Rhiza Labs FluTracker Forum

The place to discuss the flu
It is currently Fri Oct 20, 2017 8:22 am

All times are UTC - 5 hours [ DST ]




Post new topic Reply to topic  [ 6 posts ] 
Author Message
PostPosted: Wed Sep 24, 2014 3:20 pm 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
In 2014 there have only been 2 reported H3N2v cases. Both were in Ohio (A/Ohio/02/2014 & A/Ohio/4319/2014), but they were not epidemiologically linked (collection dates 8/05 and 8/27, respectively). Sequences from the original samples from both cases matched (0-2 differences) in all eight gene segments, signaling clonal expansion, even though the constellation was novel and had never been previously reported in humans.

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Wed Sep 24, 2014 3:27 pm 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
A/Ohio/02/2014 week 33 FluView description:
Novel Influenza A Viruses:
One human infection with a novel influenza A virus was reported by Ohio. The person was infected with an influenza A (H3N2) variant (H3N2v) virus and was hospitalized as a result of H3N2v illness, but has completely recovered. No ongoing human-to-human transmission has been identified and the case reported close contact with swine in the week prior to illness onset. Public health and agriculture officials are investigating the extent of disease among humans and swine and no increases in influenza-like illness in the community have been reported. Genetic sequencing of the H3N2v virus conducted at CDC showed that this virus has the nucleoprotein (NP) and the matrix (M) gene from the 2009 H1N1 virus, which is a slightly different combination of internal genes than H3N2v viruses reported in previous years. However, this H3N2v virus has the same genetic composition as influenza viruses previously isolated from swine in the U.S. this summer.

http://www.cdc.gov/flu/weekly/weeklyarc ... kly33.html

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Wed Sep 24, 2014 3:31 pm 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
CDC FluView week 34 description of A/Ohio/4319/2014
Novel Influenza A Viruses:
One new human infection with a novel influenza A virus was reported by Ohio. The person was infected with an influenza A (H3N2) variant (H3N2v) virus and was not hospitalized as a result of their illness. No ongoing human-to-human transmission has been identified and the case reported close contact with swine in the week prior to illness onset. Public health and agriculture officials are investigating the extent of disease among humans and swine and no increases in influenza-like illness in the community have been reported. Genetic sequencing of the H3N2v virus conducted at CDC showed that this virus has the nucleoprotein (NP) and matrix (M) gene from the 2009 H1N1 virus, and was similar to the H3N2v virus identified previously this summer. A total of two H3N2v cases have been reported in 2014 and are not epidemiologically linked.

http://www.cdc.gov/flu/weekly/weeklyarc ... kly34.html

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Wed Sep 24, 2014 3:34 pm 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
Case Count: Detected U.S. Human Infections with H3N2v by State since August 2011
Language:English
EspaƱol
ShareShare
Table 1. Case Count: Detected U.S. Human Infections with H3N2v by State since August 2011

States Reporting H3N2v Cases
Cases in 2011 Cases in 2012 Cases in 2013 Cases in 2014
Hawaii
0 1 0 0
Illinois
0 4 1 0
Indiana
2 138 14 0
Iowa
3 1 1 0
Maine
2 0 0 0
Maryland
0 12 0 0
Michigan
0 6 2 0
Minnesota
0 5 0 0
Ohio
0 107 1 2
Pennsylvania
3 11 0 0
Utah
0 1*0 0
West Virginia
2 3 0 0
Wisconsin
0 20 0 0

Total
12 309 19 2

* Case in Utah occurred in April 2012.

This chart indicates the number of CDC-reported infections with H3N2v variant influenza A viruses since August 2011 and is current as of July 16, 2014. This case count will be updated each Friday as new cases are reported.

NOTE: The state totals reported by CDC may not always be consistent with those reported by state health departments. If there is a discrepancy between these two counts, data from the state health departments should be used as the most accurate number.

Table 2. H3N2v Hospitalizations and Deaths Since July 2012*

H3N2v Hospitalizations and Deaths Since July 2012
Cases in 2012 Cases in 2013 Cases in 2014
Hospitalizations
16 1 1
Deaths
0 1 0 0
* As reported by states to CDC. This chart indicates the number of CDC-reported infections with H3N2v variant influenza A viruses since July 2012 and is current as of July 16, 2014. This case count will be not be updated again until new cases are reported.

See Reported Infections with Variant Influenza Viruses in the United States since 2005 for a complete list of human infections with all variant viruses since 2005.

http://www.cdc.gov/flu/swineflu/h3n2v-case-count.htm

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Wed Sep 24, 2014 5:27 pm 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
No swine matches at GISAID, but A/swine/North Dakota/A01104084/2014 at Genbank matches.

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Wed Sep 24, 2014 5:31 pm 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
niman wrote:
No swine matches at GISAID, but A/swine/North Dakota/A01104084/2014 at Genbank matches.

LOCUS KM361407 1701 bp cRNA linear VRL 14-SEP-2014
DEFINITION Influenza A virus (A/swine/North Dakota/A01104084/2014(H3N2))
segment 4 hemagglutinin (HA) gene, complete cds.
ACCESSION KM361407
VERSION KM361407.1 GI:682026159
KEYWORDS .
SOURCE Influenza A virus (A/swine/North Dakota/A01104084/2014(H3N2))
ORGANISM Influenza A virus (A/swine/North Dakota/A01104084/2014(H3N2))
Viruses; ssRNA negative-strand viruses; Orthomyxoviridae;
Influenzavirus A.
REFERENCE 1 (bases 1 to 1701)
CONSRTM USDA Swine Influenza Surveillance
TITLE Direct Submission
JOURNAL Submitted (18-AUG-2014) USDA, 1920 Dayton Ave., Ames, IA 50010, USA
COMMENT GenBank Accession Numbers KM361404-KM361411 represent sequences
from the 8 segments of Influenza A virus (A/swine/North
Dakota/A01104084/2014(H3N2)).
FEATURES Location/Qualifiers
source 1..1701
/organism="Influenza A virus (A/swine/North
Dakota/A01104084/2014(H3N2))"
/mol_type="viral cRNA"
/strain="A/swine/North Dakota/A01104084/2014"
/serotype="H3N2"
/isolation_source="nasal swab"
/host="swine"
/db_xref="taxon:1537089"
/segment="4"
/country="USA: North Dakota"
/collection_date="25-Jul-2014"
/note="no passage"
gene 1..1701
/gene="HA"
CDS 1..1701
/gene="HA"
/function="receptor binding and fusion protein"
/codon_start=1
/product="hemagglutinin"
/protein_id="AIN25605.1"
/db_xref="GI:682026160"
/translation="MKTIIAFSCILCQISAQKLPGNDNSMATLCLGHHAVPNGTLVKT
ITDDQIEVTNATELVQSTSKGEICSSPHQILDGKNCTLIDALLGDPHCDDFQNKKWDL
FVERSTAYSNCYPYYVPDYASLRSLVASSGTLEFTQESFNWTGVAQDGASYSCRRESE
NSFFSRLNWLYSLNYKYPALNVTMPNNDKFDKLYIWGVHHPGTDKDQTSLYIQASGRV
TVSTKWSQQTVIPNIGSRPWIRGVSSIISIYWTIVKPGDILLINSTGNLIAPRGYFKI
QSGKSSIMRSDAHIGNCNSECITPNGSIPNDKPFQNVNRITYGACPRYVKQNTLKLAT
GMRNVPEKQTRGIFGAIAGFIENGWEGMVDGWYGFRHQNSEGTGQAADLKSTQAAINQ
ITGKLNRVIKKTNEKFHQIEKEFSEVEGRIQDLERYVEDTKIDLWSYNAELLVALENQ
HTIDLTDSEMNKLFERTRKQLRENAEDMGNGCFKIYHKCDNACIGSIRNGTYDHDVYR
DEAVNNRFQIKGVQLKLGYKDWILWISFAISCFLLCAVLLGFIMWACQKGNIRCNICI
"
sig_peptide 1..48
/gene="HA"
mat_peptide 49..1035
/gene="HA"
/product="HA1"
mat_peptide 1036..1698
/gene="HA"
/product="HA2"
misc_feature 85..1698
/gene="HA"
/note="Haemagglutinin; Region: Hemagglutinin; pfam00509"
/db_xref="CDD:249917"
misc_feature 1..1701
/db_xref="IRD:IRD-A01104084.4"
ORIGIN
1 atgaagacta tcattgcttt tagctgcatc ttatgtcaga tctccgctca aaaactcccc
61 ggaaatgaca acagcatggc aacgctgtgc ctggggcatc acgcagtacc aaacggaacg
121 ttagtgaaaa caataacaga tgaccaaatt gaagtgacta atgctactga gctggtccag
181 agtacctcaa aaggtgaaat atgcagtagt cctcaccaaa tccttgatgg aaaaaattgt
241 acactgatag atgctctatt gggagaccct cattgtgatg acttccaaaa caagaaatgg
301 gacctttttg ttgaacgaag cacagcttac agcaactgtt acccttatta tgtgccggat
361 tatgcctccc ttaggtcact agttgcctca tccggcaccc tggaatttac tcaagaaagc
421 ttcaattgga ctggggttgc tcaagacgga gcaagctatt cttgcagaag ggaatctgaa
481 aacagtttct ttagtagatt gaattggtta tatagtttga attacaaata tccagcgctg
541 aacgtaacta tgccaaacaa tgacaaattt gacaaattgt acatttgggg ggtacaccac
601 ccgggtacag acaaggacca aaccagtcta tatattcaag catcagggag agttacagtc
661 tccaccaaat ggagccaaca aactgtaatc ccgaatatcg ggtctagacc ctggataagg
721 ggtgtctcca gcataataag catctattgg acaatagtaa aaccgggaga catacttttg
781 attaacagca cagggaatct aattgcccct cggggttact tcaaaataca aagtgggaaa
841 agctcaataa tgaggtcaga tgcacacatt ggcaactgca actctgaatg cattacccca
901 aatggaagca ttcccaacga caaacctttt caaaatgtaa acagaataac atatggggcc
961 tgtcccagat atgttaagca aaacactctg aaattagcaa caggaatgcg gaatgtacca
1021 gagaaacaaa ctagaggcat attcggcgca atcgcaggtt tcatagaaaa tggttgggaa
1081 gggatggtgg acggttggta tggtttcagg catcaaaact ctgaaggcac agggcaagca
1141 gcagatctta aaagcactca agcggcaatc aaccaaatca ccgggaaact aaatagggta
1201 atcaagaaga caaatgaaaa attccatcag atcgaaaaag aattctcaga agtagaaggg
1261 agaattcagg acctagagag atacgttgaa gacactaaaa tagacctctg gtcttacaac
1321 gcggagcttc ttgttgccct ggagaaccaa catacaattg atttaactga ctcagaaatg
1381 aacaaactgt tcgaaaggac aagaaagcaa ctgcgggaaa atgctgagga catgggcaat
1441 ggatgcttta aaatatatca caaatgtgac aatgcctgca taggatcaat cagaaatgga
1501 acttatgacc atgatgtata cagagacgaa gcagtaaaca atcggttcca gatcaaaggt
1561 gttcagctga agttaggata caaagattgg atcctatgga tttcctttgc catatcatgc
1621 tttttgcttt gtgctgttct gctaggattc attatgtggg catgccaaaa aggcaacatt
1681 aggtgcaaca tttgcatttg a

_________________
www.twitter.com/hniman


Top
 Profile  
 
Display posts from previous:  Sort by  
Post new topic Reply to topic  [ 6 posts ] 

All times are UTC - 5 hours [ DST ]


Who is online

Users browsing this forum: Yahoo [Bot] and 60 guests


You cannot post new topics in this forum
You cannot reply to topics in this forum
You cannot edit your posts in this forum
You cannot delete your posts in this forum
You cannot post attachments in this forum

Search for:
Jump to:  
cron
Powered by phpBB® Forum Software © phpBB Group