Rhiza Labs FluTracker Forum

The place to discuss the flu
It is currently Wed May 22, 2013 12:46 am

All times are UTC - 5 hours [ DST ]




Post new topic Reply to topic  [ 6 posts ] 
Author Message
PostPosted: Sun Apr 15, 2012 7:32 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 27362
Location: Pittsburgh, PA USA
Istituto Zooprofilattico Sperimentale delle Venezie in Padova, Italy has released an HA sequence from a duck in Iran, A/duck/Iran/VIR-5316-1/2011, collected in August of 2011. The sequence is clade 2.3.2 (Fujian wild bird), confirming another example of 2.3.2 circulating in wild birds which migrate to Europe and the Middle East.

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Sun Apr 15, 2012 7:33 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 27362
Location: Pittsburgh, PA USA
LOCUS JQ739696 1317 bp cRNA linear VRL 14-APR-2012
DEFINITION Influenza A virus (A/duck/Iran/VIR-5316-1/2011(H5N1)) segment 4
hemagglutinin (HA) gene, partial cds.
ACCESSION JQ739696
VERSION JQ739696.1 GI:383513035
KEYWORDS .
SOURCE Influenza A virus (A/duck/Iran/VIR-5316-1/2011(H5N1))
ORGANISM Influenza A virus (A/duck/Iran/VIR-5316-1/2011(H5N1))
Viruses; ssRNA negative-strand viruses; Orthomyxoviridae;
Influenzavirus A.
REFERENCE 1 (bases 1 to 1317)
AUTHORS Heidari,A., Ghafouri,A., Farshad Tehrani,F., Maghsudloo,H.,
Monne,I., Fusaro,A., Cattoli,G. and Capua,I.
TITLE Sequence analysis of H5N1 viruses isolated in Iran between August
and September 2011
JOURNAL Unpublished
REFERENCE 2 (bases 1 to 1317)
AUTHORS Heidari,A., Ghafouri,A., Farshad Tehrani,F., Maghsudloo,H.,
Monne,I., Fusaro,A., Cattoli,G. and Capua,I.
TITLE Direct Submission
JOURNAL Submitted (05-MAR-2012) OIE/FAO Reference Laboratory for Avian
Influenza and Newcastle Disease OIE Collaborating Center for
Diseases at the Human-Animal Interface, Istituto Zooprofilattico
Sperimentale delle Venezie, Viale dell'Universita 10 35020,
Legnaro, Padova, Italy
FEATURES Location/Qualifiers
source 1..1317
/organism="Influenza A virus
(A/duck/Iran/VIR-5316-1/2011(H5N1))"
/mol_type="viral cRNA"
/strain="A/duck/Iran/VIR-5316-1/2011"
/serotype="H5N1"
/host="duck"
/db_xref="taxon:1158460"
/segment="4"
/country="Iran"
/collection_date="Aug-2011"
gene <1..>1317
/gene="HA"
CDS <1..>1317
/gene="HA"
/codon_start=1
/product="hemagglutinin"
/protein_id="AFH41189.1"
/db_xref="GI:383513036"
/translation="ILEKTHNGKLCDLNGVKPLILKDCSVAGWLLGNPLCDEFINVPE
WSYIVEKANPANDLCYPGNFNDYEELKHLLSRINHFEKIQIIPKDSWSDHEASLGVSA
ACSYQGNSSFFRNVVWLIKKDNAYPTIKKGYNNTNQEDLLVLWGIHHPNDEAEQTRLY
QNPTTYISIGTSTLNQRLVPKIATRSKINGQSGRIDFFWTILKPNDAIHFESNGNFIA
PEYAYKIVKKGDSTIMKSEVEYGNCNTRCQTPIGAINSSMPFHNIHPLTIGECPKYVK
SNKLVLATGLRNSPQRERRRKRGLFGAIAGFIEGGWQGMVDGWYGYHHSNEQGSGYAA
DKESTQKAIDGVTNKVNSIIDKMNTQFEAVGREFNNLERRIENLNKKMEDGFLDVWTY
NAELLVLMENERTLDFHDSNVKNLYDKVRLQLKDNAKELGNGCFEFY"
ORIGIN
1 atactggaaa agacacacaa cgggaagctc tgcgatctaa atggggtgaa gcctctgatt
61 ttaaaagatt gtagtgtagc gggatggctc ctcggaaacc cattgtgtga cgaattcatc
121 aatgtaccag aatggtctta catagtagag aaggctaacc cagccaatga cctctgttac
181 ccagggaatt tcaacgatta tgaagaattg aaacacctat tgagcaggat aaaccatttt
241 gagaaaatac agatcatccc caaagattct tggtcagatc atgaagcctc attgggggtg
301 agtgcagcat gttcatacca gggaaattcc tccttcttca gaaatgtggt atggcttatc
361 aaaaaggaca atgcataccc aacaataaag aaaggctaca ataataccaa ccaagaagat
421 ctcttggtac tgtgggggat tcaccatcct aatgatgagg cagagcagac aaggctctat
481 caaaacccaa ccacctatat ttccattggg acatcaacac taaaccagag attggtacca
541 aaaatagcca ctagatccaa aataaacggg caaagtggca ggatagattt cttctggact
601 attttaaaac cgaatgatgc aatccacttc gagagtaatg gaaatttcat tgctccagaa
661 tatgcataca aaattgtcaa gaaaggagac tccacaatta tgaaaagtga agtggaatat
721 ggtaactgca acaccaggtg tcagactcca ataggggcga taaactctag tatgccattc
781 cacaatatac accctctcac cattggagaa tgccccaaat atgtgaaatc aaacaaatta
841 gtacttgcga ctgggctcag aaatagtcct caaagagaga gaagaagaaa aagaggactg
901 tttggagcta tagcaggttt tatagaggga ggatggcagg gaatggtaga cggttggtat
961 gggtaccacc acagcaatga gcaggggagt gggtacgctg cagacaaaga atcyacccaa
1021 aaggcaatag acggagtcac caataaggtc aactcgatca ttgacaaaat gaacactcag
1081 tttgaggccg taggaaggga atttaataac ctagagagga gaatagagaa tttaaacaag
1141 aagatggaag acggattcct agatgtttgg acttataatg ctgaacttct ggttctcatg
1201 gaaaatgaga gaactctaga cttccatgac tcaaatgtca agaaccttta cgataaggtc
1261 agactacagc ttaaggataa tgcaaaagag ttgggtaacg gttgtttcga gttctat

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Sun Apr 15, 2012 7:38 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 27362
Location: Pittsburgh, PA USA
A/duck/Iran/VIR-5316-1/2011 matches at GISAID
EPI300767 A/whooper swan/Mongolia/8/2009 (A/H5N1) segment 4 (HA) 2351.9 0.000000e+00 1302/1317 (98%)
EPI300766 A/whooper swan/Mongolia/6/2009 (A/H5N1) segment 4 (HA) 2351.9 0.000000e+00 1302/1317 (98%)
EPI300765 A/whooper swan/Mongolia/2/2009 (A/H5N1) segment 4 (HA) 2351.9 0.000000e+00 1302/1317 (98%)
EPI289700 A/whooper swan/Mongolia/9/2009 (A/H5N1) segment 4 (HA) 2351.9 0.000000e+00 1302/1317 (98%)
EPI289699 A/whooper swan/Mongolia/7/2009 (A/H5N1) segment 4 (HA) 2351.9 0.000000e+00 1302/1317 (98%)
EPI289697 A/whooper swan/Mongolia/4/2009 (A/H5N1) segment 4 (HA) 2351.9 0.000000e+00 1302/1317 (98%)
EPI289696 A/whooper swan/Mongolia/1/2009 (A/H5N1) segment 4 (HA) 2351.9 0.000000e+00 1302/1317 (98%)
EPI219391 A/whooper swan/Mongolia/8/2009 (A/H5N1) segment 4 (HA) 2351.9 0.000000e+00 1302/1317 (98%)
EPI219386 A/whooper swan/Mongolia/6/2009 (A/H5N1) segment 4 (HA) 2351.9 0.000000e+00 1302/1317 (98%)
EPI219381 A/whooper swan/Mongolia/2/2009 (A/H5N1) segment 4 (HA) 2351.9 0.000000e+00 1302/1317 (98%)
EPI356487 A/common buzzard/Bulgaria/38WB/2010 (A/H5N1) segment 4 (HA) 2346.4 0.000000e+00 1301/1317 (98%)
EPI335247 A/herring gull/Mongolia/833T/2009 (A/H5N1) segment 4 (HA) 2346.4 0.000000e+00 1301/1317 (98%)
EPI335245 A/ruddy shelduck/Mongolia/911T/2009 (A/H5N1) segment 4 (HA) 2346.4 0.000000e+00 1301/1317 (98%)
EPI328864 A/mallard/Korea/1195/2010 (A/H5N1) segment 4 (HA) 2346.4 0.000000e+00 1301/1317 (98%)
EPI300761 A/bar-headed goose/Mongolia/X53/2009 (A/H5N1) segment 4 (HA) 2346.4 0.000000e+00 1301/1317 (98%)
EPI300760 A/bar-headed goose/Mongolia/X25/2009 (A/H5N1) segment 4 (HA) 2346.4 0.000000e+00 1301/1317 (98%)
EPI289698 A/whooper swan/Mongolia/5/2009 (A/H5N1) segment 4 (HA) 2346.4 0.000000e+00 1301/1317 (98%)
EPI289695 A/ruddy shelduck/Mongolia/X42/2009 (A/H5N1) segment 4 (HA) 2346.4 0.000000e+00 1301/1317 (98%)
EPI219350 A/rubby shelduck/Mongolia/X42/2009 (A/H5N1) segment 4 (HA) 2346.4 0.000000e+00 1301/1317 (98%)
EPI219313 A/bar-headed goose/Mongolia/X54/2009 (A/H5N1) segment 4 (HA) 2346.4 0.000000e+00 1301/1317 (98%)
EPI219308 A/bar-headed goose/Mongolia/X53/2009 (A/H5N1) segment 4 (HA) 2346.4 0.000000e+00 1301/1317 (98%)
EPI219303 A/bar-headed goose/Mongolia/X25/2009 (A/H5N1) segment 4 (HA) 2346.4 0.000000e+00 1301/1317 (98%)
EPI186939 A/grebe/Tyva/3/2009 (A/H5N1) segment 4 (HA) 2346.4 0.000000e+00 1301/1317 (98%)
EPI359873 A/common Ketrel/Korea/Q197/2011 (A/H5N1) segment 4 (HA) 2340.8 0.000000e+00 1300/1317 (98%)
EPI359865 A/baikal teal/Korea/Q524/2010 (A/H5N1) segment 4 (HA) 2340.8 0.000000e+00 1300/1317 (98%)
EPI341909 A/tundra swan/Tottori/12-002/2010 (A/H5N1) segment 4 (HA) 2340.8 0.000000e+00 1300/1317 (98%)
EPI341001 A/goshawk/Tochigi/64/2011 (A/H5N1) segment 4 (HA) 2340.8 0.000000e+00 1300/1317 (98%)
EPI336762 A/chicken/Nepal/81/2010 (A/H5N1) segment 4 (HA) 2340.8 0.000000e+00 1300/1317 (98%)
EPI336761 A/chicken/Nepal/115/2010 (A/H5N1) segment 4 (HA) 2340.8 0.000000e+00 1300/1317 (98%)
EPI336758 A/chicken/Nepal/5-1cl/2010 (A/H5N1) segment 4 (HA) 2340.8 0.000000e+00 1300/1317 (98%)
EPI326390 A/duck/Hokkaido/WZ83/2010 (A/H5N1) segment 4 (HA) 2340.8 0.000000e+00 1300/1317 (98%)
EPI326382 A/duck/Hokkaido/WZ101/2010 (A/H5N1) segment 4 (HA) 2340.8 0.000000e+00 1300/1317 (98%)
EPI300764 A/common goldeneye/Mongolia/X59/2009 (A/H5N1) segment 4 (HA) 2340.8 0.000000e+00 1300/1317 (98%)
EPI300763 A/common goldeneye/Mongolia/X60/2009 (A/H5N1) segment 4 (HA) 2340.8 0.000000e+00 1300/1317 (98%)
EPI300762 A/bar-headed goose/Mongolia/X54/2009 (A/H5N1) segment 4 (HA) 2340.8 0.000000e+00 1300/1317 (98%)
EPI269984 A/whooper swan/Mongolia/21/2010 (A/H5N1) segment 4 (HA) 2340.8 0.000000e+00 1300/1317 (98%)
EPI219355 A/rubby shelduck/Mongolia/X63/2009 (A/H5N1) segment 4 (HA) 2340.8 0.000000e+00 1300/1317 (98%)
EPI219326 A/common goldeneye/Mongolia/X60/2009 (A/H5N1) segment 4 (HA) 2340.8 0.000000e+00 1300/1317 (98%)
EPI219321 A/common goldeneye/Mongolia/X59/2009 (A/H5N1) segment 4 (HA) 2340.8 0.000000e+00 1300/1317 (98%)
EPI186947 A/bean goose/Tyva/10/2009 (A/H5N1) segment 4 (HA) 2340.8 0.000000e+00 1300/1317 (98%)
EPI359890 A/whooper swan/Korea/Q28/2011 (A/H5N1) segment 4 (HA) 2335.3 0.000000e+00 1299/1317 (98%)
EPI359889 A/white fronted goose/Korea/Q27/2011 (A/H5N1) segment 4 (HA) 2335.3 0.000000e+00 1299/1317 (98%)
EPI359887 A/turkey/Korea/DDC518/2011 (A/H5N1) segment 4 (HA) 2335.3 0.000000e+00 1299/1317 (98%)
EPI359885 A/pheasant/Korea/PT411/2011 (A/H5N1) segment 4 (HA) 2335.3 0.000000e+00 1299/1317 (98%)
EPI359883 A/mandarin duck/Korea/Q2/2011 (A/H5N1) segment 4 (HA) 2335.3 0.000000e+00 1299/1317 (98%)
EPI359881 A/eurasian eagle owl/Korea/Q196/2011 (A/H5N1) segment 4 (HA) 2335.3 0.000000e+00 1299/1317 (98%)
EPI359876 A/duck/Korea/Cheonan/2010 (A/H5N1) segment 4 (HA) 2335.3 0.000000e+00 1299/1317 (98%)
EPI359874 A/duck/Korea/AS117/2011 (A/H5N1) segment 4 (HA) 2335.3 0.000000e+00 1299/1317 (98%)
EPI359870 A/chicken/Korea/PT412/2011 (A/H5N1) segment 4 (HA) 2335.3 0.000000e+00 1299/1317 (98%)
EPI359869 A/chicken/Korea/Iksan/2010 (A/H5N1) segment 4 (HA) 2335.3 0.000000e+00 1299/1317 (98%)
EPI356367 A/chicken/Miyazaki/M6/2011 (A/H5N1) segment 4 (HA) 2335.3 0.000000e+00 1299/1317 (98%)
EPI354427 A/great black-headed gull/Qinghai/3/2009 (A/H5N1) segment 4 (HA) 2335.3 0.000000e+00 1299/1317 (98%)
EPI354423 A/brown-headed gull/Qinghai/1/2009 (A/H5N1) segment 4 (HA) 2335.3 0.000000e+00 1299/1317 (98%)
EPI341914 A/mandarin duck/Oita/4402B056/2011 (A/H5N1) segment 4 (HA) 2335.3 0.000000e+00 1299/1317 (98%)
EPI341911 A/mandarin duck/Kochi/3901C005/2011 (A/H5N1) segment 4 (HA) 2335.3 0.000000e+00 1299/1317 (98%)
EPI325623 A/Mallard duck/Korea/W404/2011 (A/H5N1) segment 4 (HA) 2335.3 0.000000e+00 1299/1317 (98%)
EPI314813 A/mandarin duck/Korea/K10-515/2011 (A/H5N1) segment 4 (HA) 2335.3 0.000000e+00 1299/1317 (98%)
EPI314812 A/mandarin duck/Korea/K10-485/2010 (A/H5N1) segment 4 (HA) 2335.3 0.000000e+00 1299/1317 (98%)
EPI314811 A/mandarin duck/Korea/K10-483/2010 (A/H5N1) segment 4 (HA) 2335.3 0.000000e+00 1299/1317 (98%)
EPI308986 A/peregrine falcon/Tochigi/15/2011 (A/H5N1) segment 4 (HA) 2335.3 0.000000e+00 1299/1317 (98%)
EPI359884 A/mandarin duck/Korea/Q525/2010 (A/H5N1) segment 4 (HA) 2329.7 0.000000e+00 1298/1317 (98%)
EPI359871 A/chicken/Korea/SJ378/2011 (A/H5N1) segment 4 (HA) 2329.7 0.000000e+00 1298/1317 (98%)
EPI359861 A/eurasian eagle owl/Korea/Q178/2011 (A/H5N1) segment 4 (HA) 2329.7 0.000000e+00 1298/1317 (98%)
EPI356371 A/chicken/Mie/1/2011 (A/H5N1) segment 4 (HA) 2329.7 0.000000e+00 1298/1317 (98%)
EPI354431 A/great cormorant/Qinghai/1/2009 (A/H5N1) segment 4 (HA) 2329.7 0.000000e+00 1298/1317 (98%)
EPI354426 A/great black-headed gull/Qinghai/2/2009 (A/H5N1) segment 4 (HA) 2329.7 0.000000e+00 1298/1317 (98%)
EPI354425 A/great black-headed gull/1/2009 (A/H5N1) segment 4 (HA) 2329.7 0.000000e+00 1298/1317 (98%)
EPI341913 A/mandarin duck/Nagasaki/4202A023/2011 (A/H5N1) segment 4 (HA) 2329.7 0.000000e+00 1298/1317 (98%)
EPI341912 A/mandarin duck/Miyazaki/22M807-1/2011 (A/H5N1) segment 4 (HA) 2329.7 0.000000e+00 1298/1317 (98%)
EPI341910 A/peregrine falcon/Aichi/2302O017/2011 (A/H5N1) segment 4 (HA) 2329.7 0.000000e+00 1298/1317 (98%)
EPI341842 A/owl/Tokushima/3602A023/2011 (A/H5N1) segment 4 (HA) 2329.7 0.000000e+00 1298/1317 (98%)
EPI336759 A/chicken/Nepal/105/2010 (A/H5N1) segment 4 (HA) 2329.7 0.000000e+00 1298/1317 (98%)
EPI336757 A/chicken/Nepal/2-53/2010 (A/H5N1) segment 4 (HA) 2329.7 0.000000e+00 1299/1318 (98%)
EPI325622 A/Mallard duck/Korea/W401/2011 (A/H5N1) segment 4 (HA) 2329.7 0.000000e+00 1298/1317 (98%)
EPI283257 A/great crested grebe/Tyva/22/2010 (A/H5N1) segment 4 (HA) 2329.7 0.000000e+00 1298/1317 (98%)
EPI269982 A/whooper swan/Mongolia/11/2010 (A/H5N1) segment 4 (HA) 2329.7 0.000000e+00 1298/1317 (98%)
EPI359886 A/quail/Korea/GC395/2011 (A/H5N1) segment 4 (HA) 2324.2 0.000000e+00 1297/1317 (98%)
EPI359879 A/duck/Korea/YA54/2011 (A/H5N1) segment 4 (HA) 2324.2 0.000000e+00 1297/1317 (98%)
EPI359867 A/chicken/Korea/IC546/2011 (A/H5N1) segment 4 (HA) 2324.2 0.000000e+00 1297/1317 (98%)
EPI359866 A/chicken/Korea/Asan90/2011 (A/H5N1) segment 4 (HA) 2324.2 0.000000e+00 1297/1317 (98%)
EPI341908 A/hooded crane/Kagoshima/4612J008/2010 (A/H5N1) segment 4 (HA) 2324.2 0.000000e+00 1297/1317 (98%)
EPI340854 A/tufted duck/Fukushima/4/2011 (A/H5N1) segment 4 (HA) 2324.2 0.000000e+00 1297/1317 (98%)
EPI340387 A/tufted duck/Fukushima/5/2011 (A/H5N1) segment 4 (HA) 2324.2 0.000000e+00 1297/1317 (98%)
EPI340379 A/tufted duck/Fukushima/7/2011 (A/H5N1) segment 4 (HA) 2324.2 0.000000e+00 1297/1317 (98%)
EPI336767 A/duck/Nepal/DTS24/2010 (A/H5N1) segment 4 (HA) 2324.2 0.000000e+00 1298/1318 (98%)
EPI336764 A/chicken/Nepal/A135/2010 (A/H5N1) segment 4 (HA) 2324.2 0.000000e+00 1298/1318 (98%)
EPI336763 A/chicken/Nepal/A136/2010 (A/H5N1) segment 4 (HA) 2324.2 0.000000e+00 1298/1318 (98%)
EPI336760 A/chicken/Nepal/111/2010 (A/H5N1) segment 4 (HA) 2324.2 0.000000e+00 1297/1317 (98%)
EPI314810 A/mandarin duck/Korea/K10-480/2010 (A/H5N1) segment 4 (HA) 2324.2 0.000000e+00 1297/1317 (98%)
EPI359878 A/duck/Korea/NJ83/2011 (A/H5N1) segment 4 (HA) 2318.7 0.000000e+00 1296/1317 (98%)
EPI359872 A/chicken/Korea/YS171/2011 (A/H5N1) segment 4 (HA) 2318.7 0.000000e+00 1296/1317 (98%)
EPI359862 A/eurasian eagle owl/Korea/Q182/2011 (A/H5N1) segment 4 (HA) 2318.7 0.000000e+00 1296/1317 (98%)
EPI356370 A/chicken/Aichi/T1/2011 (A/H5N1) segment 4 (HA) 2318.7 0.000000e+00 1296/1317 (98%)
EPI354430 A/great black-headed gull/Qinghai/6/2009 (A/H5N1) segment 4 (HA) 2318.7 0.000000e+00 1296/1317 (98%)
EPI354428 A/great black-headed gull/Qinghai/4/2009 (A/H5N1) segment 4 (HA) 2318.7 0.000000e+00 1296/1317 (98%)
EPI354421 A/bar-headed goose/Qinghai/1/2010 (A/H5N1) segment 4 (HA) 2318.7 0.000000e+00 1296/1317 (98%)
EPI341871 A/tufted duck/Yamaguchi/3502B007/2011 (A/H5N1) segment 4 (HA) 2318.7 0.000000e+00 1296/1317 (98%)
EPI336768 A/duck/Nepal/DTS22/2010 (A/H5N1) segment 4 (HA) 2318.7 0.000000e+00 1297/1318 (98%)
EPI335200 A/duck/Lao/463/2010 (A/H5N1) segment 4 (HA) 2318.7 0.000000e+00 1296/1317 (98%)
EPI335193 A/duck/Lao/469/2010 (A/H5N1) segment 4 (HA) 2318.7 0.000000e+00 1296/1317 (98%)

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Sun Apr 15, 2012 9:30 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 27362
Location: Pittsburgh, PA USA
Transbound Emerg Dis. 2011 Feb;58(1):76-8. doi: 10.1111/j.1865-1682.2010.01175.x. Epub 2010 Nov 5.
First reported incursion of highly pathogenic notifiable avian influenza A H5N1 viruses from clade 2.3.2 into European poultry.
Reid SM, Shell WM, Barboi G, Onita I, Turcitu M, Cioranu R, Marinova-Petkova A, Goujgoulova G, Webby RJ, Webster RG, Russell C, Slomka MJ, Hanna A, Banks J, Alton B, Barrass L, Irvine RM, Brown IH.
SourceOIE, FAO, Veterinary Laboratories Agency-Weybridge, Addlestone, Surrey, UK. s.reid@vla.defra.gsi.gov.uk

Abstract
This study reports the first incursion into European poultry of H5N1 highly pathogenic notifiable avian influenza A (HPNAI) viruses from clade 2.3.2 that affected domestic poultry and wild birds in Romania and Bulgaria, respectively. Previous occurrences in Europe of HPNAI H5N1 in these avian populations have involved exclusively viruses from clade 2.2. This represents the most westerly spread of clade 2.3.2 viruses, which have shown an apparently expanding range of geographical dispersal since mid-2009 following confirmation of infections in wild waterfowl species in Mongolia and Eastern Russia. During March 2010, AI infection was suspected at post-mortem examination of two hens from two backyard flocks in Tulcea Country, Romania. HPNAI of H5N1 subtype was confirmed by reverse transcription polymerase chain reaction (RT-PCR). A second outbreak was confirmed 2 weeks later by RT-PCR, affecting all hens from another flock located 55 km east of the first cluster. On the same day, an H5N1 HPNAI virus was detected from a pooled tissue sample collected from a dead Common Buzzard found on the Black Sea coast in Bulgaria. Detailed genetic characterization of the haemagglutinin gene revealed the cleavage site of the isolates to be consistent with viruses of high pathogenicity belonging to clade 2.3.2 of the contemporary Eurasian H5N1 lineage. Viruses from a clade other than 2.2 have apparently spread to wild birds, with potential maintenance and spread through such populations. Whilst the scale of threat posed by the apparent westward spread of the clade 2.3.2 viruses remains uncertain, ongoing vigilance for clinical signs of disease as part of existing passive surveillance frameworks for AI, and the prompt reporting of suspect cases in poultry is advised.

http://www.ncbi.nlm.nih.gov/pubmed/21054819

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Sun Apr 15, 2012 9:31 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 27362
Location: Pittsburgh, PA USA
LOCUS CY110854 1700 bp cRNA linear VRL 29-FEB-2012
DEFINITION Influenza A virus (A/common buzzard/Bulgaria/38WB/2010(H5N1))
hemagglutinin (HA) gene, partial cds.
ACCESSION CY110854
VERSION CY110854.1 GI:378829249
KEYWORDS .
SOURCE Influenza A virus (A/common buzzard/Bulgaria/38WB/2010(H5N1))
ORGANISM Influenza A virus (A/common buzzard/Bulgaria/38WB/2010(H5N1))
Viruses; ssRNA negative-strand viruses; Orthomyxoviridae;
Influenzavirus A.
REFERENCE 1 (bases 1 to 1700)
AUTHORS Marinova-Petkova,A., Franks,J.S., Darnell,D. and Webster,R.G.
TITLE The intercontinental spread of clade 2.3.2 H5N1 influenza viruses
to Bulgaria in the Common Buzzard
JOURNAL Unpublished
REFERENCE 2 (bases 1 to 1700)
AUTHORS Marinova-Petkova,A., Franks,J.S., Darnell,D. and Webster,R.G.
TITLE Direct Submission
JOURNAL Submitted (29-FEB-2012) Regional Diagnostic Laboratory on Avian
Influenza and Newcastle Disease in birds, National Diagnostic &
Research Veterinary Medical Institute, 2 Batova str, Aksakovo,
Varna 9154, Bulgaria
FEATURES Location/Qualifiers
source 1..1700
/organism="Influenza A virus (A/common
buzzard/Bulgaria/38WB/2010(H5N1))"
/mol_type="viral cRNA"
/strain="A/common buzzard/Bulgaria/38WB/2010"
/serotype="H5N1"
/host="common buzzard"
/db_xref="taxon:1156386"
/segment="4"
/country="Bulgaria"
/collection_date="Mar-2010"
misc_feature 1..1700
/db_xref="IRD:CEIRS-SJC001-AMP0001.4"
gene <1..1656
/gene="HA"
CDS <1..1656
/gene="HA"
/function="receptor binding and fusion protein"
/codon_start=1
/product="hemagglutinin"
/protein_id="AFC60802.1"
/db_xref="GI:378829250"
/translation="DHICIGYHANNSTEQVDTIMEKNVTVTHAQDILEKTHNGKLCDL
NGVKPLILKDCSVAGWLLGNPLCDEFINVPEWSYIVEKANPANDLCYPGNFNDYEELK
HLLSRINHFEKIQIIPKDSWSDHEASLGVSAACSYQGNSSFFRNVVWLIKKDNAYPTI
KKGYNNTNQEDLLVLWGIHHPNDEAEQTRLYQNPITYISIGTSTLNQRLVPKIATRSK
INGQSGRIDFFWTILKPNDAIHFESNGNFIAPEYAYKIVKKGDSTIMKSEVEYGNCNT
RCQTPIGAINSSMPFHNIHPLTIGECPKYVKSNKLVLATGLRNSPQRERRRKRGLFGA
IAGFIEGGWQGMVDGWYGYHHSNEQGSGYAADKESTQKAIDGVTNKVNSIIDKMNTQF
EAVGREFNNLERRIENLNKKMEDGFLDVWTYNAELLVLMENERTLDFHDSNVKNLYDK
VRLQLKDNAKELGNGCFEFYHKCNNECMESVRNGTYDYPQYSEEARLKREEISGVKLE
SIGIYQILSIYSTVASSLVLAIMMAGLSLWMCSNGSLQCRICI"
mat_peptide 1..987
/gene="HA"
/product="HA1"
mat_peptide 988..1653
/gene="HA"
/product="HA2"
ORIGIN
1 gatcatattt gcattggtta tcatgcaaat aactcgacag agcaggttga cacaataatg
61 gaaaagaacg ttactgttac acatgcccaa gacatactgg aaaagacaca caacgggaag
121 ctctgcgatc taaatggagt gaagcctctg attttgaaag attgtagtgt agcgggatgg
181 ctcctcggaa acccattgtg tgacgaattc atcaatgtgc cagaatggtc ttacatagta
241 gagaaggcca atccagccaa tgacctctgt tacccaggga atttcaacga ttatgaagaa
301 ttgaaacacc tattgagcag gataaaccat tttgagaaaa tacagatcat ccccaaagat
361 tcttggtcag atcatgaagc ctcattgggg gtgagtgcag catgttcata ccagggaaat
421 tcctccttct tcagaaatgt ggtatggctt atcaaaaagg acaatgcata cccaacaata
481 aagaaaggct acaataatac caaccaagaa gatctcttgg tactgtgggg gattcaccat
541 cctaatgatg aggcagagca gacaaggctc tatcaaaacc caatcaccta tatttccatt
601 gggacatcaa cactaaacca gagattggta ccaaaaatag ccactagatc caaaataaac
661 gggcaaagtg gcaggataga tttcttctgg acaattttaa aaccgaatga tgcaatccac
721 ttcgagagta atggaaattt cattgctcca gaatatgcat acaaaattgt caagaaagga
781 gactccacaa ttatgaaaag tgaagtggaa tatggtaact gcaacaccag gtgtcagact
841 ccgatagggg cgataaactc tagtatgcca ttccacaaca tacaccctct caccatcgga
901 gaatgcccca aatatgtgaa atcaaacaaa ttagtccttg cgactgggct cagaaatagt
961 cctcaaagag agagaagaag aaaaagagga ctgtttggag ctatagcagg ttttatagag
1021 ggaggatggc agggaatggt agatggttgg tatgggtacc accacagcaa tgagcagggg
1081 agtgggtacg ctgcagacaa agaatctact caaaaggcaa tagacggagt caccaataag
1141 gtcaactcga tcattgacaa aatgaacact cagtttgagg ccgtaggaag ggaatttaat
1201 aacttagaga ggagaataga gaatttaaac aagaagatgg aagacggatt cctagatgtt
1261 tggacttata atgctgaact tctggttctc atggaaaatg agagaactct agacttccat
1321 gactcaaatg tcaagaacct ttacgataag gtcagactac agcttaaaga taatgcaaaa
1381 gagttgggta acggttgttt cgagttctat cacaaatgta ataatgaatg tatggaaagt
1441 gtaagaaacg gaacgtatga ctacccgcag tattcagaag aagcaagatt aaaaagagag
1501 gaaataagtg gagtaaaatt ggaatcaata ggaatctacc aaatactgtc aatttattca
1561 acagtggcga gttccctagt gctggcaatc atgatggctg gtctgtcttt atggatgtgt
1621 tccaacgggt cgttacagtg cagaatttgc atttaagttt gtgagttcaa attgtagtta
1681 aaaacaccct tgtttctact

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Sun Apr 15, 2012 9:33 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 27362
Location: Pittsburgh, PA USA
EPI356487 A/common buzzard/Bulgaria/38WB/2010 (A/H5N1) segment 4 (HA) 3140.4 0.000000e+00 1700/1700 (100%)
EPI300765 A/whooper swan/Mongolia/2/2009 (A/H5N1) segment 4 (HA) 3099.8 0.000000e+00 1693/1700 (99%)
EPI289695 A/ruddy shelduck/Mongolia/X42/2009 (A/H5N1) segment 4 (HA) 3096.1 0.000000e+00 1692/1700 (99%)
EPI300764 A/common goldeneye/Mongolia/X59/2009 (A/H5N1) segment 4 (HA) 3090.6 0.000000e+00 1691/1700 (99%)
EPI300761 A/bar-headed goose/Mongolia/X53/2009 (A/H5N1) segment 4 (HA) 3090.6 0.000000e+00 1692/1701 (99%)
EPI354427 A/great black-headed gull/Qinghai/3/2009 (A/H5N1) segment 4 (HA) 3085.0 0.000000e+00 1690/1700 (99%)
EPI354423 A/brown-headed gull/Qinghai/1/2009 (A/H5N1) segment 4 (HA) 3085.0 0.000000e+00 1690/1700 (99%)
EPI300763 A/common goldeneye/Mongolia/X60/2009 (A/H5N1) segment 4 (HA) 3085.0 0.000000e+00 1690/1700 (99%)
EPI354431 A/great cormorant/Qinghai/1/2009 (A/H5N1) segment 4 (HA) 3079.5 0.000000e+00 1689/1700 (99%)
EPI186939 A/grebe/Tyva/3/2009 (A/H5N1) segment 4 (HA) 3077.6 0.000000e+00 1680/1687 (99%)
EPI300767 A/whooper swan/Mongolia/8/2009 (A/H5N1) segment 4 (HA) 3075.8 0.000000e+00 1680/1687 (99%)
EPI354425 A/great black-headed gull/1/2009 (A/H5N1) segment 4 (HA) 3073.9 0.000000e+00 1688/1700 (99%)
EPI354421 A/bar-headed goose/Qinghai/1/2010 (A/H5N1) segment 4 (HA) 3073.9 0.000000e+00 1688/1700 (99%)
EPI354430 A/great black-headed gull/Qinghai/6/2009 (A/H5N1) segment 4 (HA) 3068.4 0.000000e+00 1687/1700 (99%)
EPI354428 A/great black-headed gull/Qinghai/4/2009 (A/H5N1) segment 4 (HA) 3068.4 0.000000e+00 1687/1700 (99%)
EPI354426 A/great black-headed gull/Qinghai/2/2009 (A/H5N1) segment 4 (HA) 3068.4 0.000000e+00 1687/1700 (99%)
EPI289697 A/whooper swan/Mongolia/4/2009 (A/H5N1) segment 4 (HA) 3068.4 0.000000e+00 1673/1679 (99%)
EPI219391 A/whooper swan/Mongolia/8/2009 (A/H5N1) segment 4 (HA) 3068.4 0.000000e+00 1673/1679 (99%)
EPI219381 A/whooper swan/Mongolia/2/2009 (A/H5N1) segment 4 (HA) 3068.4 0.000000e+00 1673/1679 (99%)
EPI289700 A/whooper swan/Mongolia/9/2009 (A/H5N1) segment 4 (HA) 3066.6 0.000000e+00 1672/1678 (99%)
EPI335247 A/herring gull/Mongolia/833T/2009 (A/H5N1) segment 4 (HA) 3064.7 0.000000e+00 1673/1680 (99%)
EPI300762 A/bar-headed goose/Mongolia/X54/2009 (A/H5N1) segment 4 (HA) 3064.7 0.000000e+00 1679/1689 (99%)
EPI185240 A/great crested grebe/Tyva/120/2009 (A/H5N1) segment 4 (HA) 3062.9 0.000000e+00 1686/1700 (99%)
EPI186947 A/bean goose/Tyva/10/2009 (A/H5N1) segment 4 (HA) 3061.0 0.000000e+00 1677/1687 (99%)
EPI335245 A/ruddy shelduck/Mongolia/911T/2009 (A/H5N1) segment 4 (HA) 3059.2 0.000000e+00 1672/1680 (99%)
EPI219350 A/rubby shelduck/Mongolia/X42/2009 (A/H5N1) segment 4 (HA) 3059.2 0.000000e+00 1672/1680 (99%)
EPI219313 A/bar-headed goose/Mongolia/X54/2009 (A/H5N1) segment 4 (HA) 3059.2 0.000000e+00 1672/1680 (99%)
EPI219308 A/bar-headed goose/Mongolia/X53/2009 (A/H5N1) segment 4 (HA) 3059.2 0.000000e+00 1672/1680 (99%)
EPI219303 A/bar-headed goose/Mongolia/X25/2009 (A/H5N1) segment 4 (HA) 3059.2 0.000000e+00 1672/1680 (99%)
EPI354424 A/brown-headed gull/Qinghai/2/2009 (A/H5N1) segment 4 (HA) 3057.3 0.000000e+00 1685/1700 (99%)
EPI219386 A/whooper swan/Mongolia/6/2009 (A/H5N1) segment 4 (HA) 3057.3 0.000000e+00 1667/1673 (99%)
EPI300760 A/bar-headed goose/Mongolia/X25/2009 (A/H5N1) segment 4 (HA) 3055.5 0.000000e+00 1670/1678 (99%)
EPI219355 A/rubby shelduck/Mongolia/X63/2009 (A/H5N1) segment 4 (HA) 3053.6 0.000000e+00 1671/1680 (99%)
EPI219321 A/common goldeneye/Mongolia/X59/2009 (A/H5N1) segment 4 (HA) 3053.6 0.000000e+00 1671/1680 (99%)
EPI185237 A/black-headed gull/Tyva/115/2009 (A/H5N1) segment 4 (HA) 3051.8 0.000000e+00 1684/1700 (99%)
EPI269984 A/whooper swan/Mongolia/21/2010 (A/H5N1) segment 4 (HA) 3048.1 0.000000e+00 1670/1680 (99%)
EPI269982 A/whooper swan/Mongolia/11/2010 (A/H5N1) segment 4 (HA) 3048.1 0.000000e+00 1670/1680 (99%)
EPI219326 A/common goldeneye/Mongolia/X60/2009 (A/H5N1) segment 4 (HA) 3048.1 0.000000e+00 1670/1680 (99%)
EPI341001 A/goshawk/Tochigi/64/2011 (A/H5N1) segment 4 (HA) 3042.6 0.000000e+00 1669/1680 (99%)
EPI326390 A/duck/Hokkaido/WZ83/2010 (A/H5N1) segment 4 (HA) 3042.6 0.000000e+00 1669/1680 (99%)
EPI326382 A/duck/Hokkaido/WZ101/2010 (A/H5N1) segment 4 (HA) 3042.6 0.000000e+00 1669/1680 (99%)
EPI283257 A/great crested grebe/Tyva/22/2010 (A/H5N1) segment 4 (HA) 3042.6 0.000000e+00 1667/1677 (99%)
EPI341911 A/mandarin duck/Kochi/3901C005/2011 (A/H5N1) segment 4 (HA) 3037.0 0.000000e+00 1668/1680 (99%)
EPI341909 A/tundra swan/Tottori/12-002/2010 (A/H5N1) segment 4 (HA) 3037.0 0.000000e+00 1668/1680 (99%)
EPI308986 A/peregrine falcon/Tochigi/15/2011 (A/H5N1) segment 4 (HA) 3037.0 0.000000e+00 1668/1680 (99%)
EPI289699 A/whooper swan/Mongolia/7/2009 (A/H5N1) segment 4 (HA) 3037.0 0.000000e+00 1654/1659 (99%)
EPI341914 A/mandarin duck/Oita/4402B056/2011 (A/H5N1) segment 4 (HA) 3031.5 0.000000e+00 1667/1680 (99%)
EPI341910 A/peregrine falcon/Aichi/2302O017/2011 (A/H5N1) segment 4 (HA) 3031.5 0.000000e+00 1667/1680 (99%)
EPI341842 A/owl/Tokushima/3602A023/2011 (A/H5N1) segment 4 (HA) 3031.5 0.000000e+00 1667/1680 (99%)
EPI354432 A/great crested grebe/Qinghai/1/2010 (A/H5N1) segment 4 (HA) 3029.6 0.000000e+00 1680/1700 (98%)
EPI335442 A/environment/Chang Sha/1/2009 (A/H5N1) segment 4 (HA) 3027.8 0.000000e+00 1669/1684 (99%)
EPI289698 A/whooper swan/Mongolia/5/2009 (A/H5N1) segment 4 (HA) 3027.8 0.000000e+00 1653/1660 (99%)
EPI341913 A/mandarin duck/Nagasaki/4202A023/2011 (A/H5N1) segment 4 (HA) 3025.9 0.000000e+00 1666/1680 (99%)
EPI341912 A/mandarin duck/Miyazaki/22M807-1/2011 (A/H5N1) segment 4 (HA) 3025.9 0.000000e+00 1666/1680 (99%)
EPI341908 A/hooded crane/Kagoshima/4612J008/2010 (A/H5N1) segment 4 (HA) 3025.9 0.000000e+00 1666/1680 (99%)
EPI340854 A/tufted duck/Fukushima/4/2011 (A/H5N1) segment 4 (HA) 3025.9 0.000000e+00 1666/1680 (99%)
EPI340387 A/tufted duck/Fukushima/5/2011 (A/H5N1) segment 4 (HA) 3025.9 0.000000e+00 1666/1680 (99%)
EPI340379 A/tufted duck/Fukushima/7/2011 (A/H5N1) segment 4 (HA) 3025.9 0.000000e+00 1666/1680 (99%)
EPI318122 A/peregrine falcon/Aomori/7/2011 (A/H5N1) segment 4 (HA) 3020.4 0.000000e+00 1665/1680 (99%)
EPI318107 A/duck/Fukushima/16/2011 (A/H5N1) segment 4 (HA) 3020.4 0.000000e+00 1665/1680 (99%)
EPI341879 A/common pochard/Shimane/5502B024/2011 (A/H5N1) segment 4 (HA) 3014.9 0.000000e+00 1664/1680 (99%)
EPI318109 A/whistling swan/Fukushima/207/2011 (A/H5N1) segment 4 (HA) 3014.9 0.000000e+00 1664/1680 (99%)
EPI307960 A/tufted duck/Fukushima/2/2011 (A/H5N1) segment 4 (HA) 3014.9 0.000000e+00 1664/1680 (99%)
EPI300766 A/whooper swan/Mongolia/6/2009 (A/H5N1) segment 4 (HA) 3013.0 0.000000e+00 1641/1646 (99%)
EPI335441 A/environment/Chang Sha/2/2009 (A/H5N1) segment 4 (HA) 3011.2 0.000000e+00 1666/1684 (98%)
EPI296699 A/grebe/Tyva/2/2010 (A/H5N1) segment 4 (HA) 3011.2 0.000000e+00 1668/1687 (98%)
EPI341871 A/tufted duck/Yamaguchi/3502B007/2011 (A/H5N1) segment 4 (HA) 3009.3 0.000000e+00 1663/1680 (98%)
EPI341827 A/great drested grebe/Hyogo/2802E082/2011 (A/H5N1) segment 4 (HA) 3009.3 0.000000e+00 1663/1680 (98%)
EPI341819 A/peregrine falcon/Kyoto/2602A009/2011 (A/H5N1) segment 4 (HA) 3009.3 0.000000e+00 1663/1680 (98%)
EPI340761 A/whooper swan/Hokkaido/6/2011 (A/H5N1) segment 4 (HA) 3009.3 0.000000e+00 1663/1680 (98%)
EPI340395 A/whooper swan/Hokkaido/3/2011 (A/H5N1) segment 4 (HA) 3009.3 0.000000e+00 1663/1680 (98%)
EPI340365 A/pintail/Hokkaido/1/2011 (A/H5N1) segment 4 (HA) 3009.3 0.000000e+00 1663/1680 (98%)
EPI318117 A/whooper swan/Hokkaido/13-21/2011 (A/H5N1) segment 4 (HA) 3009.3 0.000000e+00 1663/1680 (98%)
EPI318115 A/whooper swan/Hokkaido/A13/2011 (A/H5N1) segment 4 (HA) 3009.3 0.000000e+00 1663/1680 (98%)
EPI318113 A/whooper swan/Hokkaido/13-27/2011 (A/H5N1) segment 4 (HA) 3009.3 0.000000e+00 1663/1680 (98%)
EPI318111 A/duck/Hokkaido/28/2011 (A/H5N1) segment 4 (HA) 3009.3 0.000000e+00 1663/1680 (98%)
EPI314753 A/duck/Hokkaido/2/2011 (A/H5N1) segment 4 (HA) 3009.3 0.000000e+00 1663/1680 (98%)
EPI314751 A/whooper swan/Hokkaido/6/2011 (A/H5N1) segment 4 (HA) 3009.3 0.000000e+00 1663/1680 (98%)
EPI314749 A/duck/Hokkaido/1/2011 (A/H5N1) segment 4 (HA) 3009.3 0.000000e+00 1663/1680 (98%)
EPI314194 A/whooper swan/Hokkaido/3/2011 (A/H5N1) segment 4 (HA) 3009.3 0.000000e+00 1663/1680 (98%)
EPI307499 A/whooper swan/Hokkaido/4/2011 (A/H5N1) segment 4 (HA) 3009.3 0.000000e+00 1663/1680 (98%)
EPI355250 A/whooper swan/Hamanaka/2011 (A/H5N1) segment 4 (HA) 3007.5 0.000000e+00 1662/1679 (98%)
EPI359865 A/baikal teal/Korea/Q524/2010 (A/H5N1) segment 4 (HA) 3003.8 0.000000e+00 1646/1656 (99%)
EPI336758 A/chicken/Nepal/5-1cl/2010 (A/H5N1) segment 4 (HA) 3003.8 0.000000e+00 1646/1656 (99%)
EPI336762 A/chicken/Nepal/81/2010 (A/H5N1) segment 4 (HA) 3001.9 0.000000e+00 1645/1655 (99%)
EPI336761 A/chicken/Nepal/115/2010 (A/H5N1) segment 4 (HA) 3000.1 0.000000e+00 1644/1654 (99%)
EPI335440 A/environment/Chang Sha/3/2009 (A/H5N1) segment 4 (HA) 3000.1 0.000000e+00 1664/1684 (98%)
EPI359887 A/turkey/Korea/DDC518/2011 (A/H5N1) segment 4 (HA) 2998.2 0.000000e+00 1645/1656 (99%)
EPI359885 A/pheasant/Korea/PT411/2011 (A/H5N1) segment 4 (HA) 2998.2 0.000000e+00 1645/1656 (99%)
EPI359873 A/common Ketrel/Korea/Q197/2011 (A/H5N1) segment 4 (HA) 2998.2 0.000000e+00 1645/1656 (99%)
EPI359870 A/chicken/Korea/PT412/2011 (A/H5N1) segment 4 (HA) 2998.2 0.000000e+00 1645/1656 (99%)
EPI325623 A/Mallard duck/Korea/W404/2011 (A/H5N1) segment 4 (HA) 2998.2 0.000000e+00 1645/1656 (99%)
EPI314813 A/mandarin duck/Korea/K10-515/2011 (A/H5N1) segment 4 (HA) 2998.2 0.000000e+00 1645/1656 (99%)
EPI314812 A/mandarin duck/Korea/K10-485/2010 (A/H5N1) segment 4 (HA) 2998.2 0.000000e+00 1645/1656 (99%)
EPI314811 A/mandarin duck/Korea/K10-483/2010 (A/H5N1) segment 4 (HA) 2998.2 0.000000e+00 1645/1656 (99%)
EPI267938 A/whooper swan/Mongolia/7/2010 (A/H5N1) segment 4 (HA) 2998.2 0.000000e+00 1661/1680 (98%)
EPI356367 A/chicken/Miyazaki/M6/2011 (A/H5N1) segment 4 (HA) 2994.5 0.000000e+00 1643/1654 (99%)
EPI359890 A/whooper swan/Korea/Q28/2011 (A/H5N1) segment 4 (HA) 2992.7 0.000000e+00 1644/1656 (99%)
EPI359884 A/mandarin duck/Korea/Q525/2010 (A/H5N1) segment 4 (HA) 2992.7 0.000000e+00 1644/1656 (99%)
EPI359881 A/eurasian eagle owl/Korea/Q196/2011 (A/H5N1) segment 4 (HA) 2992.7 0.000000e+00 1644/1656 (99%)

_________________
www.twitter.com/hniman


Top
 Profile  
 
Display posts from previous:  Sort by  
Post new topic Reply to topic  [ 6 posts ] 

All times are UTC - 5 hours [ DST ]


Who is online

Users browsing this forum: gjs0708, issapharma and 62 guests


You cannot post new topics in this forum
You cannot reply to topics in this forum
You cannot edit your posts in this forum
You cannot delete your posts in this forum
You cannot post attachments in this forum

Search for:
Jump to:  
Powered by phpBB® Forum Software © phpBB Group