Rhiza Labs FluTracker Forum

The place to discuss the flu
It is currently Sun May 26, 2013 5:27 am

All times are UTC - 5 hours [ DST ]




Post new topic Reply to topic  [ 33 posts ]  Go to page 1, 2, 3, 4  Next
Author Message
PostPosted: Mon Mar 26, 2012 8:17 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 27559
Location: Pittsburgh, PA USA
Animal, Plant and Fisheries Quarantine and Inspection Agency in South Korea has released a series of H5N1 clade 2.3.2 sequences from wild birds demonstrating recombination.

Volume 18, Number 3—March 2012
Dispatch
Highly Pathogenic Avian Influenza (H5N1) Outbreaks in Wild Birds and Poultry, South Korea

Hye-Ryoung Kim, Youn-Jeong Lee, Choi-Kyu Park, Jae-Ku Oem, O-Soo Lee, Hyun-Mi Kang, Jun-Gu Choi, and You-Chan Bae
Author affiliations: Animal, Plant and Fisheries Quarantine and Inspection Agency, Anyang, South Korea

http://wwwnc.cdc.gov/eid/article/18/3/1 ... rticle.htm

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Mon Mar 26, 2012 8:20 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 27559
Location: Pittsburgh, PA USA
Abstract
Highly pathogenic avian influenza (H5N1) among wild birds emerged simultaneously with outbreaks in domestic poultry in South Korea during November 2010–May 2011. Phylogenetic analysis showed that these viruses belonged to clade 2.3.2, as did viruses found in Mongolia, the People’s Republic of China, and Russia in 2009 and 2010.

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Mon Mar 26, 2012 8:24 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 27559
Location: Pittsburgh, PA USA
Since 2003, highly pathogenic influenza (HPAI) virus subtype H5N1 has become enzootic in some countries and continues to cause outbreaks in poultry and sporadic cases of infection in humans, thus posing a persistent potential pandemic threat (1). Wild birds, especially waterfowl of the order Anseriformes (ducks, geese, and swans) are the natural reservoir of low pathogenicity avian influenza viruses, and since the HPAI outbreak at Lake Qinghai, People’s Republic of China, in 2005, they have been suspected of playing a role as long-distance vectors of HPAI viruses (2,3).

Three previous outbreaks in South Korea are assumed, on the basis of epidemiologic evidence, to have been caused by HPAI (H5N1) viruses introduced by migratory birds, although a carcass or moribund wild bird infected with these viruses (which would serve as a link to the introduction of infection in domestic poultry) was not found (4–6). On December 7, 2010, an HPAI (H5N1) virus was isolated from a healthy mallard in South Korea (7). After that, subtype H5N1 viruses were frequently detected in wild birds and poultry until May 2011. In this study, we analyzed the epidemiologic features of this outbreak and investigated the characteristics of strains through genetic analysis.

The Study
Figure 1


Figure 1. Progress of highly pathogenic avian influenza (HPAI) outbreak by time, South Korea, 2010–2011. A) HPAI-positive cases identified from samples collected November 26–December 28, 2010 (wild birds, 6 cases). B) Cases identified...

From November 26 to December 28, 2010, 6 cases of subtype H5N1 infection were identified in carcasses, feces, and cloacal swab specimens of migratory birds collected throughout South Korea. Subtype H5N1 viruses were found in various bird species (mallard, Baikal teal, mandarin duck, whooper swan, and Eurasian eagle owl) in places such as migratory bird habitats and nearby hills (Figure 1, panel A). Despite the repeated predictions from animal health authorities of poultry outbreaks and the emphasis on protection against contamination, on December 30, 2010, HPAI was confirmed on 2 poultry farms. These farms are located in the middle region of South Korea and are close (distances of 1.3 km and 0.4 km, respectively) to the migratory habitats of birds that have been positive for subtype H5N1 virus (Figure 1, panel B). During the next 2 weeks, the percentage of HPAI-positive birds increased rapidly among clustered poultry farms located in the southern region, and poultry on 23 farms and 13 wild birds were confirmed to be infected with HPAI virus (Figure 1, panel C). The HPAI outbreak spread more slowly until May 16, 2011, and an additional 30 poultry farms and 7 wild birds were confirmed to be infected with subtype H5N1 virus (Figure 1, panel D).

Fourteen bird species were found to be positive for subtype H5N1 (Table). The affected poultry included species of the order Galliformes (chickens, quail, etc.), which exhibited sudden death with severe clinical signs, and domestic ducks (order Anseriformes), which died suddenly or exhibited a decrease in egg production, depending on age. Most infected birds of species that belonged to the orders Anseriformes, Falconiformes, and Strigiformes were found dead, but a few infections were detected in swab specimens from healthy mallards and feces of wild birds. Moreover, species of Anseriformes, such as the Mandarin duck, were dominant among the wild birds with HPAI until the beginning of January 2011. After that time, many HPAI infections were found in birds of prey, such as the Eurasian eagle owl (Table).

All viruses were isolated by inoculating embryonated chicken eggs with specimens from cloacal swab specimens, feces, and homogenized organs from birds with suspected infections. The hemagglutinin (HA) and neuraminidase (NA) proteins were subtyped as previously described (6). We selected 27 viruses, taking into consideration the outbreak period, the region, and the host species (Table A1) and conducted sequencing and phylogenetic analysis of 8 gene segments. The genome sequences of 27 viruses are available from GenBank under accession numbers JN807892–JN808107.

Figure 2


Figure 2. Phylogenetic diagram of hemagglutinin (HA) gene of highly pathogenic avian influenza (H5N1) viruses, including viruses isolated in South Korea during 2010–2011. Blue indicates viruses isolated from wild birds, boldface indicates isolates...

In the HA phylogenetic tree, all 27 viruses were clustered into clade 2.3.2 HPAI viruses, together with the subtype H5N1 virus that had been isolated from a healthy mallard (7). All isolates showed a high HA homology (>99.5%) (Table A1). Of note, the isolates from poultry fell into 2 sublineages, south-middle and north-middle, which were distinct geographic regions in the HPAI outbreak among poultry, but the isolates from wild birds were not subgrouped in the phylogenetic tree, which displays only topology (Figure 2).

Figure A1


Figure A1. Phylogenetic diagram of acidic polymerase gene of highly pathogenic avian influenza (H5N1) viruses, including viruses isolated in South Korea during 2010–2011. Blue indicates viruses isolated from wild birds, boldface indicates isolates...

These isolates were different from the HPAI viruses responsible for previous outbreaks in South Korea (A/chicken/Korea/ES/2003[clade 2.5], A/chicken/Korea/IS/2006[clade 2.2] and A/chicken/Korea/Gimje/2008[clade 2.3.2]) and were closely related (>99%) to the subtype H5N1 isolates found in Mongolia, China, and Russia in 2009–2010. The phylogenetic analysis also showed that the NA and other internal genes were closely related to those of subtype H5N1 viruses found in wild birds in Mongolia, China, and Russia in 2009–2010 (Figure A1; unpub. data).

All 27 viruses characterized were highly pathogenic and had variations in the multibasic cleavage site in the HA molecule (PQRERRRKR) and a 20-aa deletion in the stalk region of NA. They did not have amino acid substitutions that conferred resistance to amantadine or oseltamivir and were associated with the increased virulence of subtype H5N1 viruses in mammalian hosts (8).

The intravenous pathogenicity test was conducted by using the A/duck/Korea/Cheonan/2010 virus, the first isolate from poultry. The intravenous pathogenicity index was 3.0 for chickens.

Conclusion
After the outbreak at Lake Qinghai, China, in 2005, the clade 2.2 viruses spread from Asia to Europe and Africa during 2005–2006 and have been circulating widely in southern Asia, the Middle East, Europe, and Africa for several years. Clade 2.3.2 viruses might spread over an extensive area, similar to clade 2.2 viruses, because clade 2.3.2 viruses are widespread among wild birds and have been continuously evolving in the regions where subtype H5N1 viruses are endemic (9). Clade 2.3.2 viruses have circulated in Vietnam and southern China since 2005, and clade 2.3.2 viruses that had undergone reassortment with clade 2.3.4 viruses were isolated from wild birds in Hong Kong in 2007. These reassorted viruses caused HPAI (H5N1) outbreaks in Japan, Russia, and South Korea during 2008 (6,10–12). New 2.3.2 viruses, reassortants that possessed a different acidic polymerase gene from the 2.3.2 viruses of 2007–2008, were isolated predominantly from migratory birds in Mongolia and China in 2009–2010 (13,14). No HPAI outbreaks occurred in South Korea and Japan in 2009, but outbreaks of a similar virus took place in both countries in late 2010 (15). The situation was analogous to outbreaks in 2 countries in 2006–2007 by clade 2.2 HPAI viruses that had been detected in China, Mongolia, and Russia in 2005. Thus, the migratory patterns of infected wild birds might be related to these outbreaks.

During the initial stage of the 2010–2011 outbreak, HPAI viruses were detected in several wild birds, and the viruses were assumed to have been introduced into domestic poultry by migratory birds. The detection of HPAI (H5N1) virus in free-ranging migratory bird might predict a poultry outbreak if biosecurity measures in poultry are inadequate, but during 2006, several European countries reported HPAI (H5N1) virus infections in wild birds without concurrent poultry outbreaks. In the 2010-2011 outbreak in South Korea, the subsequent outbreak cases suggest that the subtype H5N1 virus was spread from farm to farm by humans and associated agricultural practices so that strains of poultry were grouped in sublineages by region.

Clade 2.3.2 subtype H5N1 viruses have been circulating in poultry and migratory birds in Asia and have accumulated antigenic mutations. We can conclude that early detection of HPAI outbreaks and a rapid response to them are essential in controlling the introduction of virus from migratory birds to poultry and in preventing farm-to-farm spread.

Dr Kim is a veterinary researcher at the Animal, Plant and Fisheries Quarantine and Inspection Agency, Anyang, South Korea. Her research interests are molecular epidemiology of avian influenza virus.

Acknowledgment
This research was supported by a grant from the National Animal Disease Control Project of the Ministry of Food, Agriculture, Forest and Fisheries of South Korea.

References
1.Smith GJ, Naipospos TS, Nguyen TD, De Jong MD, Vijaykrishna D, Usman T, Evolution and adaptation of H5N1 influenza virus in avian and human hosts in Indonesia and Vietnam. Virology. 2006;350:258–68. DOIPubMed
2.Chen H, Smith G, Zhang S, Qin K, Wang J, Li K, Avian flu H5N1 virus outbreak in migratory waterfowl. Nature. 2005;436:191–2. DOIPubMed
3.Liu J, Xiao H, Lei F, Zhu Q, Qin K, Zhang XW, Highly pathogenic H5N1 influenza virus infection in migratory birds. Science. 2005;309:1206. DOIPubMed
4.Lee CW, Suarez DL, Tumpey TM, Sung HW, Kwon YK, Lee YJ, Characterization of highly pathogenic H5N1 avian influenza A viruses isolated from South Korea. J Virol. 2005;79:3692–702. DOIPubMed
5.Lee YJ, Choi YK, Kim YJ, Song MS, Jeong OM, Lee EK, Highly pathogenic avian influenza virus (H5N1) in domestic poultry and relationship with migratory birds, South Korea. Emerg Infect Dis. 2008;14:487–90. DOIPubMed
6.Kim HR, Park CK, Lee YJ, Woo GH, Lee KK, Oem JK, An outbreak of highly pathogenic H5N1 avian influenza in Korea, 2008. Vet Microbiol. 2010;141:362–6. DOIPubMed
7.Kim HR, Kim BS, Bae YC, Moon OK, Oem JK, Kang HM, H5N1 subtype highly pathogenic avian influenza virus isolated from healthy mallard captured in South Korea. Vet Microbiol. 2011;151:386–9. DOIPubMed
8.Hatta M, Gao P, Halfmann P, Kawaoka Y. Molecular basis for high virulence of Hong Kong H5N1 influenza A viruses. Science. 2001;293:1840–2. DOIPubMed
9.Jiang WM, Liu S, Chen J, Hou GY, Li JP, Cao YF, Molecular epidemiological surveys of H5 subtype highly pathogenic avian influenza viruses in poultry in China during 2007. J Gen Virol. 2010;91:2491. DOIPubMed
10.Chen H, Smith GJ, Li KS, Wang J, Fan XH, Rayner JM, Establishment of multiple sublineages of H5N1 influenza virus in Asia: implications for pandemic control. Proc Natl Acad Sci U S A. 2006;103:2845–50. DOIPubMed
11.Smith GJD, Vijaykrishna D, Ellis TM, Dyrting KC, Leung YHC, Bahl J, Characterization of avian influenza viruses A (H5N1) from wild birds, Hong Kong, 2004–2008. Emerg Infect Dis. 2009;15:402–7. DOIPubMed
12.Uchida Y, Mase M, Yoneda K, Kimura A, Obara T, Kumagai S, Highly pathogenic avian influenza virus (H5N1) isolated from whooper swans, Japan. Emerg Infect Dis. 2008;14:1427–9. DOIPubMed
13.Kang HM, Batchuluun D, Kim MC, Choi JG, Erdene-Ochir TO, Paek MR, Genetic analyses of H5N1 avian influenza virus in Mongolia, 2009 and its relationship with those of eastern Asia. Vet Microbiol. 2011;147:170–5. DOIPubMed
14.Li Y, Liu L, Zhang Y, Duan Z, Tian G, Zeng X, New avian influenza virus (H5N1) in wild birds, Qinghai, China. Emerg Infect Dis. 2011;17:265–7.PubMed
15.World Organisation for Animal Health (OIE). Update on highly pathogenic avian influenza in animals (type H5 and H7) [cited 2012 Jan 23]. http://www.oie.int/animal-health-in-the ... uenza/2011
Figures
Figure 1. Progress of highly pathogenic avian influenza (HPAI) outbreak by time, South Korea, 2010–2011. A) HPAI-positive cases identified from samples collected November 26–December 28, 2010 (wild birds, 6 cases). B)...
Figure 2. Phylogenetic diagram of hemagglutinin (HA) gene of highly pathogenic avian influenza (H5N1) viruses, including viruses isolated in South Korea during 2010–2011. Blue indicates viruses isolated from wild birds, boldface...
Figure A1. Phylogenetic diagram of acidic polymerase gene of highly pathogenic avian influenza (H5N1) viruses, including viruses isolated in South Korea during 2010–2011. Blue indicates viruses isolated from wild birds, boldface...
Tables
Table. Bird species that tested positive for highly pathogenic avian influenza subtype H5N1 in South Korea, 2010–2011
Table A1. Details of tested subtype H5N1 avian influenza viruses from wild birds and poultry, South Korea, 2010–2011
Suggested citation for this article: Kim H-R, Lee Y-J, Park C-K, Oem J-K, Lee O-S, Kang H-M, et al. Highly pathogenic avian influenza (H5N1) outbreaks in wild birds and poultry, South Korea. Emerg Infect Dis [serial on the Internet]. 2012 Mar [date cited]. http://dx.doi.org/10.3201/eid1803.111490

DOI: 10.3201/eid1803.111490

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Mon Mar 26, 2012 8:26 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 27559
Location: Pittsburgh, PA USA
HA recombinant

LOCUS JN807991 1696 bp cRNA linear VRL 24-MAR-2012
DEFINITION Influenza A virus (A/eurasian sparrowhawk/Korea/Q94/2011(H5N1))
segment 4 hemagglutinin (HA) gene, partial cds.
ACCESSION JN807991
VERSION JN807991.1 GI:353525739
KEYWORDS .
SOURCE Influenza A virus (A/eurasian sparrowhawk/Korea/Q94/2011(H5N1))
ORGANISM Influenza A virus (A/eurasian sparrowhawk/Korea/Q94/2011(H5N1))
Viruses; ssRNA negative-strand viruses; Orthomyxoviridae;
Influenzavirus A.
REFERENCE 1 (bases 1 to 1696)
AUTHORS Kim,H.R., Lee,Y.J., Park,C.K., Oem,J.K., Lee,O.S., Kang,H.M.,
Choi,J.G. and Bae,Y.C.
TITLE Highly Pathogenic Avian Influenza (H5N1) Outbreaks in Wild Birds
and Poultry, South Korea
JOURNAL Emerging Infect. Dis. 18 (3), 480-483 (2012)
PUBMED 22377052
REFERENCE 2 (bases 1 to 1696)
AUTHORS Kim,H., Lee,Y., Park,C., Oem,J., Kang,H., Choi,J., Lee,O. and
Bae,Y.
TITLE Direct Submission
JOURNAL Submitted (04-OCT-2011) Animal Disease Diagnosis Division, Animal,
Plant and Fisheries Quarantine and Inspection Agency, 175 Anyangro,
Manangu, Anyangsi, Gyeonggido 430-757, Republic of Korea
COMMENT GenBank Accession Numbers JN807904, JN807937, JN807971, JN807991,
JN808014, JN808046, JN808080, JN808082 represent sequences from the
8 segments of Influenza A virus (A/eurasian
sparrowhawk/Korea/Q94/2011(H5N1)).
FEATURES Location/Qualifiers
source 1..1696
/organism="Influenza A virus (A/eurasian
sparrowhawk/Korea/Q94/2011(H5N1))"
/mol_type="viral cRNA"
/strain="A/eurasian sparrowhawk/Korea/Q94/2011"
/serotype="H5N1"
/host="eurasian sparrowhawk"
/db_xref="taxon:1092969"
/segment="4"
/country="South Korea"
/collection_date="Jan-2011"
gene 1..>1696
/gene="HA"
CDS 1..>1696
/gene="HA"
/codon_start=1
/product="hemagglutinin"
/protein_id="AER09638.1"
/db_xref="GI:353525740"
/translation="MEKIVLLFTTISVVKSDHICVGYHANNSTEQVDTIMEKNVTVTH
AQDILEKTHNGKLCDLNGVKPLILKDCSVAGWLLGNPLCDEFINVPEWSYIVEKAKPA
NDLCYPGNFNDYEELKHLLSRINHFEKIQIIPKDSWSEHEASLGVSAACSYQGNSSFF
RNVVWLIKKDNAYPTIKKGYNNTNQEDLLVLWGIHHPNDEAEQTRLYQNPTTYISIGT
STLNQRLVPKIATRSKINGQSGRIDFFWTILKPNDAIHFESNGNFIAPEYAYKIVKKG
DSTIMKSEVEYGNCNTRCQTPIGAINSSMPFHNIHPLTIGECPKYVKSNKLVLATGLR
NSPQRERRRKRGLFGSISGSIEGGWQGIVDGWYGYHHSNEQGSGYAADKEFTQKAIDG
VTNKVNSIIDKMNTQFEAVGREFNNLERRIENLNKKMEDGFLDVWTYNAELLVLMENE
RTLDFHDSNVKNLYDKVRVQPKDNAKELGNGCVEFSHKCNNESMESVGNAMYDYPQYS
EEARLKREEINGVKLESIGIYQILSTYSTVASSLGRAIKKAGLSLWMCCNGSLQCRI"
ORIGIN
1 atggagaaaa tagtgcttct ctttacaaca atcagcgttg ttaaaagcga tcatatttgc
61 gttggttatc atgcaaataa ctcgacagag caggttgaca caataatgga aaagaacgtt
121 actgttacac atgcccaaga catactggaa aagacacaca acgggaagct ctgcgatcta
181 aatggagtga agcctctgat tttaaaagat tgtagtgtag cgggatggct cctcggaaac
241 ccattgtgtg acgaattcat caatgtgcca gaatggtctt acatagtaga gaaggccaag
301 ccagccaatg acctctgtta cccagggaat ttcaacgatt atgaagaatt gaaacaccta
361 ttgagcagga taaaccattt tgagaaaata cagatcatcc ccaaagactc ttggtcagaa
421 catgaagcct cattgggggt gagcgcagca tgttcatacc agggaaattc ctccttcttc
481 agaaatgtgg tatggcttat caaaaaggac aatgcatacc caacaataaa gaaaggctac
541 aataatacca accaagaaga tctcttggta ctgtggggga ttcaccatcc taatgatgag
601 gcagagcaga caaggctcta tcaaaaccca accacctata tttccattgg gacatcaaca
661 ctaaaccaga gattggtacc aaaaatagcc actagatcca aaataaacgg gcaaagtggc
721 aggatagatt tcttctggac aattttaaaa ccgaatgatg caatccactt cgagagtaat
781 ggaaatttca ttgctccaga atatgcatac aaaattgtca agaaaggaga ctccacaatt
841 atgaaaagtg aagtggaata tggtaactgc aacaccaggt gtcagactcc gataggggcg
901 ataaactcta gtatgccatt ccacaacata caccctctca ccatcggaga atgtcccaaa
961 tatgtgaaat caaacaaatt agtccttgcg actgggctca gaaatagtcc tcaaagagag
1021 agaagaagaa aaagaggact gtttggatct atatcaggtt ctatagaggg aggatggcag
1081 ggaatcgtag atggttggta tgggtaccac cacagcaatg agcaggggag tgggtacgct
1141 gcagacaaag aatttactca aaaggcaata gacggagtca ccaataaggt caactcgatc
1201 attgacaaaa tgaacactca gtttgaggcc gtaggaaggg aatttaataa cttagagagg
1261 agaatagaga atttaaacaa gaagatggaa gacggattcc ttgatgtttg gacttataat
1321 gctgaacttc tggttctcat ggaaaatgag agaactctag atttccatga ctcaaatgtc
1381 aagaaccttt acgataaggt cagagtacag cctaaggata acgcaaaaga gttgggtaac
1441 ggatgtgtgg agttctctca caaatgtaat aatgaaagta tggaaagtgt aggaaacgca
1501 atgtatgatt acccgcagta ttcagaagaa gcaagactaa aaagagagga aataaatgga
1561 gtaaaattgg aatcaatagg gatctaccaa atactgtcaa cttattcaac agtggcgagt
1621 tccctagggc gggcaatcaa gaaggctggt ctgtccttat ggatgtgttg caacggatcg
1681 ttacagtgca gaattt

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Mon Mar 26, 2012 8:33 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 27559
Location: Pittsburgh, PA USA
A61G

JN807986.1 Influenza A virus (A/duck/Korea/IC360/2011(H5N1)) segment 4 hemagglutinin (HA) gene, complete cds 28.2 28.2 100% 1.7 100%
JN807981.1 Influenza A virus (A/chicken/Korea/SJ378/2011(H5N1)) segment 4 hemagglutinin (HA) gene, complete cds 28.2 28.2 100% 1.7 100%
JN807991.1 Influenza A virus (A/eurasian sparrowhawk/Korea/Q94/2011(H5N1)) segment 4 hemagglutinin (HA) gene, partial cds 28.2 28.2 100% 1.7 100%
JN807989.1 Influenza A virus (A/eurasian eagle owl/Korea/Q133/2011(H5N1)) segment 4 hemagglutinin (HA) gene, complete cds 28.2 28.2 100% 1.7 100%

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Mon Mar 26, 2012 8:37 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 27559
Location: Pittsburgh, PA USA
T300G
JN807976.1 Influenza A virus (A/baikal teal/Korea/Q524/2010(H5N1)) segment 4 hemagglutinin (HA) gene, complete cds 28.2 28.2 100% 1.7 100%
JN807975.1 Influenza A virus (A/baikal teal/Korea/Q34/2011(H5N1)) segment 4 hemagglutinin (HA) gene, complete cds 28.2 28.2 100% 1.7 100%
JN807982.1 Influenza A virus (A/chicken/Korea/YS171/2011(H5N1)) segment 4 hemagglutinin (HA) gene, complete cds 28.2 28.2 100% 1.7 100%
JN807986.1 Influenza A virus (A/duck/Korea/IC360/2011(H5N1)) segment 4 hemagglutinin (HA) gene, complete cds 28.2 28.2 100% 1.7 100%
JN807990.1 Influenza A virus (A/eurasian eagle owl/Korea/Q196/2011(H5N1)) segment 4 hemagglutinin (HA) gene, complete cds 28.2 28.2 100% 1.7 100%
JN807973.1 Influenza A virus (A/eurasian eagle owl/Korea/Q178/2011(H5N1)) segment 4 hemagglutinin (HA) gene, complete cds 28.2 28.2 100% 1.7 100%
JN807981.1 Influenza A virus (A/chicken/Korea/SJ378/2011(H5N1)) segment 4 hemagglutinin (HA) gene, complete cds 28.2 28.2 100% 1.7 100%
JN807974.1 Influenza A virus (A/eurasian eagle owl/Korea/Q182/2011(H5N1)) segment 4 hemagglutinin (HA) gene, complete cds 28.2 28.2 100% 1.7 100%
JN807993.1 Influenza A virus (A/mandarin duck/Korea/Q525/2010(H5N1)) segment 4 hemagglutinin (HA) gene, complete cds 28.2 28.2 100% 1.7 100%
JN807992.1 Influenza A virus (A/mandarin duck/Korea/Q2/2011(H5N1)) segment 4 hemagglutinin (HA) gene, partial cds 28.2 28.2 100% 1.7 100%
JN807999.1 Influenza A virus (A/wild bird/Korea/IS18/2011(H5N1)) segment 4 hemagglutinin (HA) gene, complete cds 28.2 28.2 100% 1.7 100%
JN807988.1 Influenza A virus (A/duck/Korea/YA54/2011(H5N1)) segment 4 hemagglutinin (HA) gene, complete cds 28.2 28.2 100% 1.7 100%
JN807991.1 Influenza A virus (A/eurasian sparrowhawk/Korea/Q94/2011(H5N1)) segment 4 hemagglutinin (HA) gene, partial cds 28.2 28.2 100% 1.7 100%
JN807984.1 Influenza A virus (A/duck/Korea/AS117/2011(H5N1)) segment 4 hemagglutinin (HA) gene, complete cds 28.2 28.2 100% 1.7 100%
JN807978.1 Influenza A virus (A/chicken/Korea/IC546/2011(H5N1)) segment 4 hemagglutinin (HA) gene, complete cds 28.2 28.2 100% 1.7 100%
JN807985.1 Influenza A virus (A/duck/Korea/Cheonan/2010(H5N1)) segment 4 hemagglutinin (HA) gene, complete cds 28.2 28.2 100% 1.7 100%
JN807977.1 Influenza A virus (A/chicken/Korea/Asan90/2011(H5N1)) segment 4 hemagglutinin (HA) gene, complete cds 28.2 28.2 100% 1.7 100%
JN807997.1 Influenza A virus (A/white fronted goose/Korea/Q27/2011(H5N1)) segment 4 hemagglutinin (HA) gene, partial cds 28.2 28.2 100% 1.7 100%
JN807998.1 Influenza A virus (A/whooper swan/Korea/Q28/2011(H5N1)) segment 4 hemagglutinin (HA) gene, complete cds 28.2 28.2 100% 1.7 100%
JN807989.1 Influenza A virus (A/eurasian eagle owl/Korea/Q133/2011(H5N1)) segment 4 hemagglutinin (HA) gene, complete cds 28.2 28.2 100% 1.7 100%
JN807983.1 Influenza A virus (A/common Ketrel/Korea/Q197/2011(H5N1)) segment 4 hemagglutinin (HA) gene, complete cds 28.2 28.2 100% 1.7 100%
JN807987.1 Influenza A virus (A/duck/Korea/NJ83/2011(H5N1)) segment 4 hemagglutinin (HA) gene, complete cds 28.2 28.2 100% 1.7 100%
JN807995.1 Influenza A virus (A/quail/Korea/GC395/2011(H5N1)) segment 4 hemagglutinin (HA) gene, complete cds 28.2 28.2 100% 1.7 100%
JN807979.1 Influenza A virus (A/chicken/Korea/Iksan/2010(H5N1)) segment 4 hemagglutinin (HA) gene, complete cds 28.2 28.2 100% 1.7 100%
AB675741.1 Influenza A virus (A/chicken/Mie/1/2011(H5N1)) HA gene for hemagglutinin, complete cds 28.2 28.2 100% 1.7 100%
AB675739.1 Influenza A virus (A/chicken/Miyazaki/M6/2011(H5N1)) HA gene for haemagglutinin, complete cds 28.2 28.2 100% 1.7 100%
AB677931.1 Influenza A virus (A/hooded crane/Kagoshima/4612J008/2010(H5N1)) viral cRNA, segment 4, complete sequence 28.2 28.2 100% 1.7 100%
AB677923.1 Influenza A virus (A/tundra swan/Tottori/12-002/2010(H5N1)) viral cRNA, segment 4, complete sequence 28.2 28.2 100% 1.7 100%
AB677915.1 Influenza A virus (A/peregrine falcon/Aichi/2302O017/2011(H5N1)) viral cRNA, segment 4, complete sequence 28.2 28.2 100% 1.7 100%
AB677891.1 Influenza A virus (A/mandarin duck/Kochi/3901C005/2011(H5N1)) viral cRNA, segment 4, complete sequence 28.2 28.2 100% 1.7 100%
AB677875.1 Influenza A virus (A/mandarin duck/Miyazaki/22M807-1/2011(H5N1)) viral cRNA, segment 4, complete sequence 28.2 28.2 100% 1.7 100%
AB677867.1 Influenza A virus (A/mandarin duck/Nagasaki/4202A023/2011(H5N1)) viral cRNA, segment 4, complete sequence 28.2 28.2 100% 1.7 100%
AB677859.1 Influenza A virus (A/mandarin duck/Oita/4402B056/2011(H5N1)) viral cRNA, segment 4, complete sequence 28.2 28.2 100% 1.7 100%
AB677851.1 Influenza A virus (A/tufted duck/Yamaguchi/3502B007/2011(H5N1)) viral cRNA, segment 4, complete sequence 28.2 28.2 100% 1.7 100%
AB676810.1 Influenza A virus (A/goshawk/Tochigi/64/2011(H5N1)) HA gene for haemagglutinin, complete cds 28.2 28.2 100% 1.7 100%
AB612901.1 Influenza A virus (A/duck/Hokkaido/WZ83/2010(H5N1)) viral cRNA, segment 4, complete sequence
AB612909.1| Influenza A virus (A/duck/Hokkaido/WZ101/2010(H5N1)) viral cRNA, segment 4, complete sequence 28.2 28.2 100% 1.7 100%
HQ695910.1 Influenza A virus (A/mallard/Korea/1195/2010(H5N1)) segment 4 hemagglutinin (HA) gene, complete cds 28.2 28.2 100% 1.7 100%
JN202558.1 Influenza A virus (A/Mallard duck/Korea/W401/2011(H5N1)) segment 4 hemagglutinin (HA) gene, complete cds 28.2 28.2 100% 1.7 100%
AB629713.1 Influenza A virus (A/peregrine falcon/Aomori/7/2011(H5N1)) viral cRNA, segment 4, complete sequence 28.2 28.2 100% 1.7 100%
JF699675.1 Influenza A virus (A/mandarin duck/Korea/K10-515/2011(H5N1)) segment 4 hemagglutinin (HA) gene, complete cds 28.2 28.2 100% 1.7 100%
JF699674.1 Influenza A virus (A/mandarin duck/Korea/K10-485/2010(H5N1)) segment 4 hemagglutinin (HA) gene, complete cds 28.2 28.2 100% 1.7 100%
JF699673.1 Influenza A virus (A/mandarin duck/Korea/K10-483/2010(H5N1)) segment 4 hemagglutinin (HA) gene, complete cds
JN202559.1| Influenza A virus (A/Mallard duck/Korea/W404/2011(H5N1)) segment 4 hemagglutinin (HA) gene, complete cds
JN807980.1| Influenza A virus (A/chicken/Korea/PT412/2011(H5N1)) segment 4 hemagglutinin (HA) gene, complete cds
JN807994.1| Influenza A virus (A/pheasant/Korea/PT411/2011(H5N1)) segment 4 hemagglutinin (HA) gene, complete cds
JN807996.1| Influenza A virus (A/turkey/Korea/DDC518/2011(H5N1)) segment 4 hemagglutinin (HA) gene, complete cds 28.2 28.2 100% 1.7 100%
JF699672.1 Influenza A virus (A/mandarin duck/Korea/K10-480/2010(H5N1)) segment 4 hemagglutinin (HA) gene, complete cds 28.2 28.2 100% 1.7 100%
AB617579.1 Influenza A virus (A/peregrine falcon/Tochigi/15/2011(H5N1)) viral cRNA, segment 4, complete sequence 28.2 28.2 100% 1.7 100%

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Mon Mar 26, 2012 8:52 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 27559
Location: Pittsburgh, PA USA
A1302T

JN807999.1 Influenza A virus (A/wild bird/Korea/IS18/2011(H5N1)) segment 4 hemagglutinin (HA) gene, complete cds 28.2 28.2 100% 1.7 100%
JN807991.1 Influenza A virus (A/eurasian sparrowhawk/Korea/Q94/2011(H5N1)) segment 4 hemagglutinin (HA) gene, partial cds 28.2 28.2 100% 1.7 100%
JN807989.1 Influenza A virus (A/eurasian eagle owl/Korea/Q133/2011(H5N1)) segment 4 hemagglutinin (HA) gene, complete cds 28.2 28.2 100% 1.7 100%

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Mon Mar 26, 2012 9:02 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 27559
Location: Pittsburgh, PA USA
C1362T
JN807976.1 Influenza A virus (A/baikal teal/Korea/Q524/2010(H5N1)) segment 4 hemagglutinin (HA) gene, complete cds 28.2 28.2 100% 1.7 100%
JN807975.1 Influenza A virus (A/baikal teal/Korea/Q34/2011(H5N1)) segment 4 hemagglutinin (HA) gene, complete cds 28.2 28.2 100% 1.7 100%
JN807982.1 Influenza A virus (A/chicken/Korea/YS171/2011(H5N1)) segment 4 hemagglutinin (HA) gene, complete cds 28.2 28.2 100% 1.7 100%
JN807986.1 Influenza A virus (A/duck/Korea/IC360/2011(H5N1)) segment 4 hemagglutinin (HA) gene, complete cds 28.2 28.2 100% 1.7 100%
JN807990.1 Influenza A virus (A/eurasian eagle owl/Korea/Q196/2011(H5N1)) segment 4 hemagglutinin (HA) gene, complete cds 28.2 28.2 100% 1.7 100%
JN807973.1 Influenza A virus (A/eurasian eagle owl/Korea/Q178/2011(H5N1)) segment 4 hemagglutinin (HA) gene, complete cds 28.2 28.2 100% 1.7 100%
JN807981.1 Influenza A virus (A/chicken/Korea/SJ378/2011(H5N1)) segment 4 hemagglutinin (HA) gene, complete cds 28.2 28.2 100% 1.7 100%
JN807974.1 Influenza A virus (A/eurasian eagle owl/Korea/Q182/2011(H5N1)) segment 4 hemagglutinin (HA) gene, complete cds 28.2 28.2 100% 1.7 100%
JN807993.1 Influenza A virus (A/mandarin duck/Korea/Q525/2010(H5N1)) segment 4 hemagglutinin (HA) gene, complete cds 28.2 28.2 100% 1.7 100%
JN807992.1 Influenza A virus (A/mandarin duck/Korea/Q2/2011(H5N1)) segment 4 hemagglutinin (HA) gene, partial cds 28.2 28.2 100% 1.7 100%
JN807988.1 Influenza A virus (A/duck/Korea/YA54/2011(H5N1)) segment 4 hemagglutinin (HA) gene, complete cds 28.2 28.2 100% 1.7 100%
JN807991.1 Influenza A virus (A/eurasian sparrowhawk/Korea/Q94/2011(H5N1)) segment 4 hemagglutinin (HA) gene, partial cds 28.2 28.2 100% 1.7 100%
JN807984.1 Influenza A virus (A/duck/Korea/AS117/2011(H5N1)) segment 4 hemagglutinin (HA) gene, complete cds 28.2 28.2 100% 1.7 100%
JN807978.1 Influenza A virus (A/chicken/Korea/IC546/2011(H5N1)) segment 4 hemagglutinin (HA) gene, complete cds 28.2 28.2 100% 1.7 100%
JN807985.1 Influenza A virus (A/duck/Korea/Cheonan/2010(H5N1)) segment 4 hemagglutinin (HA) gene, complete cds 28.2 28.2 100% 1.7 100%
JN807997.1 Influenza A virus (A/white fronted goose/Korea/Q27/2011(H5N1)) segment 4 hemagglutinin (HA) gene, partial cds 28.2 28.2 100% 1.7 100%
JN807998.1 Influenza A virus (A/whooper swan/Korea/Q28/2011(H5N1)) segment 4 hemagglutinin (HA) gene, complete cds 28.2 28.2 100% 1.7 100%
JN807983.1 Influenza A virus (A/common Ketrel/Korea/Q197/2011(H5N1)) segment 4 hemagglutinin (HA) gene, complete cds 28.2 28.2 100% 1.7 100%
JN807987.1 Influenza A virus (A/duck/Korea/NJ83/2011(H5N1)) segment 4 hemagglutinin (HA) gene, complete cds 28.2 28.2 100% 1.7 100%
JN807995.1 Influenza A virus (A/quail/Korea/GC395/2011(H5N1)) segment 4 hemagglutinin (HA) gene, complete cds 28.2 28.2 100% 1.7 100%
JN807979.1 Influenza A virus (A/chicken/Korea/Iksan/2010(H5N1)) segment 4 hemagglutinin (HA) gene, complete cds 28.2 28.2 100% 1.7 100%
AB675741.1 Influenza A virus (A/chicken/Mie/1/2011(H5N1)) HA gene for hemagglutinin, complete cds 28.2 28.2 100% 1.7 100%
AB675740.1 Influenza A virus (A/chicken/Aichi/T1/2011(H5N1)) HA gene for haemagglutinin, complete cds 28.2 28.2 100% 1.7 100%
AB675739.1 Influenza A virus (A/chicken/Miyazaki/M6/2011(H5N1)) HA gene for haemagglutinin, complete cds 28.2 28.2 100% 1.7 100%
CY110738.1 Influenza A virus (A/whooper swan/Hamanaka/2011(H5N1)) hemagglutinin (HA) gene, complete cds 28.2 28.2 100% 1.7 100%
AB677931.1 Influenza A virus (A/hooded crane/Kagoshima/4612J008/2010(H5N1)) viral cRNA, segment 4, complete sequence 28.2 28.2 100% 1.7 100%
AB677923.1 Influenza A virus (A/tundra swan/Tottori/12-002/2010(H5N1)) viral cRNA, segment 4, complete sequence 28.2 28.2 100% 1.7 100%
AB677915.1 Influenza A virus (A/peregrine falcon/Aichi/2302O017/2011(H5N1)) viral cRNA, segment 4, complete sequence 28.2 28.2 100% 1.7 100%
AB677907.1 Influenza A virus (A/peregrine falcon/Kyoto/2602A009/2011(H5N1)) viral cRNA, segment 4, complete sequence 28.2 28.2 100% 1.7 100%
AB677899.1 Influenza A virus (A/great drested grebe/Hyogo/2802E082/2011(H5N1)) viral cRNA, segment 4, complete sequence 28.2 28.2 100% 1.7 100%
AB677891.1 Influenza A virus (A/mandarin duck/Kochi/3901C005/2011(H5N1)) viral cRNA, segment 4, complete sequence 28.2 28.2 100% 1.7 100%
AB677883.1 Influenza A virus (A/owl/Tokushima/3602A023/2011(H5N1)) viral cRNA, segment 4, complete sequence 28.2 28.2 100% 1.7 100%
AB677875.1 Influenza A virus (A/mandarin duck/Miyazaki/22M807-1/2011(H5N1)) viral cRNA, segment 4, complete sequence 28.2 28.2 100% 1.7 100%
AB677867.1 Influenza A virus (A/mandarin duck/Nagasaki/4202A023/2011(H5N1)) viral cRNA, segment 4, complete sequence 28.2 28.2 100% 1.7 100%
AB677859.1 Influenza A virus (A/mandarin duck/Oita/4402B056/2011(H5N1)) viral cRNA, segment 4, complete sequence 28.2 28.2 100% 1.7 100%
AB677851.1 Influenza A virus (A/tufted duck/Yamaguchi/3502B007/2011(H5N1)) viral cRNA, segment 4, complete sequence 28.2 28.2 100% 1.7 100%
AB677843.1 Influenza A virus (A/common pochard/Shimane/5502B024/2011(H5N1)) viral cRNA, segment 4, complete sequence 28.2 28.2 100% 1.7 100%
AB676810.1 Influenza A virus (A/goshawk/Tochigi/64/2011(H5N1)) HA gene for haemagglutinin, complete cds 28.2 28.2 100% 1.7 100%
AB675544.1 Influenza A virus (A/tufted duck/Fukushima/7/2011(H5N1)) viral cRNA, segment 4, complete sequence
AB675503.1| Influenza A virus (A/tufted duck/Fukushima/4/2011(H5N1)) viral cRNA, segment 4, complete sequence 28.2 28.2 100% 1.7 100%
AB675536.1 Influenza A virus (A/tufted duck/Fukushima/5/2011(H5N1)) viral cRNA, segment 4, complete sequence 28.2 28.2 100% 1.7 100%
CY098688.1 Influenza A virus (A/Hunan/1/2008(H5N1)) hemagglutinin (HA) gene, complete cds 28.2 28.2 100% 1.7 100%
AB612901.1 Influenza A virus (A/duck/Hokkaido/WZ83/2010(H5N1)) viral cRNA, segment 4, complete sequence
AB612909.1| Influenza A virus (A/duck/Hokkaido/WZ101/2010(H5N1)) viral cRNA, segment 4, complete sequence 28.2 28.2 100% 1.7 100%
HQ695910.1 Influenza A virus (A/mallard/Korea/1195/2010(H5N1)) segment 4 hemagglutinin (HA) gene, complete cds 28.2 28.2 100% 1.7 100%
GU727653.1 Influenza A virus (A/duck/Eastern China/008/2008(H5N5)) segment 4 hemagglutinin (HA) gene, complete cds 28.2 28.2 100% 1.7 100%
GU727661.1 Influenza A virus (A/duck/Eastern China/031/2009(H5N5)) segment 4 hemagglutinin (HA) gene, complete cds 28.2 28.2 100% 1.7 100%
GU727669.1 Influenza A virus (A/duck/Eastern China/108/2008(H5N1)) segment 4 hemagglutinin (HA) gene, complete cds 28.2 28.2 100% 1.7 100%
JN202558.1 Influenza A virus (A/Mallard duck/Korea/W401/2011(H5N1)) segment 4 hemagglutinin (HA) gene, complete cds 28.2 28.2 100% 1.7 100%
AB629713.1 Influenza A virus (A/peregrine falcon/Aomori/7/2011(H5N1)) viral cRNA, segment 4, complete sequence 28.2 28.2 100% 1.7 100%
AB629700.1 Influenza A virus (A/tundra swan/Fukushima/207/2011(H5N1)) viral cRNA, segment 4, complete sequence 28.2 28.2 100% 1.7 100%
AB629698.1 Influenza A virus (A/tufted duck/Fukushima/16/2011(H5N1)) viral cRNA, segment 4, complete sequence 28.2 28.2 100% 1.7 100%
AB601124.1 Influenza A virus (A/chicken/Egypt/RIMD4-3/2008(H5N1)) viral cRNA, segment 4, complete sequence 28.2 28.2 100% 1.7 100%
AB620022.1 Influenza A virus (A/whooper swan/Hokkaido/3/2011(H5N1)) viral cRNA, segment 4, complete sequence
AB621345.1| Influenza A virus (A/pintail/Hokkaido/1/2011(H5N1)) viral cRNA, segment 4, complete sequence
AB621347.1| Influenza A virus (A/whooper swan/Hokkaido/6/2011(H5N1)) viral cRNA, segment 4, complete sequence
AB621349.1| Influenza A virus (A/greater scaup/Hokkaido/2/2011(H5N1)) viral cRNA, segment 4, complete sequence
AB610972.2| Influenza A virus (A/whooper swan/Hokkaido/4/2011(H5N1)) viral cRNA, segment 4, complete sequence
AB629702.1| Influenza A virus (A/greater scaup/Hokkaido/28/2011(H5N1)) viral cRNA, segment 4, complete sequence
AB629704.1| Influenza A virus (A/whooper swan/Hokkaido/13-27/2011(H5N1)) viral cRNA, segment 4, complete sequence
AB629706.1| Influenza A virus (A/whooper swan/Hokkaido/A13/2011(H5N1)) viral cRNA, segment 4, complete sequence
AB629708.1| Influenza A virus (A/whooper swan/Hokkaido/13-21/2011(H5N1)) viral cRNA, segment 4, complete sequence
AB675568.1| Influenza A virus (A/whooper swan/Hokkaido/3/2011(H5N1)) viral cRNA, segment 4, complete sequence
AB675576.1| Influenza A virus (A/whooper swan/Hokkaido/6/2011(H5N1)) viral cRNA, segment 4, complete sequence
AB675558.1| Influenza A virus (A/pintail/Hokkaido/1/2011(H5N1)) viral cRNA, segment 4, complete sequence 28.2 28.2 100% 1.7 100%
JF699675.1 Influenza A virus (A/mandarin duck/Korea/K10-515/2011(H5N1)) segment 4 hemagglutinin (HA) gene, complete cds 28.2 28.2 100% 1.7 100%
JF699674.1 Influenza A virus (A/mandarin duck/Korea/K10-485/2010(H5N1)) segment 4 hemagglutinin (HA) gene, complete cds 28.2 28.2 100% 1.7 100%
JF699673.1 Influenza A virus (A/mandarin duck/Korea/K10-483/2010(H5N1)) segment 4 hemagglutinin (HA) gene, complete cds
JN202559.1| Influenza A virus (A/Mallard duck/Korea/W404/2011(H5N1)) segment 4 hemagglutinin (HA) gene, complete cds
JN807980.1| Influenza A virus (A/chicken/Korea/PT412/2011(H5N1)) segment 4 hemagglutinin (HA) gene, complete cds
JN807994.1| Influenza A virus (A/pheasant/Korea/PT411/2011(H5N1)) segment 4 hemagglutinin (HA) gene, complete cds
JN807996.1| Influenza A virus (A/turkey/Korea/DDC518/2011(H5N1)) segment 4 hemagglutinin (HA) gene, complete cds 28.2 28.2 100% 1.7 100%
JF699672.1 Influenza A virus (A/mandarin duck/Korea/K10-480/2010(H5N1)) segment 4 hemagglutinin (HA) gene, complete cds 28.2 28.2 100% 1.7 100%
AB617579.1 Influenza A virus (A/peregrine falcon/Tochigi/15/2011(H5N1)) viral cRNA, segment 4, complete sequence 28.2 28.2 100% 1.7 100%
AB615237.1 Influenza A virus (A/tufted duck/Fukushima/2/2011(H5N1)) viral cRNA, segment 4, complete sequence 28.2 28.2 100% 1.7 100%
AB569609.1 Influenza A virus (A/whooper swan/Mongolia/21/2010(H5N1)) viral cRNA, segment 4, complete sequence 28.2 28.2 100% 1.7 100%
GU560030.1 Influenza A virus (A/common pochard/Switzerland/WV4080110/2008(H5N1)) segment 4 hemagglutinin (HA) gene, complete cds 28.2 28.2 100% 1.7 100%
GU052510.1 Influenza A virus (A/turkey/England/50-92/1991(H5N1)) segment 4 hemagglutinin (HA) gene, complete cds 28.2 28.2 100% 1.7 100%
GU182142.1 Influenza A virus (A/chicken/Hunan/3/2007(H5N1)) segment 4 hemagglutinin (HA) gene, complete cds 28.2 28.2 100% 1.7 100%
CY041043.1 Influenza A virus (A/duck/Laos/22/2006(H5N1)) segment 4 sequence 28.2 28.2 100% 1.7 100%
FJ750571.1 Influenza A virus (A/chicken/Belgium/150VB/1999(H5N2)) segment 4 hemagglutinin (HA) gene, complete cds 28.2 28.2 100% 1.7 100%
CY031001.1 Influenza A virus (A/turkey/England/N50-92/1991(H5N1)) segment 4 sequence 28.2 28.2 100% 1.7 100%
EU636692.1 Influenza A virus (A/turkey/England/50-92/91(H5N1)) segment 4 hemagglutinin (HA) gene, complete cds 28.2 28.2 100% 1.7 100%
EU743135.1 Influenza A virus (A/emu/NY/12716/1994(H5N9)) segment 4 hemagglutinin (HA) gene, complete cds 28.2 28.2 100% 1.7 100%
AM498632.1 Influenza A virus (A/mute swan/France/06631a/2006(H5N1)) HA gene for hemagglutinin, genomic RNA 28.2 28.2 100% 1.7 100%
EU146801.1 Influenza A virus (A/Indonesia/567H/2006(H5N1)) segment 4 hemagglutinin (HA) gene, partial cds 28.2 28.2 100% 1.7 100%
EU146866.1 Influenza A virus (A/chicken/Egypt/3/2006(H5N1)) segment 4 hemagglutinin (HA) gene, partial cds 28.2 28.2 100% 1.7 100%
EF597265.1 Influenza A virus (A/chicken/Italy/9097/1997(H5N9)) hemagglutinin (HA) gene, partial cds 28.2 28.2 100% 1.7 100%
EF597249.1 Influenza A virus (A/duck/Hong Kong/394/1978(H5N3)) hemagglutinin (HA) gene, partial cds 28.2 28.2 100% 1.7 100%
CY022621.1 Influenza A virus (A/chicken/Italy/22A/1998(H5N9)) segment 4, complete sequence 28.2 28.2 100% 1.7 100%
AM040150.1 Influenza A virus (A/duck/France/05056a/2005(H5N2)) HA gene for hemagglutinin, genomic RNA 28.2 28.2 100% 1.7 100%
EF469656.1 Influenza A virus (A/duck/Egypt/13010N3-CLEVB/2006(H5N1)) hemagglutinin (HA) gene, partial cds 28.2 28.2 100% 1.7 100%
DQ997405.1 Influenza A virus (A/goose/Fujian/bb/2003(H5N1)) segment 4, complete sequence 28.2 28.2 100% 1.7 100%
CY014518.1 Influenza A virus (A/Indonesia/CDC644/2006(H5N1)) segment 4 sequence 28.2 28.2 100% 1.7 100%
CY014510.1 Influenza A virus (A/Indonesia/CDC644T/2006(H5N1)) segment 4 sequence 28.2 28.2 100% 1.7 100%
S68489.2 hemagglutinin [H5N1 avian influenza virus, A/turkey/England/50-92/91, Genomic, 1773 nt] 28.2 28.2 100% 1.7 100%
AF194992.1 Influenza A virus (A/Chicken/Italy/9097/97(H5N9)) segment 4 hemagglutinin (HA0) gene, partial cds 28.2 28.2 100% 1.7 100%

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Mon Mar 26, 2012 9:10 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 27559
Location: Pittsburgh, PA USA
C1405G
JN807975.1 Influenza A virus (A/baikal teal/Korea/Q34/2011(H5N1)) segment 4 hemagglutinin (HA) gene, complete cds 28.2 28.2 100% 1.7 100%
JN807991.1 Influenza A virus (A/eurasian sparrowhawk/Korea/Q94/2011(H5N1)) segment 4 hemagglutinin (HA) gene, partial cds 28.2 28.2 100% 1.7 100%
JN807989.1 Influenza A virus (A/eurasian eagle owl/Korea/Q133/2011(H5N1)) segment 4 hemagglutinin (HA) gene, complete cds 28.2 28.2 100% 1.7 100%

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Mon Mar 26, 2012 9:13 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 27559
Location: Pittsburgh, PA USA
C1405G and T1412C

JN807991.1 Influenza A virus (A/eurasian sparrowhawk/Korea/Q94/2011(H5N1)) segment 4 hemagglutinin (HA) gene, partial cds 28.2 28.2 100% 1.7 100%
JN807989.1 Influenza A virus (A/eurasian eagle owl/Korea/Q133/2011(H5N1)) segment 4 hemagglutinin (HA) gene, complete cds 28.2 28.2 100% 1.7 100%

_________________
www.twitter.com/hniman


Top
 Profile  
 
Display posts from previous:  Sort by  
Post new topic Reply to topic  [ 33 posts ]  Go to page 1, 2, 3, 4  Next

All times are UTC - 5 hours [ DST ]


Who is online

Users browsing this forum: Wogmahoge and 41 guests


You cannot post new topics in this forum
You cannot reply to topics in this forum
You cannot edit your posts in this forum
You cannot delete your posts in this forum
You cannot post attachments in this forum

Search for:
Jump to:  
cron
Powered by phpBB® Forum Software © phpBB Group