Rhiza Labs FluTracker Forum

The place to discuss the flu
It is currently Sat May 18, 2013 3:22 pm

All times are UTC - 5 hours [ DST ]




Post new topic Reply to topic  [ 224 posts ]  Go to page Previous  1 ... 11, 12, 13, 14, 15, 16, 17 ... 23  Next
Author Message
PostPosted: Fri Mar 02, 2012 11:09 am 
Online

Joined: Wed Aug 19, 2009 10:42 am
Posts: 27279
Location: Pittsburgh, PA USA
niman wrote:
niman wrote:
Actually, though, it's the wild-type virus that's odd. In general, when you give ferrets most kinds of H5N1 in their noses, said Fouchier, "they don't get sick at all". The strain he used, collected in 2005 in Indonesia, is known for causing unusual brain-related disease when put in ferrets' noses. Perhaps the mutant has lost this: the ferrets who got it in their noses, either by breathing it in or because it was put there, just got flu.


http://www.newscientist.com/blogs/short ... nline-news

The above comments indocate the Fouchier transmission studies used A/Indonesia/5/2005, the WHO pandemic vaccine target for clade 2.1.

Short communication

Pathogenesis of Influenza A/H5N1 Virus Infection in Ferrets Differs between Intranasal and Intratracheal Routes of Inoculation
Rogier Bodewes⁎,
Joost H.C.M. Kreijtz⁎,
Geert van Amerongen⁎,
Ron A.M. Fouchier⁎,
Albert D.M.E. Osterhaus⁎, †,
Guus F. Rimmelzwaan⁎, †,
Thijs Kuiken⁎, ,
⁎ Department of Virology, Erasmus Medical Center, Rotterdam, The Netherlands
† ViroClinics Biosciences B.V., Rotterdam, The Netherlands
Accepted 23 March 2011. Available online 5 May 2011.
http://dx.doi.org/10.1016/j.ajpath.2011.03.026, How to Cite or Link Using DOI

Most patients infected with highly pathogenic avian influenza A/H5N1 virus develop severe pneumonia resulting in acute respiratory distress syndrome, with extrarespiratory disease as an uncommon complication. Intranasal inoculation of ferrets with influenza A/H5N1 virus causes lesions in both the respiratory tract and extrarespiratory organs (primarily brain). However, the route of spread to extrarespiratory organs and the relative contribution of extrarespiratory disease to pathogenicity are largely unknown. In the present study, we characterized lesions in the respiratory tract and central nervous system (CNS) of ferrets (n = 8) inoculated intranasally with influenza virus A/Indonesia/5/2005 (H5N1). By 7 days after inoculation, only 3 of 8 ferrets had a mild or moderate bronchointerstitial pneumonia. In contrast, all 8 ferrets had moderate or severe CNS lesions, characterized by meningoencephalitis, choroiditis, and ependymitis, and centered on tissues adjoining the cerebrospinal fluid. These findings indicate that influenza A/H5N1 virus spread directly from nasal cavity to brain, and that CNS lesions contributed more than pulmonary lesions to the pathogenicity of influenza A/H5N1 virus infection in ferrets. In comparison, intratracheal inoculation of ferrets with the same virus reproducibly caused severe bronchointerstitial pneumonia. The method of virus inoculation requires careful consideration in the design of ferret experiments as a model for influenza A/H5N1 in humans.

http://www.sciencedirect.com/science/ar ... 4011003506

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Fri Mar 02, 2012 11:21 am 
Online

Joined: Wed Aug 19, 2009 10:42 am
Posts: 27279
Location: Pittsburgh, PA USA
Dangers of Man-Made Bird Flu Are Exaggerated, Its Creators Say
By Alice Park | @aliceparkny | March 2, 2012 | +inShare0

MedicalRF.com / Getty Images
Researchers who created a so-called superstrain of H5N1 bird flu say the virus may not be as lethal or as virulent as has been widely suggested.

This week, at a meeting of experts attending the American Society for Microbiology (ASM) in Washington, D.C., Ron Fouchier of the Erasmus Medical Center who led one of two groups that developed the man-made strain of H5N1 told his colleagues that two misconceptions about his work have circulated in the media.

The first is that the strain he generated in the lab was easily spread, Fouchier said. In testing the transmissibility of the virus among ferrets in the lab (ferrets are often used to study flu because the animals are a good model for how humans would respond to the virus), he found that, in fact, not all healthy ferrets that were exposed to the coughs and sneezes of sick animals became infected.

(PHOTOS: Bird Flu Returns)

The second misconception, Fouchier said, is that the virus is highly lethal. Ferrets that became infected in the lab didn’t get very sick or die. They did not get as sick as those infected with the commonly circulating version of H5N1. “This virus does not spread like the pandemic or seasonal flu,” he told the experts gathered at the ASM meeting.

In the real world, H5N1 is thought to be highly lethal to humans. Although it infects people uncommonly, it appears to be deadly when it does. Of 587 human cases of bird flu confirmed by the World Health Organization (WHO) since 2003, nearly 60% have died (though some researchers say the actual mortality rate, if you take into account all the cases that don’t get reported, is much lower).

Adding to the confusion surrounding man-made H5N1, Fouchier said, is the fact that the National Science Advisory Board for Biosecurity (NSABB) requested in December that the details of his work — along with those of Yoshi Kawaoke at the University of Wisconsin, whose team independently reported creating H5N1 in the lab — not be published out of fear that it would promote bioterrorism.

(MORE: Government Panel Defends Censorship of Bird-Flu-Virus Research)

Science and Nature, the two prominent science journals that are considering publishing the studies, agreed to abide by the NSABB’s recommendation and have held off publishing anything for now. In the meantime, both Fouchier and Kawaoke have also voluntarily agreed to halt their work until government officials can figure out how best to proceed with the research. Critics of the research also caution that if the virus escaped from the lab, it could trigger a potentially deadly pandemic.

But as Fouchier told the group at the ASM meeting, such responses to man-made H5N1 may be overblown. He told the group:

If one were going to deduce anything [about] the efficiency of spreading, we would have to conclude that this virus does not spread yet like a pandemic or a seasonal influenza virus. The second misconception is that the virus would be highly lethal if it would ever come out. This virus, although it is highly lethal to chickens, and highly lethal if you put it directly down, at high titers, in the lower respiratory tract, it is certainly not highly lethal if ferrets start coughing and sneezing on one another.

Dr. Anthony Fauci, director of the National Institutes of Health’s National Institute of Allergy and Infectious Diseases, agrees that the dangers of the new virus have been exaggerated and has asked the NSABB to reconsider its recommendation.

A WHO panel convened in February to discuss the matter also disagreed with the NSABB, concluding that the papers should be published in their entirety so researchers could learn valuable lessons about how influenza works.

(MORE: The End of an Epidemic?)

Although naturally circulating H5N1 does not pass easily from person to person, infectious-disease experts are concerned that the virus may acquire that ability through mutations, as it passes between birds and other animals. If a highly transmissible strain of the virus arose, it could precipitate a pandemic flu that would infect millions. But having access to the details of Fouchier’s and Kawaoke’s work could help scientists prepare for such an outcome.

Whether the NSABB will reconsider and allow publication of the studies remains to be seen, but the ongoing debate has highlighted the precarious position of research with so-called dual purposes (good and bad). As adamantly as scientists defend the neutrality of their work — maintaining that their focus is purely on scientific understanding — it is clear that not all such investigations can exist in isolation and that the system for analyzing their safety and suitability for publication needs an overhaul.

Park is a writer at TIME. Find her on Twitter at @aliceparkny. You can also continue the discussion on TIME’s Facebook page and on Twitter at @TIME.

MORE: Bird Flu: More Common, Less Deadly than We Thought?

Read other related stories about this:
Genetically Altered Bird Flu Virus Not as Dangerous as Believed, Its Maker Asserts The New York Times
Biosecurity Group to Review New Avian Flu Data Nature
Publication Delay Blamed for Bird Flu Fears MedPage Today
Related Topics: avian flu, bird flu, H5N1, influenza, national science advisory board for biosecurity, pandemic flu, ronald fouchier, yoshi kawaoke, Flu, Medicine

Read more: http://healthland.time.com/2012/03/02/d ... z1nyOlCKTN

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Fri Mar 02, 2012 11:32 am 
Online

Joined: Wed Aug 19, 2009 10:42 am
Posts: 27279
Location: Pittsburgh, PA USA
niman wrote:
niman wrote:
Actually, though, it's the wild-type virus that's odd. In general, when you give ferrets most kinds of H5N1 in their noses, said Fouchier, "they don't get sick at all". The strain he used, collected in 2005 in Indonesia, is known for causing unusual brain-related disease when put in ferrets' noses. Perhaps the mutant has lost this: the ferrets who got it in their noses, either by breathing it in or because it was put there, just got flu.


http://www.newscientist.com/blogs/short ... nline-news

The above comments indocate the Fouchier transmission studies used A/Indonesia/5/2005, the WHO pandemic vaccine target for clade 2.1.

LOCUS EU146622 1741 bp cRNA linear VRL 01-MAY-2008
DEFINITION Influenza A virus (A/Indonesia/5/2005(H5N1)) segment 4
hemagglutinin (HA) gene, partial cds.
ACCESSION EU146622
VERSION EU146622.1 GI:157955422
KEYWORDS .
SOURCE Influenza A virus (A/Indonesia/5/2005(H5N1))
ORGANISM Influenza A virus (A/Indonesia/5/2005(H5N1))
Viruses; ssRNA negative-strand viruses; Orthomyxoviridae;
Influenzavirus A.
REFERENCE 1 (bases 1 to 1741)
AUTHORS Smith,G., Guan,Y., Peiris,M., Kandun,I.N., Soendoro,T. and
Sedyaningsih,E.R.
TITLE Direct Submission
JOURNAL Submitted (10-SEP-2007) Department of Microbiology, The University
of Hong Kong, Hong Kong SAR, China
COMMENT Sequence entered by GenBank staff on behalf of submitter. Please
acknowledge the Indonesian Ministry of Health if used in a
publication. Contact person for futher information is Dr. Triono
Sundoro.
FEATURES Location/Qualifiers
source 1..1741
/organism="Influenza A virus (A/Indonesia/5/2005(H5N1))"
/mol_type="viral cRNA"
/strain="A/Indonesia/5/2005"
/serotype="H5N1"
/host="Homo sapiens"
/db_xref="taxon:400788"
/segment="4"
/country="Indonesia"
misc_feature 1..1741
/db_xref="IRD:EU146622"
gene 34..>1741
/gene="HA"
CDS 34..>1741
/gene="HA"
/codon_start=1
/product="hemagglutinin"
/protein_id="ABW06108.1"
/db_xref="GI:157955423"
/translation="MEKIVLLLAIVSLVKSDQICIGYHANNSTEQVDTIMEKNVTVTH
AQDILEKTHNGKLCDLDGVKPLILRDCSVAGWLLGNPMCDEFINVPEWSYIVEKANPT
NDLCYPGSFNDYEELKHLLSRINHFEKIQIIPKSSWSDHEASSGVSSACPYLGSPSFF
RNVVWLIKKNSTYPTIKKSYNNTNQEDLLVLWGIHHPNDAAEQTRLYQNPTTYISIGT
STLNQRLVPKIATRSKVNGQSGRMEFFWTILKPNDAINFESNGNFIAPEYAYKIVKKG
DSAIMKSELEYGNCNTKCQTPMGAINSSMPFHNIHPLTIGECPKYVKSNRLVLATGLR
NSPQRESRRKKRGLFGAIAGFIEGGWQGMVDGWYGYHHSNEQGSGYAADKESTQKAID
GVTNKVNSIIDKMNTQFEAVGREFNNLERRIENLNKKMEDGFLDVWTYNAELLVLMEN
ERTLDFHDSNVKNLYDKVRLQLRDNAKELGNGCFEFYHKCDNECMESIRNGTYNYPQY
SEEARLKREEISGVKLESIGTYQILSIYSTVASSLALAIMMAGLSLWMCSNGSLQCRI
CIK"
ORIGIN
1 ttattagcaa aaggcagggt ataatctgta aaaatggaga aaatagtgct tcttcttgca
61 atagtcagtc ttgttaaaag tgatcagatt tgcattggtt accatgcaaa caattcaaca
121 gagcaggttg acacaatcat ggaaaagaac gttactgtta cacatgccca agacatactg
181 gaaaagacac acaacgggaa gctctgcgat ctagatggag tgaagcctct aattttaaga
241 gattgtagtg tagctggatg gctcctcggg aacccaatgt gtgacgaatt catcaatgta
301 ccggaatggt cttacatagt ggagaaggcc aatccaacca atgacctctg ttacccaggg
361 agtttcaacg actatgaaga actgaaacac ctattgagca gaataaacca ttttgagaaa
421 attcaaatca tccccaaaag ttcttggtcc gatcatgaag cctcatcagg agtgagctca
481 gcatgtccat acctgggaag tccctccttt tttagaaatg tggtatggct tatcaaaaag
541 aacagtacat acccaacaat aaagaaaagc tacaataata ccaaccaaga agatcttttg
601 gtactgtggg gaattcacca tcctaatgat gcggcagagc agacaaggct atatcaaaac
661 ccaaccacct atatttccat tgggacatca acactaaacc agagattggt accaaaaata
721 gctactagat ccaaagtaaa cgggcaaagt ggaaggatgg agttcttctg gacaatttta
781 aaacctaatg atgcaatcaa cttcgagagt aatggaaatt tcattgctcc agaatatgca
841 tacaaaattg tcaagaaagg ggactcagca attatgaaaa gtgaattgga atatggtaac
901 tgcaacacca agtgtcaaac tccaatgggg gcgataaact ctagtatgcc attccacaac
961 atacaccctc tcaccatcgg ggaatgcccc aaatatgtga aatcaaacag attagtcctt
1021 gcaacagggc tcagaaatag ccctcaaaga gagagcagaa gaaaaaagag aggactattt
1081 ggagctatag caggttttat agagggagga tggcagggaa tggtagatgg ttggtatggg
1141 taccaccata gcaatgagca ggggagtggg tacgctgcag acaaagaatc cactcaaaag
1201 gcaatagatg gagtcaccaa taaggtcaac tcaatcattg acaaaatgaa cactcagttt
1261 gaggccgttg gaagggaatt taataactta gaaaggagaa tagagaattt aaacaagaag
1321 atggaagacg ggtttctaga tgtctggact tataatgccg aacttctggt tctcatggaa
1381 aatgagagaa ctctagactt tcatgactca aatgttaaga acctctacga caaggtccga
1441 ctacagctta gggataatgc aaaggagctg ggtaacggtt gtttcgagtt ctatcacaaa
1501 tgtgataatg aatgtatgga aagtataaga aacggaacgt acaactatcc gcagtattca
1561 gaagaagcaa gattaaaaag agaggaaata agtggggtaa aattggaatc aataggaact
1621 taccaaatac tgtcaattta ttcaacagtg gcgagttccc tagcactggc aatcatgatg
1681 gctggtctat ctttatggat gtgctccaat ggatcgttac aatgcagaat ttgcattaaa
1741 t

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Sat Mar 03, 2012 4:04 am 
Online

Joined: Wed Aug 19, 2009 10:42 am
Posts: 27279
Location: Pittsburgh, PA USA
Members of a U.S. government biosecurity advisory board are offering a range of reactions to the news that they are being asked to take a second look at two controversial flu studies. Some have not previously spoken publicly about the issue, which has sparked a global debate about biosecurity versus scientific freedom. And several say they are skeptical that the new review will reverse their opposition to fully publishing the methods and results of the two experiments.

The comments below come after months of rapid-fire developments in the H5N1 flu research controversy. It began late last year, when the National Science Advisory Board for Biosecurity (NSABB) recommended that two science teams delete key details from papers submitted to Science and Nature that describe how researchers made the H5N1 avian influenza more transmissible between mammals, possibly providing a blueprint for starting a flu pandemic. The risks posed by the research outweighed its potential benefits, the 23 voting members of the panel unanimously concluded after what they described as hundreds of hours of discussion. The NSABB's voting members are mostly scientists drawn from a wide range of disciplines and institutions, including universities and companies. (There are also 18 non-voting ex-officio members from federal agencies.)

The researchers and the journals agreed to follow NSABB's recommendation, provided that the U.S. government comes up with a mechanism to share those details with bona fide researchers and public health experts. The deal sparked extensive criticism, however, with some scientists saying the redactions went too far, and others arguing the research should not have been conducted in the first place.


Then, in January, flu researchers—including the leaders of the two research teams, Ron Fouchier of Erasmus Medical College in the Netherlands and Yoshihiro Kawaoka of the University of Wisconsin, Madison—announced a 60-day moratorium on many kinds of studies involving the virus. That moratorium, currently set to expire 20 March, was designed to ease tensions and public concern, and allow time for international discussion of the issue.

Last month, the World Health Organization (WHO) convened a group made up mainly of flu experts for 2 days in Geneva to examine the studies. Many of the 22 people at the WHO meeting, however, rejected NSABB's conclusions and argued that the papers should be published in full. That meeting included talks by Fouchier and Kawaoka, who presented "new data" and, in the case of Fouchier, "clarified older data," according to Anthony Fauci, head of the National Institutes of Health's National Institute of Allergy and Infectious Diseases, which funded the two studies. Fauci, who attended the Geneva meeting, says members of the group also asked the researchers to revise and resubmit their manuscripts to NSABB.

Fauci announced that the U.S. government has asked NSABB to review the new manuscripts on 29 February at an early-morning panel discussion on the H5N1 controversy organized by the American Society for Microbiology (ASM) in Washington, D.C. NSABB "needs an opportunity to see all of the data we saw in Geneva … and have some time to talk it over," Fauci told ScienceInsider.

The reconsideration request apparently caught many NSABB members and Washington policy-makers by surprise. Sources familiar with the planning say the NSABB meeting—tentatively scheduled for later this month—could last 2 days. It also hopes to include presentations by Fouchier and Kawaoka, so that NSABB members could speak to them "face-to-face," unlike the teleconferences that characterized many of the earlier discussions of the flu studies.

Acting NSABB Chair Paul Keim of Northern Arizona University in Flagstaff, who moderated the ASM discussion, declined to speculate on how the panel might view the new versions of the two studies. But "the recommendations from NSABB can clearly be changed in the future," said Keim. "We can go back and reverse this if that is the best course of action."

The ASM meeting also included an extensive presentation by Fouchier of virus transmission and lethality data apparently drawn from his Science manuscript. In general, Fouchier said the data showed that his version of the engineered H5N1 virus was, in contrast to press reports, not lethal when inhaled by ferrets and would not spread "like wildfire" through the air. (Kawaoka had publicly said earlier that his version of the mammal transmissible virus was not lethal in ferrets.)

In the wake of the ASM meeting, ScienceInsider attempted to contact all 23 voting members of the NSABB. Seven agreed to e-mail, telephone, or in-person interviews—with several emphasizing that they were speaking for themselves, not NSABB. They included:


David Relman, Professor of Microbiology & Immunology, and of Medicine, Stanford University School of Medicine, Stanford, California

"My bottom line: Fouchier started with a highly worrisome and sometimes-lethal virus for humans, and appears to have enhanced its transmissibility by the respiratory route. Nothing said in recent days changes these facts, [and] not my assessment of the risk-benefit ratio. To me the most important issue about [Fouchier's] studies of transmissibility in the ferret model is the direct comparison of the starting strain (H5N1 wildtype) and his engineered strain(s). And the latter is/are more transmissible via [respiratory] route than the former." Kawaoka's paper "also provided clear guidance on how to enhance the transmissibility of H5N1 viruses," he writes, and other issues, such as virulence and lethality, were less important.


Susan Ehrlich, Retired Judge and Adjunct Professor, Department of Microbiology & Immunology, University of Texas Medical Branch, Galveston

"I heard nothing new so much as a different emphasis during the ASM meeting. This would be expected, however, for two reasons: The NSABB members, particularly those of us working group members, have spent hundreds of hours discussing these manuscripts after having reviewed them, and this was a public meeting. And of course none of us has yet seen the revised manuscripts, which I have no doubt will be reviewed with completely open minds, remembering that the first thought of each of us is that scientific research should be freely and completely communicated, a point made evident in each of the NSABB's several reports and specifically in the June 2007 Proposed Framework for the Oversight of Dual Use Life Sciences Research: Strategies for Minimizing the Potential Misuse of Research Information."

"Keeping in mind that I have not read the revised manuscripts, I do have certain concerns. Dr. Fouchier emphasized ferret response during the meeting, but the larger issue is that of transmissibility. H5N1 admittedly is a dangerous virus, and it now has been made more so. Its host range was extended. The research on the modified virus was conducted at the same biosafety level as research on the parent virus. These concerns underlie my thoughts about the communication of this research in the context of the NSABB's responsibility to the public should there be an accident (bioerror) or an incident of deliberate misuse (bioterror), and so I want to continue to proceed with caution."


Stanley Lemon, Professor of Medicine and Microbiology & Immunology, University of North Carolina, Chapel Hill

"The major concern has been about acquisition of the capacity for aerosol transmission of the virus to a mammal."


Lynn Enquist, Professor and Chair, Department of Molecular Biology, Princeton University, New Jersey

"Here is my take home message. Both groups did experiments that are on the 'seven experiments of concern' described in detail in the Fink report [the 2003 National Academies report Biotechnology Research in an Age of Terrorism: Confronting the Dual Use Dilemma] and our own recommendations. They not only changed the host range of a dangerous pathogen, they also changed its mode of transmission. "

"All the other differences in methods, or new or clarified work on virulence in ferrets, does nothing to change those facts."

"While there is no doubt that work must be done to study H5N1, and all the debate so far shows how necessary further work is, these new derivatives are novel entities with unknown consequences if they move into the ecosystem."

"How should work on these new agents proceed? How many labs should be working along these same directions? How should this work be communicated now and in the future? Those are a few of the central questions in my opinion."

"The NSABB should not be making these decisions or reviewing the details of the science. We called attention to the fact that these experiments are dual use research of concern."


Arturo Casadevall, Chair, Division of Infectious Diseases, Albert Einstein College of Medicine, New York, New York

Casadevall noted that he went into the original NSABB discussions of the two papers thinking: "Science should be free and nothing should be redacted, but then it became clear to me that there was almost no public good in [publishing] the details." Now, he says: "I'm going to go to the next meeting with an open mind and listen to everything. This process is supposed to be deliberative. And this process is one in which you can think through it and change your mind."

But "the central issue for me is the transmissibility. Unless Ron [Fouchier] gets up there and says this is no longer mammalian transmissible," Casadevall is unlikely to reverse his opposition to full publication. "Having transmissibility is a new characteristic for H5N1," he adds, noting that "this virus has the capacity to recombine and we have no idea what will come out." He sees the virulence and lethality of the new engineered viruses as "mini-debates" that are less important. "We need to be very cautious. We're dealing with an organism that we know can cause pandemics and can kill a lot of people. And we know that we don't have immunity to H5. I would urge caution." Casadevall also notes that "I'm from Cuba. I know something about redaction."


Michael Osterholm, Director, Minnesota Center of Excellence for Influenza Research and Surveillance, University of Minnesota, Twin Cities

"The information that I saw [on 29 February] in no way changed the underlying issue of concern for NSABB, and that was the issue of transmissibility. Expanding the host range of a dangerous pathogen is one of the [seven types of experiments identified as raising dual use concerns by the Fink Report]. … I have not seen anything that fundamentally changes anything about the NSABB position. … I feel very confident that the criteria we used for calling for the redaction of this paper based on the transmissibility issue was straightforward and I'm not convinced that additional face-to-face conversation would make any difference."


Michael Imperiale, Professor, Department of Microbiology and Immunology, University of Michigan Medical School, Ann Arbor.

"What Ron [Fouchier] is saying now is not what was in the paper. We were led to believe by the paper that aerosol transmission is also lethal." He also says it was news to him that the mutated virus did not spread between ferrets via the aerosol route as readily as seasonal strains, as Fouchier showed at the ASM meeting "That really didn't come across to me in the paper," he says. "I didn't see that kind of comparison."

Then again, he is uncertain the new information will influence his thinking about redaction. "Based on bare minimal facts, from what I heard Fouchier say on Wednesday, I'm not sure it would matter. The lethality in ferrets is the same as the starting virus and now it can be transmitted." Specifically, noted Imperiale: "If the starting H5N1 virus is injected intratracheally into ferrets, it kills them. What [Fouchier's] done is changed it so it's no longer fecal-oral spread, but aerosol. He injects that intratracheally, and it kills them. So it's just as lethal, plus now it can be spread by aerosol. You have a virus that kills X percent of the humans it infects. Based on the ferret data, we'd expect it to kill the same exact percent of humans, and now it can be transmitted from human to human. Obviously, I'd need to see that revised paper, but I don't it know that it changes anything."

Imperiale says, ultimately, there's just too much uncertainty to take the risk of publishing all the details of the experiments. "Given the uncertainty, I say go with the precautionary principle. And you wait until you can get rid of that uncertainty. If you redact, it's not a permanent action. If you let it out, that's permanent."

http://news.sciencemag.org/scienceinsid ... html?rss=1

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Sat Mar 03, 2012 4:12 am 
Online

Joined: Wed Aug 19, 2009 10:42 am
Posts: 27279
Location: Pittsburgh, PA USA
niman wrote:
Members of a U.S. government biosecurity advisory board are offering a range of reactions to the news that they are being asked to take a second look at two controversial flu studies. Some have not previously spoken publicly about the issue, which has sparked a global debate about biosecurity versus scientific freedom. And several say they are skeptical that the new review will reverse their opposition to fully publishing the methods and results of the two experiments.

The comments below come after months of rapid-fire developments in the H5N1 flu research controversy. It began late last year, when the National Science Advisory Board for Biosecurity (NSABB) recommended that two science teams delete key details from papers submitted to Science and Nature that describe how researchers made the H5N1 avian influenza more transmissible between mammals, possibly providing a blueprint for starting a flu pandemic. The risks posed by the research outweighed its potential benefits, the 23 voting members of the panel unanimously concluded after what they described as hundreds of hours of discussion. The NSABB's voting members are mostly scientists drawn from a wide range of disciplines and institutions, including universities and companies. (There are also 18 non-voting ex-officio members from federal agencies.)

The researchers and the journals agreed to follow NSABB's recommendation, provided that the U.S. government comes up with a mechanism to share those details with bona fide researchers and public health experts. The deal sparked extensive criticism, however, with some scientists saying the redactions went too far, and others arguing the research should not have been conducted in the first place.


Then, in January, flu researchers—including the leaders of the two research teams, Ron Fouchier of Erasmus Medical College in the Netherlands and Yoshihiro Kawaoka of the University of Wisconsin, Madison—announced a 60-day moratorium on many kinds of studies involving the virus. That moratorium, currently set to expire 20 March, was designed to ease tensions and public concern, and allow time for international discussion of the issue.

Last month, the World Health Organization (WHO) convened a group made up mainly of flu experts for 2 days in Geneva to examine the studies. Many of the 22 people at the WHO meeting, however, rejected NSABB's conclusions and argued that the papers should be published in full. That meeting included talks by Fouchier and Kawaoka, who presented "new data" and, in the case of Fouchier, "clarified older data," according to Anthony Fauci, head of the National Institutes of Health's National Institute of Allergy and Infectious Diseases, which funded the two studies. Fauci, who attended the Geneva meeting, says members of the group also asked the researchers to revise and resubmit their manuscripts to NSABB.

Fauci announced that the U.S. government has asked NSABB to review the new manuscripts on 29 February at an early-morning panel discussion on the H5N1 controversy organized by the American Society for Microbiology (ASM) in Washington, D.C. NSABB "needs an opportunity to see all of the data we saw in Geneva … and have some time to talk it over," Fauci told ScienceInsider.

The reconsideration request apparently caught many NSABB members and Washington policy-makers by surprise. Sources familiar with the planning say the NSABB meeting—tentatively scheduled for later this month—could last 2 days. It also hopes to include presentations by Fouchier and Kawaoka, so that NSABB members could speak to them "face-to-face," unlike the teleconferences that characterized many of the earlier discussions of the flu studies.

Acting NSABB Chair Paul Keim of Northern Arizona University in Flagstaff, who moderated the ASM discussion, declined to speculate on how the panel might view the new versions of the two studies. But "the recommendations from NSABB can clearly be changed in the future," said Keim. "We can go back and reverse this if that is the best course of action."

The ASM meeting also included an extensive presentation by Fouchier of virus transmission and lethality data apparently drawn from his Science manuscript. In general, Fouchier said the data showed that his version of the engineered H5N1 virus was, in contrast to press reports, not lethal when inhaled by ferrets and would not spread "like wildfire" through the air. (Kawaoka had publicly said earlier that his version of the mammal transmissible virus was not lethal in ferrets.)

In the wake of the ASM meeting, ScienceInsider attempted to contact all 23 voting members of the NSABB. Seven agreed to e-mail, telephone, or in-person interviews—with several emphasizing that they were speaking for themselves, not NSABB. They included:


David Relman, Professor of Microbiology & Immunology, and of Medicine, Stanford University School of Medicine, Stanford, California

"My bottom line: Fouchier started with a highly worrisome and sometimes-lethal virus for humans, and appears to have enhanced its transmissibility by the respiratory route. Nothing said in recent days changes these facts, [and] not my assessment of the risk-benefit ratio. To me the most important issue about [Fouchier's] studies of transmissibility in the ferret model is the direct comparison of the starting strain (H5N1 wildtype) and his engineered strain(s). And the latter is/are more transmissible via [respiratory] route than the former." Kawaoka's paper "also provided clear guidance on how to enhance the transmissibility of H5N1 viruses," he writes, and other issues, such as virulence and lethality, were less important.


Susan Ehrlich, Retired Judge and Adjunct Professor, Department of Microbiology & Immunology, University of Texas Medical Branch, Galveston

"I heard nothing new so much as a different emphasis during the ASM meeting. This would be expected, however, for two reasons: The NSABB members, particularly those of us working group members, have spent hundreds of hours discussing these manuscripts after having reviewed them, and this was a public meeting. And of course none of us has yet seen the revised manuscripts, which I have no doubt will be reviewed with completely open minds, remembering that the first thought of each of us is that scientific research should be freely and completely communicated, a point made evident in each of the NSABB's several reports and specifically in the June 2007 Proposed Framework for the Oversight of Dual Use Life Sciences Research: Strategies for Minimizing the Potential Misuse of Research Information."

"Keeping in mind that I have not read the revised manuscripts, I do have certain concerns. Dr. Fouchier emphasized ferret response during the meeting, but the larger issue is that of transmissibility. H5N1 admittedly is a dangerous virus, and it now has been made more so. Its host range was extended. The research on the modified virus was conducted at the same biosafety level as research on the parent virus. These concerns underlie my thoughts about the communication of this research in the context of the NSABB's responsibility to the public should there be an accident (bioerror) or an incident of deliberate misuse (bioterror), and so I want to continue to proceed with caution."


Stanley Lemon, Professor of Medicine and Microbiology & Immunology, University of North Carolina, Chapel Hill

"The major concern has been about acquisition of the capacity for aerosol transmission of the virus to a mammal."


Lynn Enquist, Professor and Chair, Department of Molecular Biology, Princeton University, New Jersey

"Here is my take home message. Both groups did experiments that are on the 'seven experiments of concern' described in detail in the Fink report [the 2003 National Academies report Biotechnology Research in an Age of Terrorism: Confronting the Dual Use Dilemma] and our own recommendations. They not only changed the host range of a dangerous pathogen, they also changed its mode of transmission. "

"All the other differences in methods, or new or clarified work on virulence in ferrets, does nothing to change those facts."

"While there is no doubt that work must be done to study H5N1, and all the debate so far shows how necessary further work is, these new derivatives are novel entities with unknown consequences if they move into the ecosystem."

"How should work on these new agents proceed? How many labs should be working along these same directions? How should this work be communicated now and in the future? Those are a few of the central questions in my opinion."

"The NSABB should not be making these decisions or reviewing the details of the science. We called attention to the fact that these experiments are dual use research of concern."


Arturo Casadevall, Chair, Division of Infectious Diseases, Albert Einstein College of Medicine, New York, New York

Casadevall noted that he went into the original NSABB discussions of the two papers thinking: "Science should be free and nothing should be redacted, but then it became clear to me that there was almost no public good in [publishing] the details." Now, he says: "I'm going to go to the next meeting with an open mind and listen to everything. This process is supposed to be deliberative. And this process is one in which you can think through it and change your mind."

But "the central issue for me is the transmissibility. Unless Ron [Fouchier] gets up there and says this is no longer mammalian transmissible," Casadevall is unlikely to reverse his opposition to full publication. "Having transmissibility is a new characteristic for H5N1," he adds, noting that "this virus has the capacity to recombine and we have no idea what will come out." He sees the virulence and lethality of the new engineered viruses as "mini-debates" that are less important. "We need to be very cautious. We're dealing with an organism that we know can cause pandemics and can kill a lot of people. And we know that we don't have immunity to H5. I would urge caution." Casadevall also notes that "I'm from Cuba. I know something about redaction."


Michael Osterholm, Director, Minnesota Center of Excellence for Influenza Research and Surveillance, University of Minnesota, Twin Cities

"The information that I saw [on 29 February] in no way changed the underlying issue of concern for NSABB, and that was the issue of transmissibility. Expanding the host range of a dangerous pathogen is one of the [seven types of experiments identified as raising dual use concerns by the Fink Report]. … I have not seen anything that fundamentally changes anything about the NSABB position. … I feel very confident that the criteria we used for calling for the redaction of this paper based on the transmissibility issue was straightforward and I'm not convinced that additional face-to-face conversation would make any difference."


Michael Imperiale, Professor, Department of Microbiology and Immunology, University of Michigan Medical School, Ann Arbor.

"What Ron [Fouchier] is saying now is not what was in the paper. We were led to believe by the paper that aerosol transmission is also lethal." He also says it was news to him that the mutated virus did not spread between ferrets via the aerosol route as readily as seasonal strains, as Fouchier showed at the ASM meeting "That really didn't come across to me in the paper," he says. "I didn't see that kind of comparison."

Then again, he is uncertain the new information will influence his thinking about redaction. "Based on bare minimal facts, from what I heard Fouchier say on Wednesday, I'm not sure it would matter. The lethality in ferrets is the same as the starting virus and now it can be transmitted." Specifically, noted Imperiale: "If the starting H5N1 virus is injected intratracheally into ferrets, it kills them. What [Fouchier's] done is changed it so it's no longer fecal-oral spread, but aerosol. He injects that intratracheally, and it kills them. So it's just as lethal, plus now it can be spread by aerosol. You have a virus that kills X percent of the humans it infects. Based on the ferret data, we'd expect it to kill the same exact percent of humans, and now it can be transmitted from human to human. Obviously, I'd need to see that revised paper, but I don't it know that it changes anything."

Imperiale says, ultimately, there's just too much uncertainty to take the risk of publishing all the details of the experiments. "Given the uncertainty, I say go with the precautionary principle. And you wait until you can get rid of that uncertainty. If you redact, it's not a permanent action. If you let it out, that's permanent."

http://news.sciencemag.org/scienceinsid ... html?rss=1

The comments of NSABB demonstrate why the board should be REPLACED. Their failure to understand the PUBLISHED data on H5N1 transmission, including the CDC paper which contained all three of the changes introduced by Fouchier is PROFOUND.

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Sat Mar 03, 2012 5:27 am 
Online

Joined: Wed Aug 19, 2009 10:42 am
Posts: 27279
Location: Pittsburgh, PA USA
Commentary
http://www.recombinomics.com/News/03031 ... _Full.html

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Sat Mar 03, 2012 8:05 pm 
Online

Joined: Wed Aug 19, 2009 10:42 am
Posts: 27279
Location: Pittsburgh, PA USA
The Truth About the Doomsday Virus?

Published: March 3, 2012


Two months ago we warned that a new bird flu virus — modified in a laboratory to make it transmissible through the air among mammals — could kill millions of people if it escaped confinement or was stolen by terrorists. Now Ron Fouchier, the Dutch scientist who led the key research team, is saying that his findings, which remain confidential, were misconstrued by the press.

Genetically Altered Bird Flu Virus Not as Dangerous as Believed, Its Maker Asserts (March 1, 2012)
He says that the virus did not spread easily and was not lethal when transmitted from one ferret to another by coughing or sneezing, and that it became highly lethal only when big doses were injected into the animals’ windpipes.

That is hard to square with his original assertions. Experts who read his original manuscript say it reported that the new virus spread through the air and remained as virulent as the natural virus, which has killed 60 percent of the humans it has infected.

Dr. Fouchier’s new claims are only the latest bizarre twist in a global health debate that badly needs an objective, independent arbiter. The public needs to know whether this virus is a potentially big killer, and if so, how it should be contained. It needs to know what details can be published without giving terrorists a recipe for a biological weapon. And it needs to know that a mechanism will be put in place to assess all the risks and benefits of such research before it is approved — not after a new virus has been created.

The debate became public after a federal advisory board, the National Science Advisory Board for Biosecurity, recommended that papers prepared by Dr. Fouchier’s group and researchers doing similar work at the University of Wisconsin-Madison be published only after omitting details that might help terrorists. That drew charges of censorship from some scientists, and others warned that restricting the information would make it harder to track and combat an outbreak of a similar strain.

The World Health Organization convened a closed meeting of 22 experts last month, which concluded that the research should eventually be published in full. The group was dominated by participants with a clear stake in publication — including the researchers who made the viruses, the journals that want to publish their papers in full, and developing countries that want access to full details in exchange for having contributed the viruses that were studied.

Now this country’s National Institutes of Health, which financed the research and has its own reputation on the line, is asking the biosecurity advisory board to reconsider its call to redact details before publication.

We welcome a new appraisal from a board that has already shown considerable independence. We hope it will look beyond the security and terrorism issues and voice its opinion on what safety precautions should be required to prevent the virus from escaping and whether the work should proceed at multiple labs or possibly be halted.

These issues need to be resolved by experts who do not have institutional biases or turf to protect. The World Health Organization should be in the best position to oversee a response to what is a global problem. Its first effort was one-sided and disappointing, but it has pledged to convene further meetings with a much broader range of experts and interested parties. It must ensure that these forums are not rubber stamps for what the narrower special-interest group just concluded.

These are complicated issues, and the stakes are enormous. Governments and scientists have a clear responsibility to get this judgment and future efforts right.
http://www.nytimes.com/2012/03/04/opini ... ss&emc=rss

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Sat Mar 03, 2012 8:07 pm 
Online

Joined: Wed Aug 19, 2009 10:42 am
Posts: 27279
Location: Pittsburgh, PA USA
Lab-engineered bird flu virus may be less deadly than thought — or not


By David Brown, Saturday, March 3, 2:43 PM

The lab-engineered H5N1 bird flu virus whose recipe the U.S. government doesn’t want published may be less lethal than originally reported. But that fact, revealed at a scientific conference in Washington in the past week, isn’t likely to change many people’s minds about whether details about the bug should be kept secret or made public.

What is indisputable is that the virus, a close relative of one that has killed about 60 percent of the people it has infected in the past 15 years, is able to pass easily between mammals, not just birds. Even if it turns out to be only a fraction as virulent as its wild relative, that’s enough to make it necessary keep information about how to make it under wraps, many experts think.


“This has always been about transmissibility,” said Michael T. Osterholm, an epidemiologist at the University of Minnesota’s Center for Infectious Disease Research and Policy. “Have we added a new species to which this virus can be readily transmitted? The evidence suggests we have.”

“The big question is how does the transmissibility of the engineered virus compare to the starting [wild] one,” said David A. Relman, a physician and microbiologist at Stanford University.

Osterholm and Relman are on the National Science Advisory Board for Biosecurity, a 23-member committee that advises the federal government on issues involving biological research that can be used for nefarious purposes. In December, the panel asked the journals Science and Nature to hold up publication of two papers about experiments that made the bird flu virus contagious in ferrets, the lab animals used to mimic human influenza infections.

The journals complied, with the understanding they would eventually publish the research either in redacted form or entirely, with editorial additions. The nearly unprecedented case of self-censorship has since been the hottest topic in science on both sides of the Atlantic.

Both journals have published commentaries for and against publication. The World Health Organization held a two-day meeting in Geneva last month to discuss the issue. The Royal Society, in London, is holding a two-day conference in April; the National Academies, in Washington, a one-day meeting in May.

The biosecurity panel decided this week to meet again, this time with the lead authors of the two papers present to query them further about their findings. That will probably happen later this month.

“It wouldn’t surprise me if at least the majority, and possibly everyone, still saw this work the same way it did in December,” Relman said.

The description of the engineered virus’s lethality provided in the past week is either a clarified version of what appears in one of the unpublished manuscripts or a revised version. Opinions differ. It’s impossible to know which view is right because the only people who know the details won’t or can’t talk about them.

The gist of the initial report was that two research teams — one in the Netherlands, the other in Wisconsin, and both funded by the U.S. government — had taken “wild-type” H5N1 and modified it so that it could pass through the air from an infected ferret to an uninfected one in an abutting cage. This was reportedly achieved without altering the bug’s capacity to kill. Globally, H5N1’s lethality for humans is 59 percent — 345 deaths out of 584 confirmed cases. Most of the victims have been poultry workers in Southeast Asia; a few have been family members who cared for the victims.
http://www.washingtonpost.com/national/ ... story.html

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Sat Mar 03, 2012 8:47 pm 
Online

Joined: Wed Aug 19, 2009 10:42 am
Posts: 27279
Location: Pittsburgh, PA USA
niman wrote:
If you redact, it's not a permanent action. If you let it out, that's permanent."

http://news.sciencemag.org/scienceinsid ... html?rss=1

It is OUT. The CDC paper on H5N1 TRANSMISSION in ferrets has been PUBLISHED IN FULL in the jounal Virology in NOVEMBER.

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Mon Mar 05, 2012 9:56 am 
Online

Joined: Wed Aug 19, 2009 10:42 am
Posts: 27279
Location: Pittsburgh, PA USA
The Deadliest Virus

Did a scientist put millions of lives at risk—and was he right to do it?

by Michael Specter March 12, 2012 .

Subscribers can read this article on our iPad app or in our online archive. (Others can pay for access.)


Related Links Audio: Michael Specter on the dangers of studying bird flu.
Keywords Bird Flu; Pandemics; H5N1; Influenza; Science; Bioterrorism; Ron Fouchier


ABSTRACT: ANNALS OF MEDICINE about the creation of a highly contagious form of the H5N1 (bird flu) virus by Dutch scientists. To ignite a pandemic, even the most lethal virus would need to meet three conditions: it would have to be one that humans hadn’t confronted before, so that they didn’t have antibodies; it would have to kill them; and it would have to spread easily. H5N1 meets the first two criteria but not the third. Flu viruses mutate rapidly, but over time they tend to weaken. Researchers hoped that this would be the case with H5N1. Nonetheless, for the past decade the threat of an airborne bird flu lingered ominously in the dark imaginings of scientists around the world. Then, last September, the threat became real. At the annual meeting of the European Scientific Working Group on Influenza, Ron Fouchier, a Dutch virologist at the Erasmus Medical Center, in Rotterdam, reported that simply by transferring avian influenza from one ferret to another had made it highly contagious. Fouchier explained that he and his colleagues “mutated the hell out of H5N1”—meaning that they had altered the genetic sequence of the virus in a variety of ways. That had no effect. Then, as Fouchier later put it, “someone finally convinced me to do something really, really stupid.” He spread the virus the old-fashioned way, by squirting the mutated H5N1 into the nose of a ferret and then implanting nasal fluid from that ferret into the nose of another. After ten such manipulations, the virus began to spread rapidly around the ferret cages in his lab. Ferrets that received high doses of H5N1 died within days, but several survived exposure to lower doses. When Fouchier examined the flu cells closely, he became even more alarmed. There were only five genetic changes in two of the viruses’ eight genes. But each mutation had already been found circulating naturally in influenza viruses. Fouchier’s achievement was to place all five mutations together in one virus, which meant that nature could do precisely what he had done in the lab. Fouchier’s report caused a sensation. Scientists harbored new fears of a natural pandemic, and biological-weapons experts maintained that Fouchier’s bird flu posed a threat to hundreds of millions of people. The most important question about the continued use of the virus, and the hardest to answer, is how likely it is to escape the laboratory. Last December, the National Science Advisory Board for Biosecurity, a panel of science, defense, and public-health experts, was asked by the Department of Health and Human Services to evaluate Fouchier’s research. The panel recommended that the two principal scientific journals, Science and Nature, reconsider plans to publish information about the methods used to create the H5N1 virus. It was the first time that the Advisory Board, which was formed after the anthrax attacks of 2001, had issued such a request. Widespread alarm led Science and Nature to agree to postpone publication. Writer interviews a number of scientists about the possibility that publishing the research might help terrorists or contribute to the spread of the virus.


Read more http://www.newyorker.com/reporting/2012 ... z1oFb1M63T

_________________
www.twitter.com/hniman


Top
 Profile  
 
Display posts from previous:  Sort by  
Post new topic Reply to topic  [ 224 posts ]  Go to page Previous  1 ... 11, 12, 13, 14, 15, 16, 17 ... 23  Next

All times are UTC - 5 hours [ DST ]


Who is online

Users browsing this forum: niman and 109 guests


You cannot post new topics in this forum
You cannot reply to topics in this forum
You cannot edit your posts in this forum
You cannot delete your posts in this forum
You cannot post attachments in this forum

Search for:
Jump to:  
Powered by phpBB® Forum Software © phpBB Group