Rhiza Labs FluTracker Forum

The place to discuss the flu
It is currently Mon May 20, 2013 8:37 am

All times are UTC - 5 hours [ DST ]




Post new topic Reply to topic  [ 224 posts ]  Go to page Previous  1 ... 8, 9, 10, 11, 12, 13, 14 ... 23  Next
Author Message
PostPosted: Wed Feb 22, 2012 12:10 pm 
Online

Joined: Wed Aug 19, 2009 10:42 am
Posts: 27294
Location: Pittsburgh, PA USA
niman wrote:
niman wrote:
In contrast, when the ferrets
were infected with EG06-196R/226L/228S virus, viral shedding was
detected in the nasal secretions of direct contact ferrets, although
no infection was evident in ferrets exposed to respiratory droplets
(Table 2). The results suggest that a measurable increase in H5N1
virus transmission via direct contact in ferrets can be imparted by
modification of HA molecules approximating a human virus receptor
specificity.

Remarkably, the EG06-196R/226L/228S virus exhibited little α2-3 sialoglycan binding and strong binding to α2-6 sialoglycans (Fig. 4). Thus, unlike the natural human H5N1 isolates that exhibit weak binding to α2-6 sialosides and strong binding to α2-3 sialosides, this mutant exhibits a nearly complete switch in specificity, characteristic of the pandemic human influenza viruses of 1957 and 1968.

A reverse genetics virus with HA of EG06-196R/226L/228S, the N2 neuraminidase from a human seasonal H3N2 virus, A/Brisbane/10/2007, and 6 internal genes from a clade 1 H5N1 virus, VN04, known to replicate efficiently in ferrets (Maines et al., 2011), was generated and evaluated in the ferret transmission model. As shown in Table 2, both direct contact ferrets that were housed in the same cage with inoculated ferrets became infected, as evidenced by virus shedding and seroconversion results. In addition, viral shedding was also detected in one of two ferrets housed in adjacent cages and exposed only via respiratory droplets.

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Wed Feb 22, 2012 12:14 pm 
Online

Joined: Wed Aug 19, 2009 10:42 am
Posts: 27294
Location: Pittsburgh, PA USA
Highly pathogenic H5N1 viruses, A/Vietnam/1203/2004 (clade 1) and A/egret/Egypt/1162/2006 (clade 2.2) herein VN04 and EG06 respectively, were obtained from the WHO Global Influenza Surveillance Network (WHO/FAO/OIE, 2007)

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Wed Feb 22, 2012 12:20 pm 
Online

Joined: Wed Aug 19, 2009 10:42 am
Posts: 27294
Location: Pittsburgh, PA USA
niman wrote:
Highly pathogenic H5N1 viruses, A/Vietnam/1203/2004 (clade 1) and A/egret/Egypt/1162/2006 (clade 2.2) herein VN04 and EG06 respectively, were obtained from the WHO Global Influenza Surveillance Network (WHO/FAO/OIE, 2007)

Both of the above isolates have PB2 E627K.

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Wed Feb 22, 2012 12:40 pm 
Online

Joined: Wed Aug 19, 2009 10:42 am
Posts: 27294
Location: Pittsburgh, PA USA
niman wrote:
niman wrote:
Highly pathogenic H5N1 viruses, A/Vietnam/1203/2004 (clade 1) and A/egret/Egypt/1162/2006 (clade 2.2) herein VN04 and EG06 respectively, were obtained from the WHO Global Influenza Surveillance Network (WHO/FAO/OIE, 2007)

Both of the above isolates have PB2 E627K.

LOCUS EU719116 1607 bp cRNA linear VRL 30-MAY-2008
DEFINITION Influenza A virus (A/egret/Egypt/1162-NAMRU3/2006(H5N1))
hemagglutinin (HA) gene, partial cds.
ACCESSION EU719116
VERSION EU719116.1 GI:188526750
KEYWORDS .
SOURCE Influenza A virus (A/egret/Egypt/1162-NAMRU3/2006(H5N1))
ORGANISM Influenza A virus (A/egret/Egypt/1162-NAMRU3/2006(H5N1))
Viruses; ssRNA negative-strand viruses; Orthomyxoviridae;
Influenzavirus A.
REFERENCE 1 (bases 1 to 1607)
AUTHORS Saad,M.D., Ahmed,l.E., Abd El-Halem,M., Mohamed,N.A., Goda,A.S.,
Earhart,K.C., De Mattos,C., Ayoub,E.A., Elassal,E.M. and
Tjaden,J.A.
TITLE Hemagglutinin gene of influenza A virus subtype H5N1 from Egypt
JOURNAL Unpublished
REFERENCE 2 (bases 1 to 1607)
AUTHORS Saad,M.D., Ahmed,l.E., Abd El-Halem,M., Mohamed,N.A., Goda,A.S.,
Earhart,K.C., De Mattos,C., Ayoub,E.A., Elassal,E.M. and
Tjaden,J.A.
TITLE Direct Submission
JOURNAL Submitted (14-MAY-2008) Viral and Zoonotic Diseases Research
Program, U.S. Naval Medical Research Unit No. 3, Extension of
Ramses Street, Nasr City, Cairo 11517, Egypt
FEATURES Location/Qualifiers
source 1..1607
/organism="Influenza A virus
(A/egret/Egypt/1162-NAMRU3/2006(H5N1))"
/mol_type="viral cRNA"
/strain="A/egret/Egypt/1162-NAMRU3/2006"
/serotype="H5N1"
/host="egret"
/db_xref="taxon:529611"
/segment="4"
/country="Egypt"
/collection_date="Feb-2006"
gene <1..>1607
/gene="HA"
CDS <1..>1607
/gene="HA"
/codon_start=1
/product="hemagglutinin"
/protein_id="ACD62257.1"
/db_xref="GI:188526751"
/translation="QICIGYHANNSTEQVDTIMEKNVTVTHAQDILEKTHNGKLCDLD
GVKPLILRDCSVAGWLLGNPMCDEFLNVPEWSYIVEKINPANDLCYPGNFNDYEELKH
LLSRINHFEKIQIIPKSSWSDHEASSGVSSACPYQGRSSFFRNVVWLIKKDNAYPTIK
RSYNNTNQEDLLVLWGIHHPNDAAEQTRLYQNPTTYISVGTSTLNQRLVPKIATRSKV
NGQSGRMEFFWTILKSNDAINFESNGNFIAPENAYKIVKKGDSTIMKSELEYGNCNTK
CQTPIGAINSSMPFHNIHPLTIGECPKYVKSNRLVLATGLRNSPQGERRRKKRGLFGA
IAGFIEGGWQGMVDGWYGYHHSNEQGSGYAADKESTQKAIDGVTNKVNSIIDKMNTQF
EAVGREFNNLERRIENLNKKMEDGFLDVWTYNAELLVLMENERTLDFHDSNVKNLYDK
VRLQLRDNAKELGNGCFEFYHRCDNECMESVRNGTYDYPQYSEEARLKREEISGVKLE
SIGTYQILSIYSTVASSLALAIMVAGL"
ORIGIN
1 cagatttgca ttggttacca tgcaaacaac tcgacagagc aggttgacac aataatggaa
61 aagaacgtca ctgttacaca cgcccaagac atactggaaa agacacacaa cgggaaactc
121 tgcgatctag atggagtgaa gcctctaatt ttaagagatt gtagtgtagc tggatggctc
181 ctcgggaacc caatgtgtga cgaattcctc aatgtgccgg aatggtctta catagtggag
241 aagatcaatc cagccaatga cctctgttac ccagggaatt tcaacgacta tgaagaactg
301 aaacacctat tgagcagaat aaaccatttt gagaaaattc agatcatccc caaaagttct
361 tggtcagatc atgaagcctc atcaggagtg agctcagcat gtccatacca gggaagatcc
421 tcctttttta gaaatgtggt atggcttatc aaaaaggaca atgcataccc aacaataaag
481 agaagttaca ataataccaa ccaagaagat cttttggtac tgtgggggat tcaccatcca
541 aatgatgcgg cagagcagac aaggctctat caaaacccaa ctacctatat ttccgttggg
601 acatcaacac taaaccagag attggtacca aaaatagcta ctagatctaa ggtaaacggg
661 caaagtggaa ggatggagtt cttttggaca attttaaaat cgaatgatgc aataaacttt
721 gagagtaatg gaaatttcat tgctccagaa aatgcataca aaattgtcaa gaaaggggac
781 tcaacaatta tgaaaagtga gttggaatat ggtaactgca acaccaagtg tcaaactcca
841 ataggggcga taaactccag tatgccattc cacaacatcc accctctcac catcggggaa
901 tgccccaaat atgtgaaatc aaacagatta gtccttgcta ctgggctcag aaatagccct
961 caaggagaga gaagaagaaa aaagagagga ctatttggag ctatagcagg ttttatagag
1021 ggaggatggc agggaatggt agatggttgg tatgggtacc accatagcaa cgagcagggg
1081 agtgggtacg ctgcagacaa agaatccact caaaaggcaa tagatggagt caccaataag
1141 gtcaactcga tcattgacaa aatgaacact cagtttgagg ctgttggaag ggaatttaat
1201 aacttagaaa ggagaataga aaatttaaac aagaagatgg aagacggatt cctagatgtc
1261 tggacttata atgctgaact tctggttctc atggaaaatg agagaactct agactttcat
1321 gactcaaatg tcaagaacct ttacgacaag gtccgactac agcttaggga taatgcaaag
1381 gagcttggta acggttgttt cgagttctat cacagatgtg ataatgaatg tatggaaagt
1441 gtaagaaacg gaacgtatga ctacccgcag tattcagaag aagcaagatt aaaaagagag
1501 gaaataagtg gagtaaaatt ggaatcaata ggaacttacc aaatactgtc aatttattca
1561 acagtggcga gctccctagc actggcaatc atggtggctg gtctatt

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Wed Feb 22, 2012 12:44 pm 
Online

Joined: Wed Aug 19, 2009 10:42 am
Posts: 27294
Location: Pittsburgh, PA USA
niman wrote:
niman wrote:
Highly pathogenic H5N1 viruses, A/Vietnam/1203/2004 (clade 1) and A/egret/Egypt/1162/2006 (clade 2.2) herein VN04 and EG06 respectively, were obtained from the WHO Global Influenza Surveillance Network (WHO/FAO/OIE, 2007)

Both of the above isolates have PB2 E627K.

LOCUS AY651719 2280 bp cRNA linear VRL 31-MAR-2008
DEFINITION Influenza A virus (A/Viet Nam/1203/2004(H5N1)) polymerase basic
subunit 2 (PB2) gene, complete cds.
ACCESSION AY651719
VERSION AY651719.1 GI:50296547
KEYWORDS .
SOURCE Influenza A virus (A/Viet Nam/1203/2004(H5N1))
ORGANISM Influenza A virus (A/Viet Nam/1203/2004(H5N1))
Viruses; ssRNA negative-strand viruses; Orthomyxoviridae;
Influenzavirus A.
REFERENCE 1 (bases 1 to 2280)
AUTHORS Li,K.S., Guan,Y., Wang,J., Smith,G.J., Xu,K.M., Duan,L.,
Rahardjo,A.P., Puthavathana,P., Buranathai,C., Nguyen,T.D.,
Estoepangestie,A.T., Chaisingh,A., Auewarakul,P., Long,H.T.,
Hanh,N.T., Webby,R.J., Poon,L.L., Chen,H., Shortridge,K.F.,
Yuen,K.Y., Webster,R.G. and Peiris,J.S.
TITLE Genesis of a highly pathogenic and potentially pandemic H5N1
influenza virus in eastern Asia
JOURNAL Nature 430 (6996), 209-213 (2004)
PUBMED 15241415
REFERENCE 2 (bases 1 to 2280)
AUTHORS Li,K.S., Guan,Y., Wang,J., Smith,G.J.D., Xu,K.M., Duan,L.,
Rahardjo,A.P., Puthavathana,P., Buranathai,C., Nguyen,T.D.,
Estoepangestie,A.T.S., Chaisingh,A., Auewarakul,P., Long,H.T.,
Hanh,N.T.H., Lim,W., Webby,R.J., Poon,L.L., Chen,H.,
Shortridge,K.F., Yuen,K.Y., Webster,R.G. and Peiris,J.S.M.
TITLE Direct Submission
JOURNAL Submitted (14-JUN-2004) Microbiology, The University of Hong Kong,
HKU Pathology Building, QueenMary Hospital, Pokfulam, Hong Kong
SAR, China
FEATURES Location/Qualifiers
source 1..2280
/organism="Influenza A virus (A/Viet Nam/1203/2004(H5N1))"
/mol_type="viral cRNA"
/strain="A/Viet Nam/1203/2004"
/db_xref="taxon:284218"
/country="Viet Nam"
/note="subtype: H5N1"
gene 1..2280
/gene="PB2"
CDS 1..2280
/gene="PB2"
/codon_start=1
/product="polymerase basic subunit 2"
/protein_id="AAT73550.1"
/db_xref="GI:50296548"
/translation="MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPA
LRMKWMMAMKYPITADKRIIEMIPERNEQGQTLWSKTNDAGSDRVMVSPLAVTWWNRN
GPATSAVHYPKVYKTYFEKVERLKHGTFGPVHFRNQVKIRRRVDINPGHADLSAKEAQ
DVIMEVVFPNEVGARILTSESQLTITKEKKEELQDCKIAPLMVAYMLERELVRKTRFL
PVAGGTSSVYIEVLHLTQGTCWEQMYTPGGEVRNDDVDQSLIIAARNIVRRATVSADP
LASLLEMCHSTQIGGIRMVDILRQNPTEEQAVDICKAAMGLRISSSFSFGGFTFKRTS
GSSVKKEEEVLTGNLQTLKIRVHEGYEEFTMVGRRATAILRKATRRLIQLIVSGRDQQ
SIAEAIIVAMVFSQEDCMIKAVRGDLNFVNRANQRLNPMHQLLRHFQKDAKVLFQNWG
IEPIDNVMGMIGILPDMTPSTEMSLRGVRVSKMGVDEYSSTERVVVSIDRFLRVRDQR
GNVLLSPEEVSETQGTEKLTITYSSSMMWEINGPESVLVNTYQWIIRNWETVKIQWSQ
DPTMLYNKMEFEPFQSLVPKAARGQYSGFVRTLFQQMRDVLGTFDTVQIIKLLPFAAA
PPKQSRMQFSSLTVNVRGSGMRILVRGNSPVFNYNKATKRLTVLGKDAGALTEDPDEG
TAGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGEKANVLIGQGDVVLVMKRKRD
SSILTDSQTATKRIRMAIN"
ORIGIN
1 atggagagaa taaaagaatt acgagatcta atgtcacagt cccgcactcg cgagatacta
61 acaaaaacca ctgtggacca tatggccata atcaagaaat acacatcagg aagacaagag
121 aagaaccctg ctctcagaat gaaatggatg atggcaatga aatatccaat cacagcggac
181 aagagaataa tagagatgat tcctgaaagg aatgaacaag ggcagacgct ctggagcaag
241 acaaatgatg ctggatcgga cagggtgatg gtgtctcccc tagctgtaac ttggtggaat
301 aggaatgggc cggcgacaag tgcagttcat tatccaaagg tttacaaaac atactttgag
361 aaggttgaaa gattaaaaca tggaaccttc ggtcccgttc atttccgaaa ccaggttaaa
421 atacgccgcc gagttgatat aaatcctggc catgcagatc tcagtgctaa agaagcacaa
481 gatgtcatca tggaggtcgt tttcccaaat gaagtgggag ctagaatatt gacatcagag
541 tcgcaattga caataacgaa agagaagaaa gaagagctcc aagattgtaa gattgctccc
601 ttaatggttg catacatgtt ggaaagggaa ctggtccgca aaaccagatt cctaccggta
661 gcaggcggaa caagtagtgt gtacattgag gtattgcatt tgactcaagg gacctgctgg
721 gaacagatgt acactccagg cggagaagtg agaaatgacg atgttgacca gagtttgatc
781 attgctgcca gaaacattgt taggagagca acagtatcag cggatccact ggcatcactg
841 ctggagatgt gtcacagcac acaaattggt gggataagga tggtggacat ccttaggcaa
901 aatccaactg aggaacaagc tgtggatata tgcaaagcag caatgggtct taggatcagt
961 tcttccttta gctttggagg cttcactttc aaaagaacaa gtggatcatc cgtcaagaag
1021 gaagaggaag tgcttacagg caacctccaa acattgaaaa taagagtaca tgaggggtat
1081 gaggaattca caatggttgg gcggagggca acagctatcc tgaggaaagc aactagaagg
1141 ctgattcagt tgatagtaag tggaagagac caacaatcaa tcgctgaggc aatcattgta
1201 gcaatggtgt tctcacagga ggattgcatg ataaaggcag tccgaggcga tctgaatttc
1261 gtaaacagag caaaccaaag attaaacccc atgcatcaac tcctgagaca ttttcaaaag
1321 gacgcaaaag tgctatttca gaattgggga attgaaccca ttgataatgt catggggatg
1381 atcggaatat tacctgacat gactcccagc acagaaatgt cactgagagg agtaagagtt
1441 agtaaaatgg gagtggatga atattccagc actgagagag tagttgtaag tattgaccgt
1501 ttcttaaggg ttcgagatca gcgggggaac gtactcttat ctcccgaaga ggtcagcgaa
1561 acccagggaa cagagaaatt gacaataaca tattcatcat caatgatgtg ggaaatcaac
1621 ggtcctgagt cagtgcttgt taacacctat cagtggatca tcagaaactg ggagactgtg
1681 aagattcaat ggtctcaaga ccccacgatg ctgtacaata agatggagtt tgaaccgttc
1741 caatccttgg tacccaaagc tgccagaggt caatacagtg gatttgtgag aacattattc
1801 cagcaaatgc gtgacgtact ggggacattt gatactgtcc agataataaa gctgctacca
1861 tttgcagcag ccccaccgaa gcagagcaga atgcagtttt cttctctaac tgtgaatgtg
1921 agaggctcag gaatgagaat actcgtaagg ggcaattccc ctgtgttcaa ctacaataag
1981 gcaaccaaaa ggcttaccgt ccttggaaag gacgcaggtg cattaacaga ggatccggat
2041 gaagggacag ccggagtgga gtctgcagta ctgaggggat tcttaatttt aggcaaggag
2101 gacaaaaggt atggaccagc attgagcatc aatgaactga gcaatcttgc gaagggggag
2161 aaagctaatg tgctgatagg gcaaggagac gtggtgttgg taatgaaacg aaaacgggac
2221 tctagcatac ttactgacag ccagacagcg accaaaagaa ttcggatggc catcaattag

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Wed Feb 22, 2012 1:22 pm 
Online

Joined: Wed Aug 19, 2009 10:42 am
Posts: 27294
Location: Pittsburgh, PA USA
A reverse genetics virus with HA of EG06-196R/
226L/228S, the N2 neuraminidase from a human seasonal H3N2
virus, A/Brisbane/10/2007, and 6 internal genes from a clade 1
H5N1 virus, VN04, known to replicate efficiently in ferrets (Maines
et al., 2011), was generated and evaluated in the ferret transmission
model.

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Wed Feb 22, 2012 1:41 pm 
Online

Joined: Wed Aug 19, 2009 10:42 am
Posts: 27294
Location: Pittsburgh, PA USA
Commentary
http://www.recombinomics.com/News/02221 ... etail.html

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Wed Feb 22, 2012 2:11 pm 
Online

Joined: Wed Aug 19, 2009 10:42 am
Posts: 27294
Location: Pittsburgh, PA USA
Bioterror is not the biggest threat from bird flu
22 February 2012
Magazine issue 2853. Subscribe and save
For similar stories, visit the Epidemics and Pandemics , Editorials and Bird Flu Topic Guides
WHY DO we study flu? So we can protect ourselves from it. We've long since learned that H5N1 bird flu poses real reasons for concern; more recently, that it really does have the potential to become a nightmarish airborne plague. How should we react?

Not by delaying the publication of the research, for fear that it will aid supposed bioterrorists (see "Publish lethal flu virus work, says WHO"). There is surprisingly little evidence that such a threat exists. But there has long been a great deal of evidence that the threat of pandemic flu exists.

It is high time we ended it. We know existing flu vaccines, which date back to the 1950s, won't do the job. A vaccine that works against all types of flu - pandemic and seasonal - could. And promisingly, we have made some progress in this direction.

Yet with no commercial route to market, and regulators unable to agree on testing protocols, investment in universal flu vaccine is waning. If half the energy that went into seeing bioterrorists behind every Petri dish was expended on overcoming these obstacles, the squabble over publishing H5N1 research would become what it should be: purely academic.

http://www.newscientist.com/article/mg2 ... d-flu.html

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Wed Feb 22, 2012 3:47 pm 
Online

Joined: Wed Aug 19, 2009 10:42 am
Posts: 27294
Location: Pittsburgh, PA USA
Harvard discussion
http://www.hsph.harvard.edu/forum/bird-flu-research.cfm

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Wed Feb 22, 2012 5:13 pm 
Online

Joined: Wed Aug 19, 2009 10:42 am
Posts: 27294
Location: Pittsburgh, PA USA
Commentary
http://www.recombinomics.com/News/02221 ... rsity.html

_________________
www.twitter.com/hniman


Top
 Profile  
 
Display posts from previous:  Sort by  
Post new topic Reply to topic  [ 224 posts ]  Go to page Previous  1 ... 8, 9, 10, 11, 12, 13, 14 ... 23  Next

All times are UTC - 5 hours [ DST ]


Who is online

Users browsing this forum: Dingo, niman and 62 guests


You cannot post new topics in this forum
You cannot reply to topics in this forum
You cannot edit your posts in this forum
You cannot delete your posts in this forum
You cannot post attachments in this forum

Search for:
Jump to:  
Powered by phpBB® Forum Software © phpBB Group