Rhiza Labs FluTracker Forum

The place to discuss the flu
It is currently Tue May 21, 2013 8:18 am

All times are UTC - 5 hours [ DST ]




Post new topic Reply to topic  [ 7 posts ] 
Author Message
PostPosted: Wed Jan 04, 2012 11:32 am 
Online

Joined: Wed Aug 19, 2009 10:42 am
Posts: 27329
Location: Pittsburgh, PA USA
http://www.ncbi.nlm.nih.gov/pubmed/22090121

J Virol. 2011 Nov 16. [Epub ahead of print]

Highly Pathogenic Avian Influenza Subtype H5N1 escaping neutralization: more than HA variation.

Höper D, Kalthoff D, Hoffmann B, Beer M.


Source

Institute of Diagnostic Virology, Friedrich-Loeffler-Institut, Südufer 10, 17493 Greifswald-Insel Riems, Germany.


Abstract

Influenza A viruses are one of the major threats in modern health care. Novel viruses arise due to antigenic drift and antigenic shift, leading to escape from the immune system and resulting in a serious problem for disease control. In order to investigate the escape process and to enable predictions of escape, we serially passaged influenza A H5N1 virus in vitro 100 times under immune pressure. The generated escape viruses were characterized phenotypically and in detail by full genome deep sequencing. Mutations already found in natural isolates were detected, evidencing the in vivo relevance of the in vitro induced amino acid substitutions. Additionally, several novel alterations were triggered. Altogether, the results imply that our in vitro system is suitable to study influenza A virus evolution and that it might even be possible to predict antigenic changes of influenza A viruses circulating in vaccinated populations.

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Wed Jan 04, 2012 11:39 am 
Online

Joined: Wed Aug 19, 2009 10:42 am
Posts: 27329
Location: Pittsburgh, PA USA
niman wrote:
http://www.ncbi.nlm.nih.gov/pubmed/22090121

J Virol. 2011 Nov 16. [Epub ahead of print]

Highly Pathogenic Avian Influenza Subtype H5N1 escaping neutralization: more than HA variation.

Höper D, Kalthoff D, Hoffmann B, Beer M.


Source

Institute of Diagnostic Virology, Friedrich-Loeffler-Institut, Südufer 10, 17493 Greifswald-Insel Riems, Germany.


Abstract

Influenza A viruses are one of the major threats in modern health care. Novel viruses arise due to antigenic drift and antigenic shift, leading to escape from the immune system and resulting in a serious problem for disease control. In order to investigate the escape process and to enable predictions of escape, we serially passaged influenza A H5N1 virus in vitro 100 times under immune pressure. The generated escape viruses were characterized phenotypically and in detail by full genome deep sequencing. Mutations already found in natural isolates were detected, evidencing the in vivo relevance of the in vitro induced amino acid substitutions. Additionally, several novel alterations were triggered. Altogether, the results imply that our in vitro system is suitable to study influenza A virus evolution and that it might even be possible to predict antigenic changes of influenza A viruses circulating in vaccinated populations.

P198S in Shenzhen case identified by passage of clade 2.2 isolate

A/cygnus cygnus/Germany/R65/2006]-P18-escape/2008

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Wed Jan 04, 2012 11:40 am 
Online

Joined: Wed Aug 19, 2009 10:42 am
Posts: 27329
Location: Pittsburgh, PA USA
P198S
EPI347304 A/Guangdong-Shenzhen/1/2011(H5N1) (A/H5N1) segment 4 (HA) 27.0 7.414894e+00 14/14 (100%)
EPI287212 A/MDCK/Germany/[A/cygnus cygnus/Germany/R65/2006]-P18-escape/2008 (H5N1) (A/H5N1) segment 4 (HA) 27.0 7.414894e+00 14/14 (100%)
EPI263404 A/Cygnus olor/Caspian Sea/2006 (A/H5N1) segment 4 (HA) 27.0 7.414894e+00 14/14 (100

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Wed Jan 04, 2012 11:47 am 
Online

Joined: Wed Aug 19, 2009 10:42 am
Posts: 27329
Location: Pittsburgh, PA USA
LOCUS CY063860 1779 bp cRNA linear VRL 27-MAY-2010
DEFINITION Influenza A virus(A/Cygnus olor/Caspian Sea/2006(H5N1)) segment 4
sequence.
ACCESSION CY063860
VERSION CY063860.1 GI:296936743
KEYWORDS .
SOURCE Influenza A virus(A/Cygnus olor/Caspian Sea/2006(H5N1))
ORGANISM Influenza A virus(A/Cygnus olor/Caspian Sea/2006(H5N1))
Viruses; ssRNA negative-strand viruses; Orthomyxoviridae;
Influenzavirus A.
REFERENCE 1 (bases 1 to 1779)
AUTHORS Ilinykh,P.A., Shestopalov,A.M., Sharshov,K.A., Franks,J. and
Webster,R.G.
TITLE Field Surveilence
JOURNAL Unpublished
REFERENCE 2 (bases 1 to 1779)
AUTHORS Ilinykh,P.A., Shestopalov,A.M., Sharshov,K.A., Franks,J. and
Webster,R.G.
TITLE Direct Submission
JOURNAL Submitted (27-MAY-2010) Infectious Disease, St. Jude Children's
Hospital, 262 Danny Thomas Place, Memphis, TN 38105, USA
FEATURES Location/Qualifiers
source 1..1779
/organism="Influenza A virus(A/Cygnus olor/Caspian
Sea/2006(H5N1))"
/mol_type="viral cRNA"
/strain="A/Cygnus olor/Caspian Sea/2006"
/serotype="H5N1"
/host="Cygnus olor"
/db_xref="taxon:767934"
/segment="4"
/country="Russia"
/collection_date="2006"
misc_feature 1..1779
/db_xref="IRD:CEIRS-SJC043-jf0013.4"
gene 29..1735
/gene="HA"
CDS 29..1735
/gene="HA"
/function="receptor binding and fusion protein"
/codon_start=1
/product="hemagglutinin"
/protein_id="ADH94411.1"
/db_xref="GI:296936744"
/translation="MEKIVLLFAIVSLVKSDQICIGYHANNSTEQVDTIMEKNVTVTH
AQDILEKTHNGKLCDLDGVKPLILRDCSVAGWLLGNPMCDEFLNVPEWSYIVEKINPA
NDLCYPGNFNDYEELKHLLSRINHFEKIQIIPKSSWSDHEASSGVSSACPYQGRSSFF
RNVVWLIKKDNAYPTIKRSYNNTNQEDLLVLWGIHHPNDAAEQTRLYQNSTTYISVGT
STLNQRLVPKIATRSKVNGQSGRMEFFWTILKPNDAINFESNGNFIAPENAYKIVKKG
DSTIMKSELEYGNCNTKCQTPIGAINSSMPFHNIHPLTIGECPKYVKSNRLVLATGLR
NSPQGERRRKKRGLFGAIAGFIEGGWQGMVDGWYGYHHSNEQGSGYAADKESTQKAID
GVTNKVNSIIDKMNTQFEAVGREFNNLERRIENLNKKMEDGFLDVWTYNAELLVLMEN
ERTLDFHDSNVKNLYDKVRLQLRDNAKELGNGCFEFYHRCDNECMESVRNGTYDYPQY
SEEARLKREEISGVKLESIGTYQILSIYSTVASSLALAIMVAGLSLWMCSNGSLQCRI
CI"
sig_peptide 29..76
/gene="HA"
mat_peptide 77..1066
/gene="HA"
/product="HA1"
mat_peptide 1067..1732
/gene="HA"
/product="HA2"
ORIGIN
1 agcaaaagca ggggttcaat ctgtcaaaat ggagaaaata gtgcttcttt ttgcaatagt
61 cagtcttgtt aaaagtgatc agatttgcat tggttaccat gcaaacaact cgacagagca
121 ggttgacaca ataatggaaa agaacgtcac tgttacacac gcccaagaca tactggaaaa
181 gacacacaac gggaagctct gcgatctaga tggagtgaag cctctaattt taagagattg
241 tagtgtagct ggatggctcc tcgggaaccc aatgtgtgac gaattcctca atgtgccgga
301 atggtcttac atagtggaga agatcaatcc agccaatgac ctctgttacc cagggaattt
361 caacgactat gaagaactga aacacctatt gagcagaata aaccattttg agaaaattca
421 gatcatcccc aaaagttctt ggtcagatca tgaagcctca tcaggggtga gctcagcatg
481 tccataccag ggaaggtcct ccttttttag aaatgtggta tggcttatca aaaaggacaa
541 tgcataccca acaataaaga gaagttacaa taataccaac caagaagatc ttttggtact
601 gtgggggatt caccatccaa atgatgcggc agagcagaca aggctctatc aaaactcaac
661 cacctatatt tccgttggga catcaacact aaaccagaga ttggtaccaa aaatagctac
721 tagatccaag gtaaacgggc aaagtggaag gatggagttc ttttggacaa ttttaaaacc
781 gaatgatgca ataaactttg agagtaatgg aaatttcatt gctccagaaa atgcatacaa
841 aattgtcaag aaaggggact caacaattat gaaaagtgaa ttggaatatg gtaactgcaa
901 caccaagtgt caaactccaa taggggcgat aaactctagt atgccattcc acaacatcca
961 ccctctcacc atcggggaat gccccaaata tgtgaaatca aacagattag tccttgcgac
1021 tgggctcaga aatagccctc aaggagagag aagaagaaaa aagagaggac tatttggagc
1081 tatagcaggt tttatagaag gaggatggca gggaatggta gatggttggt atgggtacca
1141 tcatagcaac gagcagggga gtgggtacgc tgcagacaaa gaatccactc aaaaggcaat
1201 agatggagtc accaataagg tcaactcgat cattgacaaa atgaacactc agtttgaggc
1261 cgttggaagg gaatttaata acttagaaag gagaatagaa aatttaaaca agaagatgga
1321 agacggattc ctagatgtct ggacttataa tgctgaactt ctggttctca tggaaaatga
1381 gagaactcta gactttcatg actcaaatgt caagaacctt tacgacaagg tccgactaca
1441 gcttagggat aatgcaaagg aacttggtaa cggttgtttc gagttctatc acagatgtga
1501 taatgaatgt atggaaagtg taagaaacgg tacgtatgac tacccgcagt attcagaaga
1561 agcaagatta aaaagagagg aaataagtgg agtaaaattg gaatcaatag gaacctacca
1621 aatactgtca atttattcaa cagtggcgag ctccctagca ctggcaatca tggtggctgg
1681 tctatcttta tggatgtgct ccaatggatc gttgcaatgc agaatttgca tttaaatttg
1741 tgagttcaga ttgtagttaa aaacaccctt gtttctact

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Wed Jan 04, 2012 11:58 am 
Online

Joined: Wed Aug 19, 2009 10:42 am
Posts: 27329
Location: Pittsburgh, PA USA
LOCUS DQ464354 1779 bp cRNA linear VRL 26-JAN-2007
DEFINITION Influenza A virus (A/swan/Germany/R65/2006(H5N1)) hemagglutinin
(HA) gene, complete cds.
ACCESSION DQ464354
VERSION DQ464354.1 GI:94471647
KEYWORDS .
SOURCE Influenza A virus (A/swan/Germany/R65/2006(H5N1))
ORGANISM Influenza A virus (A/swan/Germany/R65/2006(H5N1))
Viruses; ssRNA negative-strand viruses; Orthomyxoviridae;
Influenzavirus A.
REFERENCE 1 (bases 1 to 1779)
AUTHORS Weber,S., Harder,T., Starick,E., Beer,M., Werner,O., Hoffmann,B.,
Mettenleiter,T.C. and Mundt,E.
TITLE Molecular analysis of highly pathogenic avian influenza virus of
subtype H5N1 isolated from wild birds and mammals in northern
Germany
JOURNAL J. Gen. Virol. 88 (PT 2), 554-558 (2007)
PUBMED 17251574
REFERENCE 2 (bases 1 to 1779)
AUTHORS Mundt,E., Weber,S., Harder,T., Mettenleiter,T.C. and Werner,O.
TITLE Direct Submission
JOURNAL Submitted (28-MAR-2006) Institute of Molecular Biology, Federal
Research Institute for Animal Health, Boddenblick 5a,
Greifswald-Insel Riems D-17493, Germany
FEATURES Location/Qualifiers
source 1..1779
/organism="Influenza A virus
(A/swan/Germany/R65/2006(H5N1))"
/mol_type="viral cRNA"
/strain="A/swan/Germany/R65/2006"
/serotype="H5N1"
/isolation_source="allantoic fluid of an inoculated SPF
egg"
/db_xref="taxon:378547"
/country="Germany"
/collection_date="Feb-2006"
gene 29..1735
/gene="HA"
CDS 29..1735
/gene="HA"
/codon_start=1
/product="hemagglutinin"
/protein_id="ABE26829.1"
/db_xref="GI:94471648"
/translation="MEKIVLLFAIVSLVKSDQICIGYHANNSTEQVDTIMEKNVTVTH
AQDILEKTHNGKLCDLDGVKPLILRDCSVAGWLLGNPMCDEFLNVPEWSYIVEKINPA
NDLCYPGNFNDYEELKHLLSRINHFEKIQIIPKSSWSDHEASSGVSSACPYQGRSSFF
RNVVWLIKKDNAYPTIKRSYNNTNQEDLLVLWGIHHPNDAAEQTRLYQNPTTYISVGT
STLNQRLVPKIATRSKVNGQSGRMEFFWTILKPNDAINFESNGNFIAPENAYKIVKKG
DSTIMKSELEYGNCNTKCQTPIGAINSSMPFHNIHPLTIGECPKYVKSNRLVLATGLR
NSPQGERRRKKRGLFGAIAGFIEGGWQGMVDGWYGYHHSNEQGSGYAADKESTQKAID
GVTNKVNSIINKMNTQFEAVGREFNNLERRIENLNKKMEDGFLDVWTYNAELLVLMEN
ERTLDFHDSNVKNLYDKVRLQLRDNAKELGNGCFEFYHRCDNECMESVRNGTYDYPQY
SEEARLKREEISGVKLESIGTYQILSIYSTVASSLALAIMVAGLSLWMCSNGSLQCRI
CI"
ORIGIN
1 agcaaaagca ggggttcaat ctgtcaaaat ggagaaaata gtgcttcttt ttgcaatagt
61 cagtcttgtt aaaagtgatc agatttgcat tggttaccat gcaaacaact cgacagagca
121 ggttgacaca ataatggaaa agaacgtcac tgttacacac gcccaagaca tactggaaaa
181 gacacacaac gggaagctct gcgatctaga tggagtgaag cctctaattt taagagattg
241 tagtgtagct ggatggctcc tcgggaaccc aatgtgtgac gaattcctca atgtgccgga
301 atggtcttac atagtagaga agatcaatcc agccaatgac ctctgttacc cagggaattt
361 caacgactat gaagaactga aacacctatt gagcagaata aaccattttg agaaaattca
421 gatcatcccc aaaagttctt ggtcagatca tgaagcctca tcaggggtga gctcagcatg
481 tccataccag ggaaggtcct ccttttttag aaatgtggta tggcttatca aaaaggacaa
541 tgcataccca acaataaaga gaagttacaa taataccaac caagaagatc ttttggtact
601 gtgggggatt caccatccaa atgatgcggc agagcagaca aggctctatc aaaacccaac
661 cacctatatt tccgttggga catcaacact aaaccagaga ttggtaccaa aaatagctac
721 tagatccaag gtaaacgggc aaagtggaag gatggagttc ttttggacaa ttttaaaacc
781 gaatgatgca ataaactttg agagtaatgg aaatttcatt gctccagaaa atgcatacaa
841 aattgtcaag aaaggggact caacaattat gaaaagtgaa ttggaatatg gtaactgcaa
901 caccaagtgt caaactccaa taggggcgat aaactctagt atgccattcc acaacatcca
961 ccctctcacc atcggggaat gccccaaata tgtgaaatca aacagattag tccttgcgac
1021 tgggctcaga aatagccctc aaggagagag aagaagaaaa aagagaggac tatttggagc
1081 tatagcaggt tttatagagg gaggatggca gggaatggta gatggttggt atgggtacca
1141 ccatagcaac gagcagggga gtgggtacgc tgcagacaaa gaatccactc aaaaggcaat
1201 agatggagtc accaataagg tcaactcgat cattaacaaa atgaacactc agtttgaggc
1261 cgttggaagg gaatttaata acttagaaag gagaatagaa aatttaaaca agaagatgga
1321 agacggattc ctagatgtct ggacttataa tgctgaactt ctggttctca tggaaaatga
1381 gagaactcta gactttcatg actcaaatgt caagaacctt tacgacaagg tccgactaca
1441 gcttagggat aatgcaaagg agcttggtaa cggttgtttc gagttctatc acagatgtga
1501 taatgaatgc atggaaagtg taagaaacgg aacgtatgac tacccgcagt attcagaaga
1561 agcaagatta aaaagagagg aaataagtgg agtaaaattg gaatcaatag gaacctacca
1621 aatactgtca atttattcaa cagtggcgag ctccctagca ctggcaatca tggtggctgg
1681 tctatcttta tggatgtgct ccaatggatc gttacaatgc agaatttgca tttaaacttg
1741 tgagttcaga ttgtagttaa aaacaccctt gtttctact

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Wed Jan 04, 2012 12:49 pm 
Online

Joined: Wed Aug 19, 2009 10:42 am
Posts: 27329
Location: Pittsburgh, PA USA
Clade 2.3.2 Avian Influenza Virus (H5N1), Qinghai Lake Region, China, 2009–2010
Article Contents
LetterAcknowledgmentReferencesFigureSuggested CitationSuggested citation for this article

To the Editor: In 2005, a large population of wild migratory birds was infected with highly pathogenic avian influenza (HPAI) virus (H5N1) in the Qinghai Lake region of western People’s Republic of China, resulting in the death of ≈10,000 birds (1,2). On the basis of phylogenetic analysis of the hemagglutinin (HA) gene, the virus was classified as clade 2.2 according to the World Health Organization guidelines. Subsequently, viruses from this clade were found in Mongolia, Russia, Europe, and Africa along the migratory flyways of birds (3,4). This unique distribution of the same clade of HPAI virus (H5N1) through different migratory routes indicates that migratory birds might play a global role in virus dissemination (3,4).

In 2006, viruses from the same clade were isolated in the Qinghai Lake region (3). Analysis of viral outbreaks along migratory flyways demonstrated a similar outbreak pattern for the past 4 years (2006–2009) (5). During that period, clade 2.2 avian influenza virus (H5N1) was isolated in China, Mongolia, Russia, Germany, Egypt, and Nigeria; all viruses were closely related to the Qinghai Lake virus. Despite the broad distribution of clade 2.2 viruses in migratory flyways, few isolates of clade 2.2 viruses in local domestic poultry were reported, especially in China (6). Outbreaks of these viruses were reported in poultry in Africa (7). The reason these viruses rarely cause outbreaks in poultry is unknown.

During May–June 2009 and 2010, several dead migratory birds were found in the Qinghai Lake region. Nine HPAI viruses (H5N1) were isolated in 2009 and 2 were isolated in 2010 from great cormorants (Phalacrocorax carbo), brown-headed gulls (Chroicocephalus brunnicephalus), great black-headed gulls (Ichthyaetus ichthyaetus), great-crested grebes (Podiceps cristatus), and bar-headed geese (Anser indicus) and serotyped as described (3). HA genes from all 11 isolates were subsequently amplified by using reverse transcription–PCR and sequenced.

Figure


Figure. Bootstrapped (1,000×) maximum likelihood phylogenetic tree of hemagglutinin genes of avian influenza viruses (H5N1), People’s Republic of China, 2009–2010. Viruses isolated from the plateau pika near Qinghai Lake are indicated by...
Phylogenetic analysis of HA sequences and an additional HA gene sequence from the 2009 Qinghai Lake subtype H5N1 virus isolate from a great crested grebe (from the National Avian Influenza Virus Reference Laboratory, Harbin, China) (GenBank accession no. CY063318) showed that HA genes from all 12 viruses clustered as clade 2.3.2 (Figure); none clustered with clade 2.2 viruses. Additionally, the HA cleavage site in the new isolates is PQRERRRKRG, which is identical to that of clade 2.3.2 viruses. In clade 2.2, the cleavage site is PQRERRRKKRG.

A bootstrap (1,000×) maximum likelihood tree (8) also demonstrated that Qinghai 2009 and 2010 virus isolates are closely related to those isolated in Mongolia and Uvs Nuur Lake in 2009, as reported by Sharshov et al. (5). Qinghai Lake and Uvs Nuur Lake, which are found along the migratory flyway in central Asia, are major lakes for bird migration and breeding. Many birds fly from Qinghai Lake to Uvs Nuur Lake in the spring.

If one considers isolation date and bird species infected, viruses isolated in Mongolia and Russia and our isolates were likely transmitted between the 2 lake regions by bird migration. Moreover, HA sequences are closely related to viruses isolated from wild birds in Hong Kong and Japan during 2007–2008, which are the most recent isolates of clade 2.3.2 viruses before isolation of 2009 Qinghai Lake viruses. These results indicate that viruses in the Qinghai Lake region may be transmitted by wild birds along the migratory flyway in eastern Asia. However, there is no evidence that avian influenza virus (H5N1) is transmitted from eastern Asian (inner China or across the Himalayas) to the Qinghai Lake region.

The 2009 and 2010 Qinghai Lake viruses are related to various viruses isolated from plateau pikas near Qinghai Lake (9). In 2007, clade 2.2 and clade 2.3.2 viruses were isolated from plateau pikas, but no clade 2.3.2 viruses were found in aquatic birds. Wild birds, pikas, and other animals near Qinghai Lake share the same environment, and viruses may be transmitted across species. However, surveillance data are limited for wild animals near Qinghai Lake. Therefore, further investigations need to be conducted to clarify relationships among birds, animals, and influenza viruses near Qinghai Lake.

Our results and those of Sharshov et al. (5) show that in 2009 HPAI virus (H5N1) began infecting birds along the migratory route near Qinghai Lake and changed from clade 2.2 viruses to clade 2.3 viruses. New outbreaks of HPAI viruses (H5N1) along this migratory flyway should be investigated.

Xudong Hu, Di Liu, Mingyang Wang, Le Yang, Ming Wang, Qingyu Zhu, Laixing Li, and George F. Gao
Author affiliations: Author affiliations: China Agricultural University College of Veterinary Medicine, Beijing, People’s Republic of China (X. Hu, Ming Wang, G.F. Gao); Chinese Academy of Sciences (CAS) Key Laboratory of Pathogenic Microbiology and Immunology Institute of Microbiology, Beijing (X. Hu, D. Liu, Mingyang Wang, G.F. Gao); Graduate University CAS, Beijing (Mingyang Wang, G.F. Gao); Northwestern Institute of Plateau Biology CAS, Xining, China (L. Yang, L. Li); Tibet Plateau Institute of Biology, Lhasa, Tibet Autonomous Region, China (L. Yang); State Key Laboratory of Pathogens and Biosecurity Academy of Military Medical Sciences, Beijing (Q. Zhu); Beijing Institutes of Life Sciences CAS, Beijing (G.F. Gao)
Acknowledgment
This study was supported in part by the China Ministry of Science and Technology Project 973 (grants no. 2010CB530301 and 2010CB530303) and the US National Institutes of Health Comprehensive International Program of Research on AIDS–affiliated Project (grant no. 3 U19 AI051915-05S1). D.L. is partially supported by the Natural Science Foundation of China (grant no. 30800640). G.F.G. is leading principal investigator of the Innovative Research Group of the National Natural Science Foundation of China (grant no. 81021003).

References
1.Liu J, Xiao H, Lei F, Zhu Q, Qin K, Zhang X-W, Highly pathogenic H5N1 influenza virus infection in migratory birds. Science. 2005;309:1206. DOIPubMed
2.Chen H, Li Y, Li Z, Shi J, Shinya K, Deng G, Properties and dissemination of H5N1 viruses isolated during an influenza outbreak in migratory waterfowl in western China. J Virol. 2006;80:5976–83. DOIPubMed
3.Wang G, Zhan D, Li L, Lei F, Liu B, Liu D, H5N1 avian influenza re-emergence of Lake Qinghai: phylogenetic and antigenic analyses of the newly isolated viruses and roles of migratory birds in virus circulation. J Gen Virol. 2008;89:697–702. DOIPubMed
4.Liu D, Liu X, Yan J, Liu W-J, Gao GF. Interspecies transmission and host restriction of avian H5N1 influenza virus. Sci China C Life Sci. 2009;52:428–38. DOIPubMed
5.Sharshov K, Silko N, Sousloparov I, Zaykovskaya A, Shestopalov A, Drozdov I. Avian influenza (H5N1) outbreak among wild birds, Russia, 2009. Emerg Infect Dis. 2010;16:349–51.PubMed
6.Chen H. H5N1 avian influenza in China. Sci China C Life Sci. 2009;52:419–27. DOIPubMed
7.Monne I, Joannis TM, Fusaro A, De Benedictis P, Lombin LH, Ularamu H, Reassortant avian influenza virus (H5N1) in poultry, Nigeria, 2007. Emerg Infect Dis. 2008;14:637–40. DOIPubMed
8.Stamatakis A. RAxML-VI-HPC: maximum likelihood-based phylogenetic analyses with thousands of taxa and mixed models. Bioinformatics. 2006;22:2688–90. DOIPubMed
9.Zhou J, Sun W, Wang J, Guo J, Yin W, Wu N, Characterization of the H5N1 highly pathogenic avian influenza virus derived from wild pikas in China. J Virol. 2009;83:8957–64. DOIPubMed
Figure
Figure. Bootstrapped (1,000×) maximum likelihood phylogenetic tree of hemagglutinin genes of avian influenza viruses (H5N1), People’s Republic of China, 2009–2010. Viruses isolated from the plateau pika near Qinghai Lake are indicated...
Suggested citation for this article: Hu X, Liu D, Wang M, Yang L, Wang M, Zhu Q, et al. Clade 2.3.2 avian influenza virus (H5N1), Qinghai Lake region, China, 2009–2010 [letter]. Emerg Infect Dis [serial on the Internet]. 2011 Mar [date cited]. http://dx.doi.org/10.3201/eid1703.100948

DOI: 10.3201/eid1703.100948

1These authors contributed equally to this article.

http://wwwnc.cdc.gov/eid/article/17/3/1 ... rticle.htm

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Wed Jan 04, 2012 1:01 pm 
Online

Joined: Wed Aug 19, 2009 10:42 am
Posts: 27329
Location: Pittsburgh, PA USA
Commentary

http://www.recombinomics.com/News/01041 ... scape.html

_________________
www.twitter.com/hniman


Top
 Profile  
 
Display posts from previous:  Sort by  
Post new topic Reply to topic  [ 7 posts ] 

All times are UTC - 5 hours [ DST ]


Who is online

Users browsing this forum: No registered users and 28 guests


You cannot post new topics in this forum
You cannot reply to topics in this forum
You cannot edit your posts in this forum
You cannot delete your posts in this forum
You cannot post attachments in this forum

Search for:
Jump to:  
Powered by phpBB® Forum Software © phpBB Group