Rhiza Labs FluTracker Forum

The place to discuss the flu
It is currently Fri May 24, 2013 7:49 am

All times are UTC - 5 hours [ DST ]




Post new topic Reply to topic  [ 52 posts ]  Go to page Previous  1, 2, 3, 4, 5, 6  Next
Author Message
PostPosted: Wed Dec 14, 2011 3:00 pm 
Online

Joined: Wed Aug 19, 2009 10:42 am
Posts: 27536
Location: Pittsburgh, PA USA
An infant from Minnesota has developed an extremely rare strain of swine flu. It's called the H1N2 virus and is common in pigs in the Upper Midwest, CBS local affiliate WCCO reported. The boy is only the second human ever to contract H1N2.

Why did the infant contract the H1N2 virus? Not because of anything he did - neither he nor his family had direct contact with swine. His case is an unusual mutation of the flu virus.


While Minn. health officials say there's little reason to worry, they also say the boy is living proof of just how difficult it is to pin down the flu virus.

"Typically, influenzas change a little bit," Dr. Aaron DeVries of the Minn. Department of Health told WCCO. "When the virus changes substantially, that is when a pandemic can occur and that is what happened in 2009."

As many as 6,000 people died in the U.S. in 2009 during a seven-month outbreak of the H1N1 swine flu virus. This boy's strain of H1N2 is not as serious, proved by his quick recovery, and does not spread as easily.

"We haven't observed any additional cases," since the child developed symptoms, DeVries told the Star Tribune.

The boy has since recovered from the virus, which was diagnosed in October.

H1N2 is not protected against by the flu shot, which does cover the H1N1 virus.


http://www.cbsnews.com/8301-504763_162- ... nn-infant/

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Wed Dec 14, 2011 3:09 pm 
Online

Joined: Wed Aug 19, 2009 10:42 am
Posts: 27536
Location: Pittsburgh, PA USA
H1N2 Virus: Infant Found Carrying Rare Form of Swine Flu
By Myles Collier | Christian Post Contributor
Text Share RSS Print E-mailAn infant in Minnesota has been found to have been carrying an extremely rare form of the swine flu known as the H1N2 virus.
Related
New Swine Flu Emerges in Iowa, Vaccine Already DevelopedRelated Topics
Health CareDoctors are now monitoring the infant who was diagnosed with the rare virus in October, according to WCCO. It is only the second time that this particular strain of the virus has been documented.

The infant contracted the rare strand of the more prevalent H1N1 virus, which is common in pigs located in the Upper Midwest. Until this year, only one other case had been ever known to occur in humans and that was in 2007 in Michigan.

Tom Skinner, a spokesman for the Centers for Disease Control and Prevention, told Fox News the general public has very little reason to panic or be alarmed.

"Discovery of these novel influenza viruses shows that our surveillance systems are working. And laboratory testing has advanced to where we’re now picking up infections that we’d likely not have picked up in the past."

The CDC estimates that back in 2009 as many as 6,000 people died in the United States during a seven month period from the H1N1 virus.

Like us on Facebook

Scientists eventually were able to develop a vaccine, one that is currently included in this year’s flu shot. But scientists acknowledge if a new deadly strain emerged it would once again likely take a long time for an effective vaccine to be developed.

Dr. Aaron DeVries of the Minnesota Department of Health told WCCO: “Typically influenzas change a little bit. When the virus changes substantially, that is when a pandemic can occur and that is what happened in 2009.”

The current flu shot does not protect patients against the H1N2 virus. But the Minnesota Department of Health says they do not think this strain of H1N2 is a serious threat, because the infant recovered quickly and no one around him got sick which suggests that it does not spread easily.

http://global.christianpost.com/news/h1 ... flu-64826/

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Thu Dec 15, 2011 1:15 pm 
Online

Joined: Wed Aug 19, 2009 10:42 am
Posts: 27536
Location: Pittsburgh, PA USA
Minnesota Boy Contracts Rare Swine Flu Strain

An extremely rare strain of swine flu has been reported in Minnesota infant who is only the second person ever to contract the H1N2 strain.

The boy was diagnosed in October and has since recovered, CBS News reported. There haven't been any other cases, according to health officials.

The flu shot does not protect against H1N2, which is common in pigs in the Upper Midwest, according to CBS local affiliate WCCO.

Neither the boy or his family had direct contact with swine and it appears his case is an unusual mutation of the H1N2 virus.
http://www.doctorslounge.com/index.php/news/hd/25321

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Thu Dec 15, 2011 3:06 pm 
Online

Joined: Wed Aug 19, 2009 10:42 am
Posts: 27536
Location: Pittsburgh, PA USA
MDPH confirms there is only one cofirmed trH1N2 case at this time, and the sample sent to the CDC was an isolate.

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Thu Dec 15, 2011 4:34 pm 
Online

Joined: Wed Aug 19, 2009 10:42 am
Posts: 27536
Location: Pittsburgh, PA USA
niman wrote:
MDPH confirms there is only one cofirmed trH1N2 case at this time, and the sample sent to the CDC was an isolate.

Symptomatic contact not tested.

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Fri Dec 16, 2011 6:05 am 
Online

Joined: Wed Aug 19, 2009 10:42 am
Posts: 27536
Location: Pittsburgh, PA USA
niman wrote:
Minnesota Boy Contracts Rare Swine Flu Strain

There haven't been any other cases, according to health officials.

Neither the boy or his family had direct contact with swine and it appears his case is an unusual mutation of the H1N2 virus.
http://www.doctorslounge.com/index.php/news/hd/25321

There haven't been any CONFIRMED cases. A contact had symptoms, but was not tested because the H1N2 was identified in ROUTINE surveillance. The child (listed as a female by the CDC) developed symptoms on Oct 30. The sample was collected on Nov 4 and received as an ISOLATE (it had been isolated in MDCK cells). Thus, it was identified WELL after the fact. The PCR test on the ISOLATE signaled a triple reassortant, and it was then sent to the CDC who sequenced the ISOLATE. Thus, it was not confirmed until a MONTH after symptoms.

Therefore, the symptomatic CONTACT was NOT tested.

The sequence is the 2010 trH3N2 with PB1 E618D which had acquired an H1N2 H and N. Thus, six genes matched the 2010 HUMAN trH3N2, and two genes were from the same parental swine H1N2 that created H3N2pdm11 (which kept the H3 and our internal genes, but swapped ou PB1, N2, and M gene).

There have been 18 CONFIRMED novel HUMAN cases in 2010 and 2011. ALL have PB1 with H1N1pdm09 E618D on a Huron County fair background, OR H1N1pdm09 M gene (i.e. 18/18 have a H1N1pdm09 component which is NOT common in swine).

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Fri Dec 16, 2011 9:01 am 
Online

Joined: Wed Aug 19, 2009 10:42 am
Posts: 27536
Location: Pittsburgh, PA USA
Cpmmentary

http://www.recombinomics.com/News/12161 ... Delay.html

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Fri Dec 16, 2011 10:19 am 
Online

Joined: Wed Aug 19, 2009 10:42 am
Posts: 27536
Location: Pittsburgh, PA USA
niman wrote:
Baby's flu case was mild, but strange enough to raise flags
Article by: MAURA LERNER , Star Tribune Updated: December 12, 2011 - 5:45 PM

Last week, the CDC reported the Minnesota case, along with a similar one in West Virginia. Both involved children who were infected with unusual strains of swine flu. But because neither child had any known contact with the animals, the CDC speculated that "limited human-to-human transmission may have occurred."

http://www.startribune.com/local/135474708.html

Yes, the CDC speculation that the transmission was "limited" is PURE speculation based on wishful thinking. The CDC has failed to identify a swine source for any of the 18 novel infleunza cases in 2010 and 2011. Instead, two of the three Iowa confirmed cases were epidemiologically linked to a HUMAN (the 3F index case). Moreover, all 18 cases have a link to H1N1pdm09. The six cases in 2010 plus the H1N2 case in 2011 have E618D in PB1, while the 11 trH3N2 cases in 2011 have a H1N1pdm09 M gene.

The cases are identified in the "off season" when flu transmission is limited. Now, as the new cases begin to appear during the flu season, more H2H is noted - the Iowa clustered involved three confirmed and two suspect contacts, Minnesota H1N2 has 1 confirmed case and 1 suspect contact, West Virginia has 1 confirmed and one influenza A contact (under investigation).

Thus, the "limited transmission" is linked to the collection DATE, not the novel infleunza, and is just another media myth.

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Sat Dec 17, 2011 10:44 am 
Online

Joined: Wed Aug 19, 2009 10:42 am
Posts: 27536
Location: Pittsburgh, PA USA
All eight gene segments at Genbank

PB2 2012703003_207222_v1_1 2265 EPI346498 JQ290154

PB1 2012703003_207222_v1_2 2269 EPI346499 JQ290149

PA 2012703003_207222_v1_3 2151 EPI346497 JQ290153

HA 2012703003_207222_v1_4 1731 EPI346501 JQ290156

NP 2012703003_207222_v1_5 1497 EPI346494 JQ290150

NA 2012703003_207222_v1_6 1392 EPI346500 JQ290155

MP 2012703003_207222_v1_7 968 EPI346496 JQ290152

NS 2012703003_207222_v1_8 844 EPI346495 JQ290151

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Sat Dec 17, 2011 10:49 am 
Online

Joined: Wed Aug 19, 2009 10:42 am
Posts: 27536
Location: Pittsburgh, PA USA
niman wrote:
All eight gene segments at Genbank

PB2 2012703003_207222_v1_1 2265 EPI346498 JQ290154

PB1 2012703003_207222_v1_2 2269 EPI346499 JQ290149

PA 2012703003_207222_v1_3 2151 EPI346497 JQ290153

HA 2012703003_207222_v1_4 1731 EPI346501 JQ290156

NP 2012703003_207222_v1_5 1497 EPI346494 JQ290150

NA 2012703003_207222_v1_6 1392 EPI346500 JQ290155

MP 2012703003_207222_v1_7 968 EPI346496 JQ290152

NS 2012703003_207222_v1_8 844 EPI346495 JQ290151

LOCUS JQ290154 2265 bp cRNA linear VRL 16-DEC-2011
DEFINITION Influenza A virus (A/Minnesota/19/2011(H1N2)) segment 1 polymerase
PB2 (PB2) gene, partial cds.
ACCESSION JQ290154
VERSION JQ290154.1 GI:363804994
KEYWORDS .
SOURCE Influenza A virus (A/Minnesota/19/2011(H1N2))
ORGANISM Influenza A virus (A/Minnesota/19/2011(H1N2))
Viruses; ssRNA negative-strand viruses; Orthomyxoviridae;
Influenzavirus A.
REFERENCE 1 (bases 1 to 2265)
AUTHORS Shu,B., Garten,R., Emery,S., Balish,A., Smith,C., Barnes,J.,
Lindstrom,S., Klimov,A. and Cox,N.
TITLE Direct Submission
JOURNAL Submitted (14-DEC-2011) WHO Collaborating Center for Surveillance,
Epidemiology and Control of Influenza, Influenza Division, Centers
for Disease Control and Prevention, 1600 Clifton Road, N.E.,
Atlanta, GA 30333, USA
COMMENT Additional isolate information, e.g. epidemiological and clinical
data is available at http://gisaid.org.

GenBank Accession Numbers JQ290149-JQ290156 represent sequences
from the 8 segments of Influenza A virus
(A/Minnesota/19/2011(H1N2)).

##GISAID_EpiFlu(TM)Data-START##
segment :: 1
strain :: Influenza A virus
(A/Minnesota/19/2011(H1N2))
serotype :: H1N2
collection_date :: 4-Nov-11
Note :: Human case of H1N2 SOIV
Lab_ID :: 2012703003
EPI_ISOLATE_ID :: EPI_ISL_99810
NAME :: A/Minnesota/19/2011
TYPE :: A / H1N2
Segment_name :: PB2
HOST_GENDER :: F
PASSAGE :: M1M2
LOCATION :: North America / United States / Minnesota
COLLECT_DATE :: 11/4/2011
RESIST_TO_ADAMANTANES :: Unknown
RESIST_TO_OSELTAMIVIR :: Unknown
RESIST_TO_ZANAMIVIR :: Unknown
RESIST_TO_PERAMIVIR :: Unknown
IV_SAMPLE_ID :: 2011300231
SEQLAB_SAMPLE_ID :: 2012703003
EPI_SEQUENCE_ID :: EPI346498
ISOLATE_NOTE :: Minnesota Department of Health
##GISAID_EpiFlu(TM)Data-END##
FEATURES Location/Qualifiers
source 1..2265
/organism="Influenza A virus (A/Minnesota/19/2011(H1N2))"
/mol_type="viral cRNA"
/strain="A/Minnesota/19/2011"
/serotype="H1N2"
/host="Homo sapiens"
/db_xref="taxon:1127476"
/segment="1"
/country="USA"
/collection_date="04-Nov-2011"
/note="M1M2 passages(s)"
gene 1..>2265
/gene="PB2"
CDS 1..>2265
/gene="PB2"
/codon_start=1
/product="polymerase PB2"
/protein_id="AEW31132.1"
/db_xref="GI:363804995"
/translation="MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPA
LRMKWMMAMKYPITADRRIMDMIPERNEQGQTLWSRTNDAGSDRVMVSPLAVTWWNRN
GPTTNTVHYPKVYKTYFEKVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQ
DVIMEVVFPNEVGARILTSESQLTITKEKKEELQDCKIAPLMVAYMLERELVRKTRFL
PVAGGTSSVYIEVLHLTQGTCWEQMYTPGGEVRNDDVDQSLIIAARNIVRRAAVSADP
LASLLEMCHSTQIGGIRMMDILRQNPTEEQAVDICKAAMGLRISSSFSFGGFTFKRTS
GSSVKKEEEVLTGNLQTLKIRVHEGYEEFTMVGRRATAILRKATRRLIQLIVSGRDDQ
SIAEAIIVAMVFSQEDCMIKAVRGDLNFVNRANQRLNPMHQLLRHFQKDAKVLFQNWG
IEPIDSVMGMIGILPDMTPSTEMSLRGIRVSKMGVDEYSSTERVVVSIDRFLRVRDQR
GNVLLSPEEVSETQGTEKLTITYSSSMMWEINGPESVMVNTYQWIIRNWESLKIQWSQ
DPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLFQQMRDVLGTFDTVQIIKLLPFAAA
PPEQSRMQFSSLTVNVRGSGLRILVRGNSPVFNYNKATKRLTILGKDAGALTEDPDEG
TAGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGEKANVLIGQGDVVLVMKRKRD
SSILTDSQTATKRIR"
ORIGIN
1 atggagagaa taaaagaact aagagatcta atgtcgcagt cccgcactcg cgagatactc
61 actaagacca ctgtggacca tatggccata atcaaaaagt acacgtcagg aaggcaggag
121 aagaaccccg cactcagaat gaagtggatg atggcaatga aatacccaat tacagcagac
181 aggagaataa tggacatgat tccagagagg aatgaacaag gacaaaccct ctggagcaga
241 acaaacgatg ctggatcgga ccgtgtgatg gtatcacccc tggccgtaac atggtggaat
301 aggaatggcc caacaacaaa cacagttcac taccctaagg tatacaaaac ttatttcgaa
361 aaagtcgaaa ggttaaaaca tggtaccttt ggccctgtcc acttcagaaa tcaagttaaa
421 ataaggagga gggttgacac aaaccctggt catgcagatc tcagtgccaa ggaggcacag
481 gatgtgatca tggaagttgt tttcccaaat gaagtggggg caagaatact gacatcagag
541 tcacagctga caataacaaa agaaaagaaa gaagagctcc aggattgtaa aattgctccc
601 ttgatggtgg catacatgct agaaagagaa ttggttcgta agacgaggtt tcttccggtg
661 gctggtggaa caagcagtgt ttatattgaa gtgctgcact taactcaggg aacatgctgg
721 gagcaaatgt acactccagg aggagaagtg agaaatgatg atgttgacca aagtttgatt
781 atcgccgcta gaaacatagt aagaagagca gcagtgtcag cagacccatt agcatctctc
841 ttggaaatgt gccacagcac acaaattgga ggaataagga tgatggacat ccttagacag
901 aacccaacgg aggaacaagc cgtagacata tgcaaggcag caatggggct gaggattagc
961 tcctctttca gctttggtgg gttcaccttc aaaaggacaa gcggatcatc tgttaagaaa
1021 gaagaagaag tgctcacggg caacctccaa acactgaaaa taagagtaca tgaaggatat
1081 gaggaattca caatggtcgg gagaagagca acagctattc tcagaaaagc aaccaggaga
1141 ttgatccagt taatagtaag tgggagagac gatcaatcaa ttgctgaggc aataattgtg
1201 gccatggtat tttcacaaga ggattgcatg atcaaggcag ttaggggcga tctgaacttt
1261 gtcaataggg caaaccagcg actgaatccc atgcaccaac tcttgaggca tttccaaaag
1321 gatgcaaaag tgcttttcca gaactggggg attgaaccca tcgacagtgt aatgggaatg
1381 atcggaatat tgcctgatat gaccccaagc acggaaatgt cgctgagggg tataagagtc
1441 agcaaaatgg gagtagatga atattccagt acggagagag tggtagtgag cattgaccga
1501 tttttgagag ttcgggatca acgaggaaac gtactattgt cccccgaaga ggtcagcgag
1561 acacagggaa ctgagaaatt gacaataact tattcgtcat caatgatgtg ggagatcaat
1621 ggtcctgagt cagtgatggt caacacttat caatggatta taaggaactg ggaaagcttg
1681 aaaattcaat ggtcacagga tcccacgatg ttatacaaca aaatggaatt tgaaccattc
1741 cagtctcttg tccctaaggc aaccagaagt cgttacagtg gattcgtgag gacactgttc
1801 cagcaaatgc gggatgtgct tggaacattt gatactgtcc aaataataaa acttctcccc
1861 tttgctgctg ctccaccgga acagagtagg atgcagttct cctcgctgac tgtgaatgtg
1921 agaggatcag ggctgaggat actggtaaga ggcaactctc cagtgttcaa ttacaacaaa
1981 gcaaccaaaa gacttacaat ccttggaaaa gatgcaggtg cattgactga agatccagat
2041 gaaggcacag ctggagtgga gtctgctgtc ctgaggggat tcctcatttt gggtaaagaa
2101 gacaagagat atggcccagc attaagcatc aatgaactga gcaatcttgc aaaaggagag
2161 aaggctaatg tgctaattgg gcaaggagac gtggtgttgg taatgaaacg gaaacgggac
2221 tctagcatac ttactgacag ccagacagcg accaaaagga ttcgg

_________________
www.twitter.com/hniman


Top
 Profile  
 
Display posts from previous:  Sort by  
Post new topic Reply to topic  [ 52 posts ]  Go to page Previous  1, 2, 3, 4, 5, 6  Next

All times are UTC - 5 hours [ DST ]


Who is online

Users browsing this forum: MSN [Bot], niman and 87 guests


You cannot post new topics in this forum
You cannot reply to topics in this forum
You cannot edit your posts in this forum
You cannot delete your posts in this forum
You cannot post attachments in this forum

Search for:
Jump to:  
Powered by phpBB® Forum Software © phpBB Group