Rhiza Labs FluTracker Forum

The place to discuss the flu
It is currently Sat May 25, 2013 4:37 pm

All times are UTC - 5 hours [ DST ]




Post new topic Reply to topic  [ 88 posts ]  Go to page Previous  1 ... 5, 6, 7, 8, 9  Next
Author Message
PostPosted: Tue Sep 20, 2011 10:14 pm 
Online

Joined: Wed Aug 19, 2009 10:42 am
Posts: 27558
Location: Pittsburgh, PA USA
Direct sequence from IN/08/11

LOCUS JN655556 1279 bp cRNA linear VRL 08-SEP-2011
DEFINITION Influenza A virus (A/Indiana/08/2011(H3N2)) segment 4 hemagglutinin
(HA) gene, partial cds.
ACCESSION JN655556
VERSION JN655556.1 GI:345722478
KEYWORDS .
SOURCE Influenza A virus (A/Indiana/08/2011(H3N2))
ORGANISM Influenza A virus (A/Indiana/08/2011(H3N2))
Viruses; ssRNA negative-strand viruses; Orthomyxoviridae;
Influenzavirus A.
REFERENCE 1 (bases 1 to 1279)
AUTHORS Shu,B., Garten,R., Emery,S., Balish,A., Smith,C., Barnes,J.,
Lindstrom,S., Klimov,A. and Cox,N.
TITLE Direct Submission
JOURNAL Submitted (08-SEP-2011) WHO Collaborating Center for Surveillance,
Epidemiology and Control of Influenza, Influenza Division, Centers
for Disease Control and Prevention, 1600 Clifton Road, N.E.,
Atlanta, GA 30333, USA
COMMENT GenBank Accession Numbers JN655551-JN655558 represent sequences
from the 8 segments of Influenza A virus (A/Indiana/08/2011(H3N2)).

##GISAID_EpiFlu(TM)Data-START##
Isolate :: A/Indiana/08/2011
Subtype :: H3N2
Segment_name :: HA
Host_gender :: M
Host_age :: 2
Passage_history :: original
Adamantane_resistance :: unknown
Zanamivir_resistance :: unknown
Oseltamivir_resistance :: unknown
Peramivir_resistance :: unknown
Other_resistance :: unknown
Country :: United States
State/Province :: Indiana
Collection_day :: 27
Collection_month :: 07
Collection_year :: 2011
Isolate_note :: comment: Human case of H3N2 SOIV - with
an M gene from 2009 H1N1 Pandemic virus.
; Originating Laboratory: Indiana State
Department of Health Laboratories, 550 W.
16th St., Suite B, 46202-5120,
Indianapolis, United States
EPI_accession :: EPI335629
##GISAID_EpiFlu(TM)Data-END##
FEATURES Location/Qualifiers
source 1..1279
/organism="Influenza A virus (A/Indiana/08/2011(H3N2))"
/mol_type="viral cRNA"
/strain="A/Indiana/08/2011"
/serotype="H3N2"
/host="Homo sapiens; gender M; age 2"
/db_xref="taxon:1081253"
/segment="4"
/country="USA"
/collection_date="27-Jul-2011"
gene <1..>1279
/gene="HA"
CDS <1..>1279
/gene="HA"
/codon_start=2
/product="hemagglutinin"
/protein_id="AEO16263.1"
/db_xref="GI:345722479"
/translation="FAQKLPGSDNSMATLCLGHHAVPNGTLVKTITDDQIEVTNATEL
VQSSSTGGICNSPHQILDGKNCTLIDALLGDPHCDDFQNKEWDLFVERSTAYSNCYPY
YVPDYATLRSLVASSGNLEFTQESFNWTGVAQGGSSYACRRGSVNSFFSRLNWLYNLN
YKYPEQNVTMPNNDKFDKLYIWGVHHPGTDKDQTNLYVQASGRVIVSTKRSQQTVIPN
IGSRPWVRGVSSIISIYWTIVKPGDILLINSTGNLIAPRGYFKIQSGKSSIMRSDAHI
DECNSECITPNGSIPNDKPFQNVNKITYGACPRYVKQNTLKLATGMRNVPEKQTRGIF
GAIAGFIENGWEGMVDGWYGFRHQNSEGTGQAADLKSTQAAINQITGKLNRVIKKTNE
KFHQIEKEFSEVEGRIQDLEKYVEDTKIDLWSYN"
ORIGIN
1 tttcgctcaa aaacttcccg gaagtgacaa cagcatggca acgctgtgcc tgggacacca
61 tgcagtgcca aacggaacat tagtgaaaac aatcacggat gaccaaattg aagtgactaa
121 tgctactgag ctggtccaga gttcctcaac aggtggaata tgcaacagtc ctcaccaaat
181 ccttgatggg aaaaattgca cactgataga tgctctattg ggggaccctc attgtgatga
241 cttccaaaac aaggaatggg acctttttgt tgaacgaagc acagcctaca gcaactgtta
301 cccttattac gtgccggatt atgccaccct tagatcatta gttgcctcat ccggcaacct
361 ggaatttacc caagaaagct tcaattggac tggagttgct caaggcggat caagctatgc
421 ctgcagaagg ggatctgtta acagtttctt tagtagattg aattggttgt ataacttgaa
481 ttacaagtat ccagagcaga acgtaactat gccaaacaat gacaaatttg acaaattgta
541 catttggggg gttcaccacc cgggtacgga caaggaccaa accaacctat atgtccaagc
601 atcagggaga gttatagtct ctaccaaaag aagccaacaa actgtaatcc cgaatatcgg
661 gtctagaccc tgggtaaggg gtgtctccag cataataagc atctattgga cgatagtaaa
721 accgggagac atacttttga ttaacagcac agggaatcta attgcccctc ggggttactt
781 caaaatacaa agtgggaaaa gctcaataat gagatcagat gcacacattg atgaatgcaa
841 ttctgaatgc attactccaa atggaagcat tcccaatgac aaaccttttc aaaatgtaaa
901 caagatcaca tatggagcct gtcccagata tgttaagcaa aacaccctga aattggcaac
961 aggaatgcgg aatgtaccag agaaacaaac tagaggcata ttcggcgcaa ttgcaggttt
1021 catagaaaat ggttgggagg gaatggtaga cggttggtac ggtttcaggc atcagaattc
1081 tgaaggcaca ggacaagcag cagatcttaa aagcactcaa gcagcaatca accaaatcac
1141 cgggaaacta aatagagtaa tcaagaaaac aaacgagaaa ttccatcaaa tcgaaaaaga
1201 attctcagaa gtagaaggaa gaattcagga cctagagaaa tacgttgaag acactaaaat
1261 agatctctgg tcttacaac

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Tue Sep 20, 2011 10:16 pm 
Online

Joined: Wed Aug 19, 2009 10:42 am
Posts: 27558
Location: Pittsburgh, PA USA
Week 36 FluView

As a result of intensive surveillance after the identification of two cases of human infection with a novel influenza A virus, one in Indiana and one in Pennsylvania, reported in August MMWR, two additional human infections with novel influenza A virus were identified in Pennsylvania. Both patients were infected with swine-origin influenza A (H3N2) viruses, with illness onset dates of August 18 and August 21, 2011. One patient was hospitalized, but was discharged home and both patients have fully recovered. All three Pennsylvania patients reported contact with pigs at the same agricultural fair in the week preceding symptom onset and enhanced surveillance for human illness continues. Although these additional cases have been detected, exposure to pigs was reported in both cases and no evidence of ongoing transmission of this virus in the community has been identified.

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Tue Sep 20, 2011 10:19 pm 
Online

Joined: Wed Aug 19, 2009 10:42 am
Posts: 27558
Location: Pittsburgh, PA USA
Unsubtypables (in powder blue) through week 36

Image

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Tue Sep 20, 2011 10:29 pm 
Online

Joined: Wed Aug 19, 2009 10:42 am
Posts: 27558
Location: Pittsburgh, PA USA
niman wrote:
Week 36 FluView

As a result of intensive surveillance after the identification of two cases of human infection with a novel influenza A virus, one in Indiana and one in Pennsylvania, reported in August MMWR, two additional human infections with novel influenza A virus were identified in Pennsylvania. Both patients were infected with swine-origin influenza A (H3N2) viruses, with illness onset dates of August 18 and August 21, 2011. One patient was hospitalized, but was discharged home and both patients have fully recovered. All three Pennsylvania patients reported contact with pigs at the same agricultural fair in the week preceding symptom onset and enhanced surveillance for human illness continues. Although these additional cases have been detected, exposure to pigs was reported in both cases and no evidence of ongoing transmission of this virus in the community has been identified.

Note that the "intensive surveillance" failed to find swine with symptoms, swine with an SIV infection, swine with trH3N2, and swine with trH3N2 matching the three cases in Pennsylvania and one case in Indiana.

Similarly, the Indiana case, with samples collected in week 30 (on July 24 and July 27) has not been linked to swine with symptoms, swine with an SIV infection, swine with trH3N2, or swine with trH3N2 sequences matching the four 2011 cases, which is also true for the patient's caretaker.

Moreover, the matching constellation of flu gene segments in all four human cases(including pandemic H1N1 M gene segment) has not been reported in any swine in the US or worldwide.

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Tue Sep 20, 2011 10:44 pm 
Online

Joined: Wed Aug 19, 2009 10:42 am
Posts: 27558
Location: Pittsburgh, PA USA
Identity between the partial HA generated by direct sequencing of the IN/08/11 clinical sample, and trH3N2 cloned from the sample:

EPI335629 A/Indiana/08/2011 (A/H3N2) segment 4 (HA) 2363.0 0.000000e+00 1279/1279 (100%)
EPI333152 A/Indiana/08/2011 (A/H3N2) segment 4 (HA) 2363.0 0.000000e+00 1279/1279 (100%)
EPI335610 A/Pennsylvania/09/2011 (A/H3N2) segment 4 (HA) 2351.9 0.000000e+00 1277/1279 (99%)
EPI324857 A/swine/North Carolina/A01049436/2011 (A/H3N2) segment 4 (HA) 2324.2 0.000000e+00 1272/1279 (99%)
EPI317003 A/swine/Indiana/A0109091/2010 (A/H3N2) segment 4 (HA) 2324.2 0.000000e+00 1272/1279 (99%)
EPI293965 A/Minnesota/11/2010 (A/H3N2) segment 4 (HA) 2313.1 0.000000e+00 1270/1279 (99%)
EPI312980 A/Pennsylvania/40/2010 (A/H3N2) segment 4 (HA) 2307.6 0.000000e+00 1269/1279 (99%)
EPI291898 A/Wisconsin/12/2010 (A/H3N2) segment 4 (HA) 2307.6 0.000000e+00 1269/1279 (99%)
EPI291893 A/Wisconsin/12/2010 (A/H3N2) segment 4 (HA) 2307.6 0.000000e+00 1269/1279 (99%)
EPI328900 A/Minnesota/11/2010 X-203A (A/H3N2) segment 4 (HA) 2302.0 0.000000e+00 1268/1279 (99%)
EPI328898 A/Minnesota/11/2010 X-203 (A/H3N2) segment 4 (HA) 2296.5 0.000000e+00 1267/1279 (99%)
EPI291838 A/Minnesota/09/2010 (A/H3N2) segment 4 (HA) 2285.4 0.000000e+00 1265/1279 (98%)
EPI222910 A/swine/Minnesota/7931/2007 (A/H3N2) segment 4 (HA) 2152.5 0.000000e+00 1242/1280 (97%)
EPI229372 A/turkey/OH/313053/2004 (A/H3N2) segment 4 (HA) 2130.3 0.000000e+00 1239/1281 (96%)
EPI314335 A/turkey/BC/1529-3/2005 (A/H3N2) segment 4 (HA) 2124.8 0.000000e+00 1238/1281 (96%)
EPI103199 A/swine/Ontario/33853/2005 (A/H3N2) segment 4 (HA) 2124.8 0.000000e+00 1238/1281 (96%)
EPI103181 A/swine/Manitoba/12707/2005 (A/H3N2) segment 4 (HA) 2124.8 0.000000e+00 1237/1280 (96%)
EPI103127 A/Ontario/RV1273/2005 (A/H3N2) segment 4 (HA) 2124.8 0.000000e+00 1238/1281 (96%)
EPI101389 A/turkey/Ohio/313053/04 (A/H3N2) segment 4 (HA) 2124.8 0.000000e+00 1238/1281 (96%)
EPI103145 A/swine/Alberta/14722/2005 (A/H3N2) segment 4 (HA) 2119.2 0.000000e+00 1236/1280 (96%)
EPI289638 A/swine/Minnesota/1300/2007 (A/H3N2) segment 4 (HA) 2108.1 0.000000e+00 1234/1280 (96%)
EPI158876 A/turkey/MN/366767/2005 (A/H3N2) segment 4 (HA) 2108.1 0.000000e+00 1235/1281 (96%)
EPI228922 A/turkey/Illinois/2004 (A/H3N2) segment 4 (HA) 2097.1 0.000000e+00 1234/1282 (96%)
EPI168645 A/turkey/Minnesota/366767/2005 (A/H3N2) segment 4 (HA) 2097.1 0.000000e+00 1234/1282 (96%)
EPI166252 A/swine/Minnesota/SG-00234/2005 (A/H3N2) segment 4 (HA) 2097.1 0.000000e+00 1234/1282 (96%)
EPI103217 A/turkey/Ontario/31232/2005 (A/H3N2) segment 4 (HA) 2097.1 0.000000e+00 1233/1281 (96%)
EPI227574 A/turkey/NC/353568/2005 (A/H3N2) segment 4 (HA) 2086.0 0.000000e+00 1231/1281 (96%)
EPI225758 A/swine/Minnesota/66960/2006 (A/H3N2) segment 4 (HA) 2086.0 0.000000e+00 1231/1281 (96%)
EPI168650 A/turkey/North Carolina/353568/2005 (A/H3N2) segment 4 (HA) 2086.0 0.000000e+00 1231/1281 (96%)
EPI166258 A/swine/Minnesota/SG-00236/2007 (A/H3N2) segment 4 (HA) 2080.4 0.000000e+00 1230/1281 (96%)
EPI166255 A/swine/Minnesota/SG-00235/2007 (A/H3N2) segment 4 (HA) 2080.4 0.000000e+00 1230/1281 (96%)
EPI98712 A/swine/MI/PU243/04 (A/H3N1) segment 4 (HA) 2076.8 0.000000e+00 1228/1280 (95%)
EPI259504 A/swine/Minnesota/03008/2010 (A/H3N2) segment 4 (HA) 2074.9 0.000000e+00 1229/1281 (95%)
EPI225756 A/swine/Minnesota/66853/2006 (A/H3N2) segment 4 (HA) 2074.9 0.000000e+00 1228/1280 (95%)
EPI184448 A/swine/North Carolina/R08-001877-D08-013371/2008 (A/H3N2) segment 4 (HA) 2074.9 0.000000e+00 1229/1281 (95%)
EPI128344 A/Ontario/1252/2007 (A/H3N2) segment 4 (HA) 2074.9 0.000000e+00 1228/1280 (95%)
EPI103163 A/swine/British Columbia/28103/2005 (A/H3N2) segment 4 (HA) 2074.9 0.000000e+00 1229/1281 (95%)
EPI182817 A/swine/Quebec/4001/2005 (A/H3N2) segment 4 (HA) 2073.1 0.000000e+00 1227/1279 (95%)
EPI324844 A/swine/Nebraska/A01049235/2010 (A/H3N2) segment 4 (HA) 2069.4 0.000000e+00 1229/1282 (95%)
EPI314635 A/swine/QC/2108-2/2009 (A/H3N2) segment 4 (HA) 2069.4 0.000000e+00 1227/1280 (95%)
EPI222959 A/swine/Minnesota/578/2007 (A/H3N2) segment 4 (HA) 2069.4 0.000000e+00 1227/1280 (95%)
EPI222756 A/swine/Minnesota/1145/2007 (A/H3N2) segment 4 (HA) 2069.4 0.000000e+00 1229/1282 (95%)
EPI222674 A/swine/Oklahoma/008722/2007 (A/H3N2) segment 4 (HA) 2069.4 0.000000e+00 1228/1281 (95%)
EPI317007 A/swine/Iowa/A0109112/2010 (A/H3N2) segment 4 (HA) 2063.8 0.000000e+00 1228/1282 (95%)
EPI225753 A/swine/Minnesota/65767/2006 (A/H3N2) segment 4 (HA) 2063.8 0.000000e+00 1227/1281 (95%)
EPI324851 A/swine/Iowa/A01049317/2010 (A/H3N2) segment 4 (HA) 2058.3 0.000000e+00 1226/1281 (95%)
EPI318106 A/swine/Iowa/A01049185/2010 (A/H3N2) segment 4 (HA) 2058.3 0.000000e+00 1225/1280 (95%)
EPI318095 A/swine/Iowa/A01049113/2010 (A/H3N2) segment 4 (HA) 2058.3 0.000000e+00 1227/1282 (95%)
EPI314679 A/swine/QC/414/2009 (A/H3N2) segment 4 (HA) 2058.3 0.000000e+00 1228/1283 (95%)
EPI222657 A/swine/Minnesota/5947/2007 (A/H3N2) segment 4 (HA) 2056.4 0.000000e+00 1224/1279 (95%)
EPI222682 A/swine/Oklahoma/011506/2007 (A/H3N2) segment 4 (HA) 2052.7 0.000000e+00 1225/1281 (95%)
EPI182824 A/mink/Nova Scotia/1055488/2007 (A/H3N2) segment 4 (HA) 2052.7 0.000000e+00 1225/1281 (95%)
EPI166278 A/swine/Minnesota/SG-00242/2006 (A/H3N2) segment 4 (HA) 2052.7 0.000000e+00 1224/1280 (95%)
EPI309154 A/swine/Pennsylvania/62170-3/2010 (A/H3N2) segment 4 (HA) 2047.2 0.000000e+00 1223/1280 (95%)
EPI309153 A/swine/Pennsylvania/62170-1/2010 (A/H3N2) segment 4 (HA) 2047.2 0.000000e+00 1223/1280 (95%)
EPI324849 A/swine/Iowa/A01049254/2010 (A/H3N2) segment 4 (HA) 2041.7 0.000000e+00 1222/1280 (95%)
EPI312689 A/swine/Minnesota/239105/2009 (A/H3N2) segment 4 (HA) 2041.7 0.000000e+00 1221/1279 (95%)
EPI222961 A/swine/Minnesota/761/2007 (A/H3N2) segment 4 (HA) 2041.7 0.000000e+00 1224/1282 (95%)
EPI291872 A/Pennsylvania/14/2010 (A/H3N2) segment 4 (HA) 2036.1 0.000000e+00 1221/1280 (95%)
EPI291870 A/Pennsylvania/14/2010 (A/H3N2) segment 4 (HA) 2036.1 0.000000e+00 1221/1280 (95%)
EPI291865 A/Pennsylvania/14/2010 (A/H3N2) segment 4 (HA) 2036.1 0.000000e+00 1221/1280 (95%)
EPI314796 A/swine/Pennsylvania/602170-4/2010 (A/H3N2) segment 4 (HA) 2030.6 0.000000e+00 1220/1280 (95%)
EPI335253 A/swine/Quebec/1267568/2010 (A/H3N2) segment 4 (HA) 2025.0 0.000000e+00 1221/1282 (95%)
EPI230035 A/swine/Wisconsin/R7c/2001 (A/H3N2) segment 4 (HA) 2025.0 0.000000e+00 1222/1283 (95%)
EPI219360 A/swine/Kansas/015252/2009 (A/H3N2) segment 4 (HA) 2023.2 0.000000e+00 1219/1280 (95%)
EPI324852 A/swine/Minnesota/A01049346/2010 (A/H3N2) segment 4 (HA) 2019.5 0.000000e+00 1221/1283 (95%)
EPI316991 A/swine/Iowa/A0109035/2010 (A/H3N2) segment 4 (HA) 2019.5 0.000000e+00 1217/1279 (95%)
EPI316990 A/swine/Iowa/A0109034/2010 (A/H3N2) segment 4 (HA) 2019.5 0.000000e+00 1217/1279 (95%)
EPI314687 A/swine/QC/1840-2/2009 (A/H3N2) segment 4 (HA) 2019.5 0.000000e+00 1219/1281 (95%)
EPI314666 A/swine/QC/1698-2/2009 (A/H3N2) segment 4 (HA) 2019.5 0.000000e+00 1220/1282 (95%)
EPI314665 A/swine/QC/1698-1/2009 (A/H3N2) segment 4 (HA) 2019.5 0.000000e+00 1220/1282 (95%)
EPI314643 A/swine/QC/382/2009 (A/H3N2) segment 4 (HA) 2019.5 0.000000e+00 1219/1281 (95%)
EPI307943 A/swine/Iowa/A01057188/2010 (A/H3N2) segment 4 (HA) 2019.5 0.000000e+00 1219/1281 (95%)
EPI302647 A/swine/Illinois/53612-2/2009 (A/H3N2) segment 4 (HA) 2019.5 0.000000e+00 1219/1281 (95%)
EPI302646 A/swine/Illinois/53612-1/2009 (A/H3N2) segment 4 (HA) 2019.5 0.000000e+00 1219/1281 (95%)
EPI244297 A/Kansas/13/2009 (A/H3N2) segment 4 (HA) 2019.5 0.000000e+00 1219/1281 (95%)
EPI25393 A/turkey/ Minnesota/764-2/03 (A/H3N2) segment 4 (HA) 2017.7 0.000000e+00 1219/1281 (95%)
EPI314795 A/swine/Pennsylvania/602170-2/2010 (A/H3N2) segment 4 (HA) 2014.0 0.000000e+00 1217/1280 (95%)
EPI314668 A/swine/QC/1698-5/2009 (A/H3N2) segment 4 (HA) 2014.0 0.000000e+00 1219/1282 (95%)
EPI314667 A/swine/QC/1698-4/2009 (A/H3N2) segment 4 (HA) 2014.0 0.000000e+00 1219/1282 (95%)
EPI314152 A/swine/Quebec/1259260/2010 (A/H3N2) segment 4 (HA) 2014.0 0.000000e+00 1218/1281 (95%)
EPI25391 A/turkey/North Carolina/12344/03 (A/H3N2) segment 4 (HA) 2012.1 0.000000e+00 1218/1281 (95%)
EPI314161 A/swine/Quebec/1265553/2010 (A/H3N2) segment 4 (HA) 2008.4 0.000000e+00 1218/1282 (95%)
EPI307945 A/swine/Illinois/A01057088/2010 (A/H3N2) segment 4 (HA) 2006.6 0.000000e+00 1218/1282 (95%)
EPI302659 A/swine/Illinois/53612-6/2010 (A/H3N2) segment 4 (HA) 2006.6 0.000000e+00 1217/1281 (95%)
EPI302658 A/swine/Illinois/53612-5/2009 (A/H3N2) segment 4 (HA) 2006.6 0.000000e+00 1217/1281 (95%)
EPI219368 A/swine/Oklahoma/001142/2009 (A/H3N2) segment 4 (HA) 2006.6 0.000000e+00 1216/1280 (95%)
EPI307944 A/swine/Illinois/A01057087/2010 (A/H3N2) segment 4 (HA) 2001.0 0.000000e+00 1217/1282 (94%)
EPI302653 A/swine/Illinois/53612-4/2009 (A/H3N2) segment 4 (HA) 2001.0 0.000000e+00 1216/1281 (94%)
EPI292016 A/swine/Iowa/H03BF5/2003 (A/H3N2) segment 4 (HA) 1999.2 0.000000e+00 1219/1285 (94%)
EPI314515 A/quail/QC/FAV-10/2008 (A/H3N2) segment 4 (HA) 1997.3 0.000000e+00 1214/1280 (94%)
EPI291813 A/Iowa/16/2009 (A/H3N2) segment 4 (HA) 1997.3 0.000000e+00 1216/1282 (94%)
EPI302664 A/swine/Illinois/53612-7/2010 (A/H3N2) segment 4 (HA) 1995.5 0.000000e+00 1216/1282 (94%)
EPI324850 A/swine/Pennsylvania/A01049256/2010 (A/H3N2) segment 4 (HA) 1993.7 0.000000e+00 1215/1282 (94%)
EPI314663 A/swine/QC/1685-1/2009 (A/H3N2) segment 4 (HA) 1991.8 0.000000e+00 1214/1281 (94%)
EPI131612 A/swine/Wisconsin/H03HO7/2003 (A/H3N2) segment 4 (HA) 1991.8 0.000000e+00 1216/1283 (94%)
EPI281211 A/swine/Illinois/03040/2010 (A/H3N2) segment 4 (HA) 1990.0 0.000000e+00 1216/1283 (94%)
EPI318101 A/swine/Iowa/A01049160/2010 (A/H3N2) segment 4 (HA) 1986.3 0.000000e+00 1215/1283 (94%)
EPI314695 A/swine/QC/440-A/2009 (A/H3N2) segment 4 (HA) 1986.3 0.000000e+00 1214/1282 (94%)
EPI314664 A/swine/QC/1685-5/2009 (A/H3N2) segment 4 (HA) 1986.3 0.000000e+00 1213/1281 (94%)

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Tue Sep 20, 2011 11:59 pm 
Online

Joined: Wed Aug 19, 2009 10:42 am
Posts: 27558
Location: Pittsburgh, PA USA
Commentary

http://www.recombinomics.com/News/09211 ... imits.html

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Thu Sep 22, 2011 7:37 am 
Online

Joined: Wed Aug 19, 2009 10:42 am
Posts: 27558
Location: Pittsburgh, PA USA
Tomorrow's notifiable disease will appear at link below soon

http://wonder.cdc.gov/mmwr/mmwr_reps.as ... wr_table=1

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Thu Sep 29, 2011 9:52 am 
Online

Joined: Wed Aug 19, 2009 10:42 am
Posts: 27558
Location: Pittsburgh, PA USA
No additional trH3N2 cases reported in week 38

http://wonder.cdc.gov/mmwr/mmwr_reps.as ... wr_table=1

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Fri Oct 14, 2011 9:21 pm 
Online

Joined: Wed Aug 19, 2009 10:42 am
Posts: 27558
Location: Pittsburgh, PA USA
niman wrote:
No additional trH3N2 cases reported in week 38

http://wonder.cdc.gov/mmwr/mmwr_reps.as ... wr_table=1

Once again teh CDC hides the trH3N2 cases in the sub-typing figure

Image

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Wed Nov 16, 2011 1:50 pm 
Online

Joined: Wed Aug 19, 2009 10:42 am
Posts: 27558
Location: Pittsburgh, PA USA
Detail on first Indiana case (2M):

Case 1 (Indiana)
• A medically fragile male child with multiple co-morbidities became ill with influenza-like
symptoms (fever, cough, congestion, fatigue and diarrhea) on July 23, 2011. The patient has
since returned to baseline health status.
• The child had received influenza vaccine in September 2010, and was not treated with
influenza antiviral medications.
• The child was seen at a local emergency department on July 24, 2011. A nasopharyngeal swab
specimen tested positive for influenza A (H3) and was forwarded to the Indiana State
Department of Health for further testing as part of routine CDC-supported influenza
surveillance.
• Testing at the Indiana State Department of Health identified suspect swine-origin triple
reassortant influenza virus and the specimen was sent to CDC for further characterization.
• This case is the first recognized case of human infection with swine-origin triple reassortant
influenza A (H3N2) virus with the M segment gene from the pandemic 2009 H1N1 virus to
date.
• An International Health Regulation (IHR) report was submitted on August 20, 2011, per the
World Health Organizations reporting requirements in the event of a human infection with a
novel or animal origin influenza virus infection.
• There is no reported contact between the patient and swine in this case. However, a home
health nurse of the child reported frequent swine contact in the weeks prior to his illness
onset.
• The situation in Indiana is suggestive of human to human transmission of this virus. No
additional illness was identified in the caretaker, her family or close contacts, or the pigs she
contacted.

https://linksweb.oph.dhh.louisiana.gov/ ... 0IN_PA.pdf

_________________
www.twitter.com/hniman


Top
 Profile  
 
Display posts from previous:  Sort by  
Post new topic Reply to topic  [ 88 posts ]  Go to page Previous  1 ... 5, 6, 7, 8, 9  Next

All times are UTC - 5 hours [ DST ]


Who is online

Users browsing this forum: No registered users and 26 guests


You cannot post new topics in this forum
You cannot reply to topics in this forum
You cannot edit your posts in this forum
You cannot delete your posts in this forum
You cannot post attachments in this forum

Search for:
Jump to:  
Powered by phpBB® Forum Software © phpBB Group