Rhiza Labs FluTracker Forum

The place to discuss the flu
It is currently Thu May 23, 2013 1:21 am

All times are UTC - 5 hours [ DST ]




Post new topic Reply to topic  [ 13 posts ]  Go to page Previous  1, 2
Author Message
PostPosted: Wed Aug 17, 2011 3:11 pm 
Online

Joined: Wed Aug 19, 2009 10:42 am
Posts: 27403
Location: Pittsburgh, PA USA
niman wrote:
niman wrote:
niman wrote:
The CDC has released a new series of H1N1 sequences from recent cases. Included was A/Mexico/2208/2011, which was from a 36M and collected on March 15, 2011. Those demographics matched A/Mexico/InDRE1945/2011, which had D225N (36M collected in March, 2011). However, since the latest sequence from the CDC has a different number, A/Mexico/2208/2011, may be the index case for the outbreak (when the CDC sequenced an isolate from 29M, A/Mexico/InDRE1946/2011, it was designated A/Mexico/1946/2011 by the CDC).

A/Mexico/2208/2011 was isolated in eggs and it had D225G.

At the protein level, A/Mexico/2208/2011 matches A/Mexico/InDRE1945/2011, except it has K214E and D225G.

A/Mexico/InDRE1945/2011 was from a diect sequence of a nasopharyngeal swab, while A/Mexico/2208/2011 was an egg isolate.

LOCUS CY089387 1777 bp cRNA linear VRL 02-APR-2011
DEFINITION Influenza A virus (A/Mexico/InDRE1945/2011(H1N1)) hemagglutinin
(HA) gene, complete cds.
ACCESSION CY089387
VERSION CY089387.1 GI:327412375
DBLINK Project: 37813
KEYWORDS .
SOURCE Influenza A virus (A/Mexico/InDRE1945/2011(H1N1))
ORGANISM Influenza A virus (A/Mexico/InDRE1945/2011(H1N1))
Viruses; ssRNA negative-strand viruses; Orthomyxoviridae;
Influenzavirus A.
REFERENCE 1 (bases 1 to 1777)
AUTHORS Ramirez-Gonzalez,J.E., Alcantara-Perez,P., Rodriguez-Maldonado,A.,
Wong-Arambula,C., Del-Mazo,J.C., Esau,D., Olivera-Diaz,H.,
Barrera-Badillo,G., Lopez-Martinez,I., Guzman-Bracho,C. and
Alpuche-Aranda,C.
TITLE Detection of D222N substitution in Pandemic Influenza A (H1N1)
Virus in Chihuahua, Mexico
JOURNAL Unpublished
REFERENCE 2 (bases 1 to 1777)
AUTHORS Ramirez-Gonzalez,J.E., Alcantara-Perez,P., Rodriguez-Maldonado,A.,
Wong-Arambula,C., Del-Mazo,J.C., Esau,D., Olivera-Diaz,H.,
Barrera-Badillo,G., Lopez-Martinez,I., Guzman-Bracho,C. and
Alpuche-Aranda,C.
TITLE Direct Submission
JOURNAL Submitted (02-APR-2011) Laboratorio de Genoma de Patogenos,
Instituto de Diagnostico y Referencia Epidemiologicos, Crpio 470
Col. Sto Tomas, Mexico, DF 11340, Mexico
FEATURES Location/Qualifiers
source 1..1777
/organism="Influenza A virus
(A/Mexico/InDRE1945/2011(H1N1))"
/mol_type="viral cRNA"
/strain="A/Mexico/InDRE1945/2011"
/serotype="H1N1"
/isolation_source="Pharyngeal swab"
/host="human; gender M; age 36"
/db_xref="taxon:1003291"
/segment="4"
/country="Mexico: Chihuahua"
/collection_date="Mar-2011"
gene 33..1733
/gene="HA"
CDS 33..1733
/gene="HA"
/function="receptor binding and fusion protein"
/codon_start=1
/product="hemagglutinin"
/protein_id="AEA74031.1"
/db_xref="GI:327412376"
/translation="MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVT
HSVDLLEDKHNGKLCKLRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETSSS
DNGTCYPGDFIDYEELREQLSSVSSFERFEIFPKTSSWPNHDSNKGVTAACPHAGAKS
FYNNLIWLVKKGNSYPKLNKSYINDKGKEVLVLWGIHHPSTSTDQQSLYQNADAYVFV
GTSRYSKKFKPEIAIRPKVRNQEGRMNYYWTLVEPGDKITFEATGNLVVPRYAFAMER
NAGSGIIISDTPIHDCNTTCQTPKGAINTSLPFQNIHPITIGKCPKYVKSTKLRLATG
LRNVPSIQSRGLFGAIAGFIEGGWTGMVDGWYGYHHQNEQGSGYAADLKSTQNAIDEI
TNKVNSVIEKMNTQFTAVGKEFNHLEKRIENLNKKVDDGFLDIWTYNAELLVLLENER
TLDYHDSNVKNLYEKVRSQLKNNAKEIGNGCFEFYHKCDNTCMESVKNGTYDYPKYSE
EAKLNREEIDGVKLESTRIYQILAIYSTVASSLVLVVSLGAISFWMCSNGSLQCRICI
"
sig_peptide 33..83
/gene="HA"
mat_peptide 84..1064
/gene="HA"
/product="HA1"
mat_peptide 1065..1730
/gene="HA"
/product="HA2"
ORIGIN
1 agcaaaagca ggggaaaaca aaagcaacaa aaatgaaggc aatactagta gttctgctat
61 atacatttgc aaccgcaaat gcagacacat tatgtatagg ttatcatgcg aacaattcaa
121 cagacactgt agacacagta ctagaaaaga atgtaacagt aacacattct gttgaccttc
181 tagaagacaa gcataacggg aaactatgca aactaagagg ggtagcccca ttgcatttag
241 gtaaatgtaa cattgctggc tggatcctgg gaaatccaga gtgtgaatca ctctccacag
301 caagctcatg gtcttacatt gtggaaacat ctagttcaga caatggaacg tgttacccag
361 gagatttcat cgattatgag gagctaagag agcaattgag ctcagtgtca tcatttgaaa
421 ggtttgaaat attccccaag acaagttcat ggcccaatca tgactcgaac aaaggtgtaa
481 cggcagcatg tccacatgct ggagcaaaaa gcttctacaa caatttaata tggctagtta
541 aaaaaggaaa ttcataccca aagctcaaca aatcctacat taatgataaa gggaaagaag
601 tcctcgtgct atggggcatt caccatccat ctactagtac tgaccaacaa agtctctatc
661 agaatgcaga tgcatatgtt tttgtgggga catcaagata cagcaagaag tttaagccgg
721 aaatagcaat aagacccaaa gtgaggaatc aagaagggag aatgaactat tactggacac
781 tagtagagcc gggagacaaa ataacattcg aagcaactgg aaatctagtg gtaccgagat
841 atgcattcgc aatggaaaga aatgctggat ctggtattat catttcagat acaccaatcc
901 acgattgcaa tacaacttgt cagacaccca agggggctat aaacaccagc ctcccatttc
961 agaatataca tccgatcaca attggaaagt gtccaaaata tgtaaaaagc acaaaattga
1021 gactggccac aggattgagg aatgtcccgt ctattcaatc tagaggccta tttggggcca
1081 ttgccggttt cattgaaggg gggtggacag gaatggtaga tggatggtac ggttatcacc
1141 atcaaaatga gcaggggtca ggatatgcag ccgacctgaa gagcacacag aatgccattg
1201 acgagattac taacaaagta aattctgtta ttgaaaagat gaatacgcag ttcacagcag
1261 taggcaaaga gttcaaccac ctggaaaaaa gaatagagaa tttaaataaa aaagttgatg
1321 atggtttcct ggacatttgg acttacaatg ccgaactgtt ggttctattg gaaaatgaaa
1381 gaactttgga ctaccacgat tcaaatgtga agaacttata tgaaaaggta agaagccagt
1441 taaaaaacaa tgccaaggaa attggaaacg gctgctttga attttaccac aaatgcgata
1501 acacgtgcat ggaaagtgtc aaaaatggga cttatgacta cccaaaatac tcagaggaag
1561 caaaattaaa cagagaagaa atagatgggg taaagctgga atcaacaagg atttaccaga
1621 ttttggcgat ctattcaact gtcgccagtt cattggtact ggtagtctcc ctgggggcaa
1681 tcagtttctg gatgtgctct aatgggtctc tacagtgtag aatatgtatt taacattagg
1741 atttcagaag catgagaaaa acacccttgt ttctact

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Wed Aug 17, 2011 3:36 pm 
Online

Joined: Wed Aug 19, 2009 10:42 am
Posts: 27403
Location: Pittsburgh, PA USA
niman wrote:
The CDC has released a new series of H1N1 sequences from recent cases. Included was A/Mexico/2208/2011, which was from a 36M and collected on March 15, 2011. Those demographics matched A/Mexico/InDRE1945/2011, which had D225N (36M collected in March, 2011). However, since the latest sequence from the CDC has a different number, A/Mexico/2208/2011, may be the index case for the outbreak (when the CDC sequenced an isolate from 29M, A/Mexico/InDRE1946/2011, it was designated A/Mexico/1946/2011 by the CDC).

A/Mexico/2208/2011 was isolated in eggs and it had D225G.

The March 15 collection date was a week prior to other Chihuahua sequences from Mexico.

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Wed Aug 17, 2011 4:47 pm 
Online

Joined: Wed Aug 19, 2009 10:42 am
Posts: 27403
Location: Pittsburgh, PA USA
Commentary

http://www.recombinomics.com/News/08171 ... Index.html

_________________
www.twitter.com/hniman


Top
 Profile  
 
Display posts from previous:  Sort by  
Post new topic Reply to topic  [ 13 posts ]  Go to page Previous  1, 2

All times are UTC - 5 hours [ DST ]


Who is online

Users browsing this forum: emrj, niman and 25 guests


You cannot post new topics in this forum
You cannot reply to topics in this forum
You cannot edit your posts in this forum
You cannot delete your posts in this forum
You cannot post attachments in this forum

Search for:
Jump to:  
Powered by phpBB® Forum Software © phpBB Group