Rhiza Labs FluTracker Forum

The place to discuss the flu
It is currently Wed May 22, 2013 7:01 pm

All times are UTC - 5 hours [ DST ]




Post new topic Reply to topic  [ 35 posts ]  Go to page Previous  1, 2, 3, 4  Next
Author Message
PostPosted: Sat Aug 06, 2011 11:01 am 
Online

Joined: Wed Aug 19, 2009 10:42 am
Posts: 27399
Location: Pittsburgh, PA USA
niman wrote:
niman wrote:
Parallel H1N1 Pandemics in 2010?
Recombinomics Commentary 03:50
July 7, 2010

An H1N1 influenza A virus, A/swine/Ohio/24366/07, was isolated from pigs in an Ohio county fair. Twenty-six people who came in contact with the infected pigs developed respiratory disease and two of these people were laboratory confirmed as H1N1 by the Centers for Disease Control and Prevention (CDC). The A/swine/Ohio/24366/07 virus we isolated from swine was shown at the CDC to have 100% identical genome sequence to the human virus associated with the county fair.

Many of the interal genes in MN/11/2010 are closely related to those from human isolates from the above Hudson County fair in 2007. This cluster was the largest reported swine flu outbreak since the Fox Dix outbreak in 1976. These internal genes are present in tha vast majority of trH3N2 human isolates. In the US, all reported trH3N2 cases followed the H1N1 pademic in 2009.

PB2 from the Hudson Valley fair is closely related to human trH3n2 cases including MN/11. The PB2 from MN11 is VERY closley related to swine H1N1 PB2 in Minnesota
http://www.ncbi.nlm.nih.gov/nuccore/JF312057

LOCUS JF312057 2280 bp cRNA linear VRL 27-MAR-2011
DEFINITION Influenza A virus (A/swine/Minnesota/A01047613/2010(H1N1)) segment
1 polymerase PB2 (PB2) gene, complete cds.
ACCESSION JF312057
VERSION JF312057.1 GI:326579167
KEYWORDS .
SOURCE Influenza A virus (A/swine/Minnesota/A01047613/2010(H1N1))
ORGANISM Influenza A virus (A/swine/Minnesota/A01047613/2010(H1N1))
Viruses; ssRNA negative-strand viruses; Orthomyxoviridae;
Influenzavirus A.
REFERENCE 1 (bases 1 to 2280)
AUTHORS McGill,J.L. and Gramer,M.
TITLE Direct Submission
JOURNAL Submitted (09-FEB-2011) DVL-BPA, USDA, APHIS, NVSL, 1920 Dayton
Ave., Ames, IA 50010, USA
FEATURES Location/Qualifiers
source 1..2280
/organism="Influenza A virus
(A/swine/Minnesota/A01047613/2010(H1N1))"
/mol_type="viral cRNA"
/strain="A/swine/Minnesota/A01047613/2010"
/serotype="H1N1"
/host="swine"
/db_xref="taxon:983888"
/segment="1"
/country="USA"
/collection_date="10-Dec-2010"
gene 1..2280
/gene="PB2"
CDS 1..2280
/gene="PB2"
/codon_start=1
/product="polymerase PB2"
/protein_id="ADZ96082.1"
/db_xref="GI:326579168"
/translation="MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPA
LRMKWMMAMKYPITADRRIMDMIPERNEQGQTLWSKTNDAGSDRVMVSPLAVTWWNRN
GPTTSTVHYPKVYKTYFEKVERLKHGTFGPVHFRNQVKIRRRVDTNPGHADLSAKEAQ
DVIMEVVFPNEVGARILTSESQLTITKEKKEELQDCKIAPLMVAYMLERELVRKTRFL
PVAGGTSSVYIEVLHLTQGTCWEQMYTPGGEVRNDDVDQSLIIAARNIVRRAAVSADP
LASLLEMCHSTQIGGIRMMDILRQNPTEEQAVDICKAAMGLRISSSFSFGGFTFKRTS
GSSVKKEEEVLTGNLQTLKIKVHEGYEEFTMVGRRATAILRKATRRLIQLIVSGRDDQ
SIAEAIIVAMVFSQEDCMIKAVRGDLNFVNRANQRLNPMHQLLRHFQKDAKVLFQNWG
IEPIDSVMGMIGILPDMTPSTEMSLRGIRVSKMGVDEYSSTERVVVSIDRFLRVRDQR
GNVLLSPEEVSETQGTEKLTITYSSSMMWEINGPESVLVNTYQWIIRNWESLKIQWSQ
DPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLFQQMRDVLGTFDTVQIIKLLPFAAA
PPEQSRMQFSSLTVNVRGSGLRILVRGNSPVFNYNKATKRLTILGKDAGALTEDPDEG
TAGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGEKANVLIGQGDVVLVMKRKRD
SSILTDSQTATKRIRMAIN"
ORIGIN
1 atggagagaa taaaagaact aagagatcta atgtctcagt cccgcactcg cgagatactc
61 actaagacca ctgtggacca tatggccata atcaaaaagt acacatcagg aaggcaggag
121 aagaaccccg cactcagaat gaagtggatg atggcaatga aatacccaat tacagcagac
181 aggagaataa tggacatgat tccagagagg aatgaacaag gacaaaccct ctggagcaaa
241 acaaacgatg ctggatcgga ccgtgtgatg gtatcacccc tggccgtaac atggtggaat
301 aggaatggcc caacaacaag cacagttcac taccctaagg tatacaaaac ttatttcgaa
361 aaagtcgaaa ggttaaaaca tggtaccttt ggccctgtcc acttcagaaa tcaagttaaa
421 ataagaagga gggttgacac aaaccctggt catgcagatc tcagtgccaa ggaggcacag
481 gatgtgatca tggaagttgt tttccctaat gaagtggggg caagaatact gacatcagag
541 tcacagctga caataacaaa agaaaagaaa gaagagctcc aggattgtaa aattgctccc
601 ttgatggtgg catacatgct agaaagagaa ttggttcgta agacgaggtt tcttccggtg
661 gctggtggaa caagcagtgt ttatattgaa gtgctgcact taactcaggg aacatgctgg
721 gaacaaatgt acactccagg aggagaagtg agaaatgatg atgttgacca aagtttgatt
781 atcgccgcta gaaacatagt aagaagagca gcagtgtcag cagacccatt agcatctctc
841 ttggaaatgt gccacagcac acaaattgga ggaataagga tgatggacat ccttagacag
901 aacccaacgg aggaacaagc cgtagacata tgcaaggcag caatggggct gaggattagc
961 tcctctttca gctttggtgg gttcaccttc aaaaggacaa gcggatcatc tgttaagaaa
1021 gaagaagaag tgctcacggg caacctccaa acactgaaaa taaaagtaca tgaaggatat
1081 gaggaattca caatggtcgg gagaagagca acagctattc tcagaaaagc aaccaggaga
1141 ttgatccagt taatagtaag tgggagagac gatcaatcaa ttgctgaggc aataattgtg
1201 gccatggtat tttcacaaga ggattgcatg atcaaggcag ttaggggcga tctgaacttt
1261 gtcaataggg caaaccagcg actgaatccc atgcaccaac tcttgaggca tttccaaaag
1321 gatgcaaaag tgcttttcca gaactgggga attgaaccca tcgacagtgt aatgggaatg
1381 atcggaatat tgcctgatat gaccccaagc acggaaatgt cgctgagagg tataagagtc
1441 agcaaaatgg gagtagatga atattccagc acggagagag tggtagtgag cattgaccga
1501 tttttgagag ttcgggatca acgggggaac gtactattgt cccccgaaga ggtcagcgag
1561 acacagggaa ctgagaaatt gacaataact tattcgtcat caatgatgtg ggagatcaat
1621 ggtcctgagt cagtgctggt caacacttat caatggatca taaggaactg ggaaagcttg
1681 aaaattcaat ggtcacagga tcccacgatg ttatacaaca aaatggaatt tgaaccattc
1741 cagtctcttg tccctaaggc aaccagaagt cgttacagtg gattcgtgag gacactgttc
1801 cagcaaatgc gggatgtgct tggaacattt gatactgtcc aaataataaa acttctcccc
1861 tttgctgctg ctccaccgga acagagtagg atgcagttct cctcgctgac tgtgaatgtg
1921 agaggatcag ggctgaggat actggtaaga ggcaactctc cagtgttcaa ttacaacaaa
1981 gcaaccaaaa ggcttacaat tcttggaaaa gatgcaggtg cattgactga agatccagat
2041 gaaggcacag ctggagtgga gtctgctgtc ctgaggggat tcctcatttt gggtaaagaa
2101 gacaagagat atggcccagc attaagcatc aatgaactga gcaatcttgc aaaaggagag
2161 aaggctaatg tgctaattgg gcaaggagac gtggtgttgg taatgaaacg gaaacgggac
2221 tctagcatac ttactgacag ccagacagcg accaaaagga ttcggatggc catcaattag

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Sat Aug 06, 2011 11:08 am 
Online

Joined: Wed Aug 19, 2009 10:42 am
Posts: 27399
Location: Pittsburgh, PA USA
Top 100 PB2 matches for swine isolates from Minnesota H1N1 swine (at GISAID). A/Ohio/01/2007 and A/Ohio/02/2007 are from a Hudson County fair presentor and her father. Human cases highlighted

EPI314788 A/swine/Minnesota/A01047613/2010 (A/H1N1) segment 1 (PB2) 4211.5 0.000000e+00 2280/2280 (100%)
EPI312977 A/Pennsylvania/40/2010 (A/H3N2) segment 1 (PB2) 4176.4 0.000000e+00 2265/2267 (99%)
EPI293962 A/Minnesota/11/2010 (A/H3N2) segment 1 (PB2) 4176.4 0.000000e+00 2266/2269 (99%)
EPI291896 A/Wisconsin/12/2010 (A/H3N2) segment 1 (PB2) 4169.0 0.000000e+00 2261/2263 (99%)
EPI302677 A/swine/Pennsylvania/62170-3/2010 (A/H3N2) segment 1 (PB2) 4156.1 0.000000e+00 2270/2280 (99%)
EPI302688 A/swine/Pennsylvania/62170-4/2010 (A/H3N2) segment 1 (PB2) 4150.5 0.000000e+00 2269/2280 (99%)
EPI302676 A/swine/Pennsylvania/62170-2/2010 (A/H3N2) segment 1 (PB2) 4150.5 0.000000e+00 2269/2280 (99%)
EPI302665 A/swine/Pennsylvania/62170-1/2010 (A/H3N2) segment 1 (PB2) 4150.5 0.000000e+00 2269/2280 (99%)
EPI291841 A/Minnesota/09/2010 (A/H3N2) segment 1 (PB2) 4146.8 0.000000e+00 2257/2263 (99%)
EPI291868 A/Pennsylvania/14/2010 (A/H3N2) segment 1 (PB2) 4113.6 0.000000e+00 2247/2257 (99%)
EPI173657 A/swine/OH/511445/2007 (A/H1N1) segment 1 (PB2) 4095.1 0.000000e+00 2259/2280 (99%)
EPI291908 A/Ohio/02/2007 (A/H1N1) segment 1 (PB2) 4084.1 0.000000e+00 2251/2271 (99%)
EPI291860 A/Ohio/01/2007 (A/H1N1) segment 1 (PB2) 4084.1 0.000000e+00 2251/2271 (99%)
EPI291791 A/Illinois/09/2007 (A/H1N1) segment 1 (PB2) 4084.1 0.000000e+00 2253/2274 (99%)
EPI222635 A/swine/Kansas/77778/2007 (A/H1N1) segment 1 (PB2) 4084.1 0.000000e+00 2257/2280 (98%)
EPI153511 A/swine/Ohio/24366/07 (A/H1N1) segment 1 (PB2) 4069.3 0.000000e+00 2245/2266 (99%)
EPI291825 A/Michigan/09/2007 (A/H1N2) segment 1 (PB2) 4065.6 0.000000e+00 2250/2275 (98%)
EPI281307 A/swine/Ohio/02026/2008 (A/H1N1) segment 1 (PB2) 4056.4 0.000000e+00 2250/2277 (98%)
EPI166281 A/swine/Illinois/SG-00244/2007 (A/H1N1) segment 1 (PB2) 4054.5 0.000000e+00 2233/2252 (99%)
EPI323265 A/swine/Minnesota/66853/2006 (A/H3N2) segment 1 (PB2) 4045.3 0.000000e+00 2250/2280 (98%)
EPI307926 A/swine/Pennsylvania/057108-1/2010 (A/H3N2) segment 1 (PB2) 4045.3 0.000000e+00 2250/2280 (98%)
EPI323254 A/swine/Minnesota/1300/2007 (A/H3N2) segment 1 (PB2) 4043.4 0.000000e+00 2249/2279 (98%)
EPI185085 A/swine/Minnesota/SG-00239/2007 (A/H1N2) segment 1 (PB2) 4034.2 0.000000e+00 2248/2280 (98%)
EPI323263 A/swine/Minnesota/578/2007 (A/H3N2) segment 1 (PB2) 4026.8 0.000000e+00 2246/2279 (98%)
EPI295332 A/swine/South Dakota/152B/2009 (A/H1N2) segment 1 (PB2) 4023.1 0.000000e+00 2246/2280 (98%)
EPI281304 A/swine/Minnesota/02011/2008 (A/H1N2) segment 1 (PB2) 4012.0 0.000000e+00 2242/2277 (98%)
EPI184445 A/swine/North Carolina/R08-001877-D08-013371/2008 (A/H3N2) segment 1 (PB2) 4006.5 0.000000e+00 2243/2280 (98%)
EPI188111 A/swine/Illinois/Sg-00443/2008 (A/H1N1) segment 1 (PB2) 3995.4 0.000000e+00 2241/2280 (98%)
EPI229379 A/turkey/OH/313053/2004 (A/H3N2) segment 1 (PB2) 3989.9 0.000000e+00 2240/2280 (98%)
EPI188115 A/swine/Illinois/Sg-00444/2008 (A/H1N1) segment 1 (PB2) 3989.9 0.000000e+00 2240/2280 (98%)
EPI101403 A/turkey/Ohio/313053/04 (A/H3N2) segment 1 (PB2) 3989.9 0.000000e+00 2240/2280 (98%)
EPI188119 A/swine/Illinois/Sg-00445/2008 (A/H1N1) segment 1 (PB2) 3984.3 0.000000e+00 2238/2280 (98%)
EPI227581 A/turkey/NC/353568/2005 (A/H3N2) segment 1 (PB2) 3973.3 0.000000e+00 2237/2280 (98%)
EPI281303 A/swine/Missouri/02060/2008 (A/H1N1) segment 1 (PB2) 3956.6 0.000000e+00 2234/2279 (98%)
EPI158873 A/turkey/MN/366767/2005 (A/H3N2) segment 1 (PB2) 3956.6 0.000000e+00 2235/2281 (97%)
EPI103201 A/turkey/Ontario/31232/2005 (A/H3N2) segment 1 (PB2) 3956.6 0.000000e+00 2234/2280 (97%)
EPI103183 A/swine/Ontario/33853/2005 (A/H3N2) segment 1 (PB2) 3956.6 0.000000e+00 2234/2280 (97%)
EPI103147 A/swine/British Columbia/28103/2005 (A/H3N2) segment 1 (PB2) 3956.6 0.000000e+00 2234/2280 (97%)
EPI103111 A/Ontario/RV1273/2005 (A/H3N2) segment 1 (PB2) 3956.6 0.000000e+00 2234/2280 (97%)
EPI98706 A/swine/MI/PU243/04 (A/H3N1) segment 1 (PB2) 3951.1 0.000000e+00 2233/2280 (97%)
EPI244298 A/Kansas/13/2009 (A/H3N2) segment 1 (PB2) 3949.3 0.000000e+00 2222/2264 (98%)
EPI228919 A/turkey/Illinois/2004 (A/H3N2) segment 1 (PB2) 3945.6 0.000000e+00 2232/2280 (97%)
EPI182823 A/swine/Quebec/4001/2005 (A/H3N2) segment 1 (PB2) 3940.0 0.000000e+00 2231/2280 (97%)
EPI166279 A/swine/Minnesota/SG-00243/2006 (A/H3N2) segment 1 (PB2) 3936.3 0.000000e+00 2193/2224 (98%)
EPI103165 A/swine/Manitoba/12707/2005 (A/H3N2) segment 1 (PB2) 3928.9 0.000000e+00 2230/2281 (97%)
EPI312702 A/swine/North Carolina/239108/2010 (A/H1N2) segment 1 (PB2) 3912.3 0.000000e+00 2226/2280 (97%)
EPI222649 A/swine/Minnesota/1145/2007 (A/H3N2) segment 1 (PB2) 3910.5 0.000000e+00 2225/2279 (97%)
EPI312654 A/swine/North Carolina/226124/2010 (A/H1N2) segment 1 (PB2) 3901.2 0.000000e+00 2224/2280 (97%)
EPI291853 A/Missouri/04/2006 (A/H1N1) segment 1 (PB2) 3901.2 0.000000e+00 2225/2281 (97%)
EPI291794 A/Iowa/01/2006 (A/H1N1) segment 1 (PB2) 3901.2 0.000000e+00 2224/2280 (97%)
EPI220864 A/swine/Oklahoma/020734-3/2008 (A/H1N2) segment 1 (PB2) 3901.2 0.000000e+00 2224/2280 (97%)
EPI179351 A/swine/IL/07003243/2007 (A/H1N2) segment 1 (PB2) 3901.2 0.000000e+00 2224/2280 (97%)
EPI166250 A/swine/Minnesota/SG-00234/2005 (A/H3N2) segment 1 (PB2) 3897.6 0.000000e+00 2204/2251 (97%)
EPI312670 A/swine/North Carolina/226126/2010 (A/H1N2) segment 1 (PB2) 3895.7 0.000000e+00 2223/2280 (97%)
EPI312662 A/swine/North Carolina/226125/2010 (A/H1N2) segment 1 (PB2) 3895.7 0.000000e+00 2223/2280 (97%)
EPI281298 A/swine/Texas/01976/2008 (A/H1N2) segment 1 (PB2) 3895.7 0.000000e+00 2221/2277 (97%)
EPI222679 A/swine/Oklahoma/011506/2007 (A/H3N2) segment 1 (PB2) 3895.7 0.000000e+00 2223/2280 (97%)
EPI220913 A/swine/Texas/008648/2008 (A/H1N2) segment 1 (PB2) 3895.7 0.000000e+00 2223/2280 (97%)
EPI220832 A/swine/Oklahoma/011521-5/2008 (A/H1N2) segment 1 (PB2) 3895.7 0.000000e+00 2223/2280 (97%)
EPI220824 A/swine/Oklahoma/011521-4/2008 (A/H1N2) segment 1 (PB2) 3895.7 0.000000e+00 2223/2280 (97%)
EPI220816 A/swine/Oklahoma/011289-9/2008 (A/H1N2) segment 1 (PB2) 3895.7 0.000000e+00 2223/2280 (97%)
EPI220784 A/swine/Oklahoma/010710-8/2008 (A/H1N2) segment 1 (PB2) 3895.7 0.000000e+00 2223/2280 (97%)
EPI220848 A/swine/Oklahoma/016179-9/2008 (A/H1N2) segment 1 (PB2) 3890.2 0.000000e+00 2222/2280 (97%)
EPI220840 A/swine/Oklahoma/016179-8/2008 (A/H1N2) segment 1 (PB2) 3890.2 0.000000e+00 2222/2280 (97%)
EPI220808 A/swine/Oklahoma/011289-8/2008 (A/H1N2) segment 1 (PB2) 3890.2 0.000000e+00 2222/2280 (97%)
EPI220800 A/swine/Oklahoma/011289-10/2008 (A/H1N2) segment 1 (PB2) 3890.2 0.000000e+00 2222/2280 (97%)
EPI220792 A/swine/Oklahoma/010710-9/2008 (A/H1N2) segment 1 (PB2) 3890.2 0.000000e+00 2222/2280 (97%)
EPI324032 A/swine/QC/1695-3/2009 (A/H1N1) segment 1 (PB2) 3884.6 0.000000e+00 2221/2280 (97%)
EPI220880 A/swine/Oklahoma/020736-2/2008 (A/H1N2) segment 1 (PB2) 3884.6 0.000000e+00 2221/2280 (97%)
EPI220872 A/swine/Oklahoma/020736-1/2008 (A/H1N2) segment 1 (PB2) 3884.6 0.000000e+00 2221/2280 (97%)
EPI220768 A/swine/Oklahoma/010226-16/2008 (A/H1N2) segment 1 (PB2) 3884.6 0.000000e+00 2221/2280 (97%)
EPI182830 A/mink/Nova Scotia/1055488/2007 (A/H3N2) segment 1 (PB2) 3884.6 0.000000e+00 2221/2280 (97%)
EPI103129 A/swine/Alberta/14722/2005 (A/H3N2) segment 1 (PB2) 3884.6 0.000000e+00 2223/2282 (97%)
EPI323283 A/swine/Minnesota/7931/2007 (A/H3N2) segment 1 (PB2) 3882.8 0.000000e+00 2220/2279 (97%)
EPI281308 A/swine/Iowa/02039/2008 (A/H1N2) segment 1 (PB2) 3879.1 0.000000e+00 2218/2277 (97%)
EPI222671 A/swine/Oklahoma/008722/2007 (A/H3N2) segment 1 (PB2) 3879.1 0.000000e+00 2220/2280 (97%)
EPI220888 A/swine/Oklahoma/032726/2008 (A/H1N2) segment 1 (PB2) 3879.1 0.000000e+00 2220/2280 (97%)
EPI220856 A/swine/Oklahoma/020734-2/2008 (A/H1N2) segment 1 (PB2) 3879.1 0.000000e+00 2220/2280 (97%)
EPI166253 A/swine/Minnesota/SG-00235/2007 (A/H3N2) segment 1 (PB2) 3879.1 0.000000e+00 2202/2253 (97%)
EPI324015 A/swine/QC/1531-3/2009 (A/H1N1) segment 1 (PB2) 3873.5 0.000000e+00 2219/2280 (97%)
EPI220904 A/swine/Oklahoma/053259/2008 (A/H1N2) segment 1 (PB2) 3873.5 0.000000e+00 2219/2280 (97%)
EPI220776 A/swine/Oklahoma/010226-17/2008 (A/H1N2) segment 1 (PB2) 3873.5 0.000000e+00 2219/2280 (97%)
EPI153513 A/swine/Ohio/C62006/06 (A/H1N1) segment 1 (PB2) 3871.7 0.000000e+00 2205/2259 (97%)
EPI220896 A/swine/Oklahoma/042169/2008 (A/H1N2) segment 1 (PB2) 3868.0 0.000000e+00 2218/2280 (97%)
EPI323205 A/swine/Minnesota/65767/2006 (A/H3N2) segment 1 (PB2) 3866.2 0.000000e+00 2217/2279 (97%)
EPI291833 A/Minnesota/03/2008 (A/H1N1) segment 1 (PB2) 3866.2 0.000000e+00 2216/2277 (97%)
EPI281299 A/swine/Iowa/02096/2008 (A/H1N1) segment 1 (PB2) 3862.5 0.000000e+00 2215/2277 (97%)
EPI128360 A/Ontario/1252/2007 (A/H3N2) segment 1 (PB2) 3862.5 0.000000e+00 2217/2280 (97%)
EPI220921 A/swine/Texas/050593/2008 (A/H1N2) segment 1 (PB2) 3856.9 0.000000e+00 2216/2280 (97%)
EPI323975 A/swine/QC/398/2009 (A/H1N1) segment 1 (PB2) 3855.1 0.000000e+00 2215/2279 (97%)
EPI281302 A/swine/North Carolina/02023/2008 (A/H1N1) segment 1 (PB2) 3851.4 0.000000e+00 2213/2277 (97%)
EPI281301 A/swine/North Carolina/02084/2008 (A/H1N1) segment 1 (PB2) 3851.4 0.000000e+00 2213/2277 (97%)
EPI220929 A/swine/Texas/050625/2008 (A/H1N2) segment 1 (PB2) 3851.4 0.000000e+00 2215/2280 (97%)
EPI166272 A/swine/Minnesota/SG-00241/2007 (A/H1N1) segment 1 (PB2) 3851.4 0.000000e+00 2197/2253 (97%)
EPI314646 A/swine/QC/382/2009 (A/H3N2) segment 1 (PB2) 3845.8 0.000000e+00 2215/2281 (97%)
EPI166275 A/swine/Minnesota/SG-00242/2006 (A/H3N2) segment 1 (PB2) 3845.8 0.000000e+00 2196/2253 (97%)
EPI98722 A/swine/IN/PU542/04 (A/H3N1) segment 1 (PB2) 3845.8 0.000000e+00 2215/2281 (97%)
EPI166269 A/swine/Minnesota/SG-00240/2007 (A/H1N1) segment 1 (PB2) 3840.3 0.000000e+00 2195/2253 (97%)
EPI219365 A/swine/Oklahoma/001142/2009 (A/H3N2) segment 1 (PB2) 3834.8 0.000000e+00 2212/2280 (97%)
EPI219357 A/swine/Kansas/015252/2009 (A/H3N2) segment 1 (PB2) 3834.8 0.000000e+00 2212/2280 (97%)

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Sat Aug 06, 2011 11:16 am 
Online

Joined: Wed Aug 19, 2009 10:42 am
Posts: 27399
Location: Pittsburgh, PA USA
Similar results are seen in NS gene. Top 100 matches for Minnesota swine, including identity with PA/40/2010, MN/11/2010 (vaccine target), and WI/12/2010:

EPI314794 A/swine/Minnesota/A01047613/2010 (A/H1N1) segment 8 (NS) 1548.6 0.000000e+00 838/838 (100%)
EPI312978 A/Pennsylvania/40/2010 (A/H3N2) segment 8 (NS) 1548.6 0.000000e+00 838/838 (100%)
EPI293969 A/Minnesota/11/2010 (A/H3N2) segment 8 (NS) 1548.6 0.000000e+00 838/838 (100%)
EPI291889 A/Wisconsin/12/2010 (A/H3N2) segment 8 (NS) 1548.6 0.000000e+00 838/838 (100%)
EPI302684 A/swine/Pennsylvania/62170-4/2010 (A/H3N2) segment 8 (NS) 1543.1 0.000000e+00 837/838 (99%)
EPI302681 A/swine/Pennsylvania/62170-3/2010 (A/H3N2) segment 8 (NS) 1543.1 0.000000e+00 837/838 (99%)
EPI302669 A/swine/Pennsylvania/62170-1/2010 (A/H3N2) segment 8 (NS) 1543.1 0.000000e+00 837/838 (99%)
EPI291861 A/Pennsylvania/14/2010 (A/H3N2) segment 8 (NS) 1543.1 0.000000e+00 837/838 (99%)
EPI291834 A/Minnesota/09/2010 (A/H3N2) segment 8 (NS) 1543.1 0.000000e+00 837/838 (99%)
EPI244304 A/Kansas/13/2009 (A/H3N2) segment 8 (NS) 1543.1 0.000000e+00 837/838 (99%)
EPI291819 A/Michigan/09/2007 (A/H1N2) segment 8 (NS) 1537.5 0.000000e+00 836/838 (99%)
EPI302672 A/swine/Pennsylvania/62170-2/2010 (A/H3N2) segment 8 (NS) 1532.0 0.000000e+00 836/839 (99%)
EPI323271 A/swine/Minnesota/66960/2006 (A/H3N2) segment 8 (NS) 1498.8 0.000000e+00 829/838 (98%)
EPI291903 A/Ohio/02/2007 (A/H1N1) segment 8 (NS) 1482.1 0.000000e+00 826/838 (98%)
EPI291854 A/Ohio/01/2007 (A/H1N1) segment 8 (NS) 1482.1 0.000000e+00 826/838 (98%)
EPI173662 A/swine/OH/511445/2007 (A/H1N1) segment 8 (NS) 1482.1 0.000000e+00 826/838 (98%)
EPI291784 A/Illinois/09/2007 (A/H1N1) segment 8 (NS) 1476.6 0.000000e+00 825/838 (98%)
EPI281223 A/swine/Ohio/02026/2008 (A/H1N1) segment 8 (NS) 1476.6 0.000000e+00 825/838 (98%)
EPI324022 A/swine/QC/1531-3/2009 (A/H1N1) segment 8 (NS) 1471.1 0.000000e+00 824/838 (98%)
EPI229376 A/turkey/OH/313053/2004 (A/H3N2) segment 8 (NS) 1471.1 0.000000e+00 824/838 (98%)
EPI15030 A/SW/IN/14810-S/01 (A/H1N2) segment 8 (NS) 1471.1 0.000000e+00 824/838 (98%)
EPI15028 A/SW/IN/14810-T/01 (A/H1N2) segment 8 (NS) 1471.1 0.000000e+00 824/838 (98%)
EPI307933 A/swine/Pennsylvania/057108-1/2010 (A/H3N2) segment 8 (NS) 1465.5 0.000000e+00 824/839 (98%)
EPI291960 A/swine/Iowa/H03BF5/2003 (A/H3N2) segment 8 (NS) 1465.5 0.000000e+00 823/838 (98%)
EPI291950 A/swine/Iowa/H03UWF2/2003 (A/H1N1) segment 8 (NS) 1465.5 0.000000e+00 823/838 (98%)
EPI291952 A/swine/Iowa/H03LS4/2003 (A/H1N1) segment 8 (NS) 1460.0 0.000000e+00 822/838 (98%)
EPI222648 A/swine/Minnesota/07002083/2007 (A/H1N1) segment 8 (NS) 1460.0 0.000000e+00 823/839 (98%)
EPI222639 A/swine/Kansas/77778/2007 (A/H1N1) segment 8 (NS) 1460.0 0.000000e+00 821/836 (98%)
EPI182820 A/swine/Quebec/4001/2005 (A/H3N2) segment 8 (NS) 1460.0 0.000000e+00 822/838 (98%)
EPI164075 A/swine/Korea/CAS09/2006 (A/H3N2) segment 8 (NS) 1460.0 0.000000e+00 822/838 (98%)
EPI103189 A/swine/Ontario/33853/2005 (A/H3N2) segment 8 (NS) 1460.0 0.000000e+00 822/838 (98%)
EPI103171 A/swine/Manitoba/12707/2005 (A/H3N2) segment 8 (NS) 1460.0 0.000000e+00 822/838 (98%)
EPI103117 A/Ontario/RV1273/2005 (A/H3N2) segment 8 (NS) 1460.0 0.000000e+00 822/838 (98%)
EPI101397 A/turkey/Ohio/313053/04 (A/H3N2) segment 8 (NS) 1460.0 0.000000e+00 822/838 (98%)
EPI291963 A/swine/Iowa/H02NJ56371/2002 (A/H1N1) segment 8 (NS) 1454.4 0.000000e+00 821/838 (97%)
EPI281224 A/swine/Iowa/02039/2008 (A/H1N2) segment 8 (NS) 1454.4 0.000000e+00 821/838 (97%)
EPI235275 A/swine/North Carolina/2003 (A/H3N2) segment 8 (NS) 1454.4 0.000000e+00 821/838 (97%)
EPI228926 A/turkey/Illinois/2004 (A/H3N2) segment 8 (NS) 1454.4 0.000000e+00 821/838 (97%)
EPI227578 A/turkey/NC/353568/2005 (A/H3N2) segment 8 (NS) 1454.4 0.000000e+00 821/838 (97%)
EPI227561 A/swine/Oklahoma/D05-52884/2005 (A/H1N2) segment 8 (NS) 1454.4 0.000000e+00 821/838 (97%)
EPI164074 A/swine/Korea/CAS07/2005 (A/H3N2) segment 8 (NS) 1454.4 0.000000e+00 821/838 (97%)
EPI164073 A/swine/Korea/CAN04/2005 (A/H3N2) segment 8 (NS) 1454.4 0.000000e+00 821/838 (97%)
EPI164062 A/swine/Korea/CAS08/2005 (A/H1N1) segment 8 (NS) 1454.4 0.000000e+00 821/838 (97%)
EPI103207 A/turkey/Ontario/31232/2005 (A/H3N2) segment 8 (NS) 1454.4 0.000000e+00 821/838 (97%)
EPI103153 A/swine/British Columbia/28103/2005 (A/H3N2) segment 8 (NS) 1454.4 0.000000e+00 821/838 (97%)
EPI103135 A/swine/Alberta/14722/2005 (A/H3N2) segment 8 (NS) 1454.4 0.000000e+00 821/838 (97%)
EPI98720 A/swine/MI/PU243/04 (A/H3N1) segment 8 (NS) 1454.4 0.000000e+00 821/838 (97%)
EPI25405 A/turkey/North Carolina/12344/03 (A/H3N2) segment 8 (NS) 1454.4 0.000000e+00 821/838 (97%)
EPI9401 A/Swine/Ohio/891/01 (A/H1N2) segment 8 (NS) 1454.4 0.000000e+00 821/838 (97%)
EPI323204 A/swine/Minnesota/65767/2006 (A/H3N2) segment 8 (NS) 1448.9 0.000000e+00 820/838 (97%)
EPI314331 A/turkey/BC/1529-3/2005 (A/H3N2) segment 8 (NS) 1448.9 0.000000e+00 820/838 (97%)
EPI168654 A/turkey/North Carolina/353568/2005 (A/H3N2) segment 8 (NS) 1448.9 0.000000e+00 820/838 (97%)
EPI164061 A/swine/Korea/CAN01/2004 (A/H1N1) segment 8 (NS) 1448.9 0.000000e+00 820/838 (97%)
EPI98736 A/swine/IN/PU542/04 (A/H3N1) segment 8 (NS) 1448.9 0.000000e+00 820/838 (97%)
EPI15276 A/Swine/Korea/CY02/02 (A/H1N2) segment 8 (NS) 1448.9 0.000000e+00 820/838 (97%)
EPI255765 A/swine/MN/48683/2002 (A/H1N1) segment 8 (NS) 1447.0 0.000000e+00 819/837 (97%)
EPI327283 A/swine/Texas/4199-2/1998 (A/H3N2) segment 8 (NS) 1443.4 0.000000e+00 819/838 (97%)
EPI324168 A/SW/MB/5-5/2009 (A/H1N1) segment 8 (NS) 1443.4 0.000000e+00 819/838 (97%)
EPI291962 A/swine/Iowa/H02NJ56391/2002 (A/H1N1) segment 8 (NS) 1443.4 0.000000e+00 819/838 (97%)
EPI291958 A/swine/Iowa/H03G1/2003 (A/H1N1) segment 8 (NS) 1443.4 0.000000e+00 820/839 (97%)
EPI291956 A/swine/Iowa/H03HO7/2003 (A/H3N2) segment 8 (NS) 1443.4 0.000000e+00 820/839 (97%)
EPI281221 A/swine/Minnesota/02093/2008 (A/H1N1) segment 8 (NS) 1443.4 0.000000e+00 819/838 (97%)
EPI222678 A/swine/Oklahoma/008722/2007 (A/H3N2) segment 8 (NS) 1443.4 0.000000e+00 819/838 (97%)
EPI222655 A/swine/Minnesota/1145/2007 (A/H3N2) segment 8 (NS) 1443.4 0.000000e+00 819/838 (97%)
EPI220928 A/swine/Texas/050593/2008 (A/H1N2) segment 8 (NS) 1443.4 0.000000e+00 819/838 (97%)
EPI220895 A/swine/Oklahoma/032726/2008 (A/H1N2) segment 8 (NS) 1443.4 0.000000e+00 819/838 (97%)
EPI220871 A/swine/Oklahoma/020734-3/2008 (A/H1N2) segment 8 (NS) 1443.4 0.000000e+00 819/838 (97%)
EPI220855 A/swine/Oklahoma/016179-9/2008 (A/H1N2) segment 8 (NS) 1443.4 0.000000e+00 819/838 (97%)
EPI220839 A/swine/Oklahoma/011521-5/2008 (A/H1N2) segment 8 (NS) 1443.4 0.000000e+00 819/838 (97%)
EPI220831 A/swine/Oklahoma/011521-4/2008 (A/H1N2) segment 8 (NS) 1443.4 0.000000e+00 819/838 (97%)
EPI220823 A/swine/Oklahoma/011289-9/2008 (A/H1N2) segment 8 (NS) 1443.4 0.000000e+00 819/838 (97%)
EPI220815 A/swine/Oklahoma/011289-8/2008 (A/H1N2) segment 8 (NS) 1443.4 0.000000e+00 819/838 (97%)
EPI220807 A/swine/Oklahoma/011289-10/2008 (A/H1N2) segment 8 (NS) 1443.4 0.000000e+00 819/838 (97%)
EPI220791 A/swine/Oklahoma/010710-8/2008 (A/H1N2) segment 8 (NS) 1443.4 0.000000e+00 819/838 (97%)
EPI220775 A/swine/Oklahoma/010226-16/2008 (A/H1N2) segment 8 (NS) 1443.4 0.000000e+00 819/838 (97%)
EPI219372 A/swine/Oklahoma/001142/2009 (A/H3N2) segment 8 (NS) 1443.4 0.000000e+00 819/838 (97%)
EPI184475 A/mallard/South Dakota/Sg-00128/2007 (A/H3N2) segment 8 (NS) 1443.4 0.000000e+00 819/838 (97%)
EPI184469 A/mallard/South Dakota/Sg-00127/2007 (A/H3N2) segment 8 (NS) 1443.4 0.000000e+00 819/838 (97%)
EPI184457 A/mallard/South Dakota/Sg-00125/2007 (A/H3N2) segment 8 (NS) 1443.4 0.000000e+00 819/838 (97%)
EPI168649 A/turkey/Minnesota/366767/2005 (A/H3N2) segment 8 (NS) 1443.4 0.000000e+00 819/838 (97%)
EPI158872 A/turkey/MN/366767/2005 (A/H3N2) segment 8 (NS) 1443.4 0.000000e+00 819/838 (97%)
EPI25408 A/turkey/ Minnesota/764-2/03 (A/H3N2) segment 8 (NS) 1443.4 0.000000e+00 820/839 (97%)
EPI9419 A/Swine/Illinois/100085A/01 (A/H1N2) segment 8 (NS) 1443.4 0.000000e+00 819/838 (97%)
EPI5873 A/Swine/Minnesota/9088-2/98 (A/H3N2) segment 8 (NS) 1443.4 0.000000e+00 819/838 (97%)
EPI5870 A/Swine/Texas/4199-2/98 (A/H3N2) segment 8 (NS) 1443.4 0.000000e+00 819/838 (97%)
EPI323999 A/swine/QC/1488-2/2009 (A/H1N1) segment 8 (NS) 1441.5 0.000000e+00 817/838 (97%)
EPI105655 A/swine/Korea/S5/2005 (A/H1N2) segment 8 (NS) 1441.5 0.000000e+00 818/837 (97%)
EPI324039 A/swine/QC/1695-3/2009 (A/H1N1) segment 8 (NS) 1437.8 0.000000e+00 818/838 (97%)
EPI323266 A/swine/Minnesota/66853/2006 (A/H3N2) segment 8 (NS) 1437.8 0.000000e+00 818/838 (97%)
EPI323257 A/swine/Minnesota/1300/2007 (A/H3N2) segment 8 (NS) 1437.8 0.000000e+00 818/838 (97%)
EPI291961 A/swine/Iowa/H02PW7/2002 (A/H1N1) segment 8 (NS) 1437.8 0.000000e+00 818/838 (97%)
EPI281214 A/swine/Texas/01976/2008 (A/H1N2) segment 8 (NS) 1437.8 0.000000e+00 818/838 (97%)
EPI225765 A/swine/Minnesota/SG242/2006 (A/H3N2) segment 8 (NS) 1437.8 0.000000e+00 818/838 (97%)
EPI222669 A/swine/Minnesota/SG244/2007 (A/H1N1) segment 8 (NS) 1437.8 0.000000e+00 802/814 (98%)
EPI222614 A/swine/Illinois/D07-040832.3/2007 (A/H1N1) segment 8 (NS) 1437.8 0.000000e+00 802/814 (98%)
EPI220903 A/swine/Oklahoma/042169/2008 (A/H1N2) segment 8 (NS) 1437.8 0.000000e+00 818/838 (97%)
EPI220887 A/swine/Oklahoma/020736-2/2008 (A/H1N2) segment 8 (NS) 1437.8 0.000000e+00 818/838 (97%)
EPI220879 A/swine/Oklahoma/020736-1/2008 (A/H1N2) segment 8 (NS) 1437.8 0.000000e+00 818/838 (97%)
EPI220863 A/swine/Oklahoma/020734-2/2008 (A/H1N2) segment 8 (NS) 1437.8 0.000000e+00 818/838 (97%)
EPI220847 A/swine/Oklahoma/016179-8/2008 (A/H1N2) segment 8 (NS) 1437.8 0.000000e+00 818/838 (97%)

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Sat Aug 06, 2011 12:01 pm 
Online

Joined: Wed Aug 19, 2009 10:42 am
Posts: 27399
Location: Pittsburgh, PA USA
niman wrote:
niman wrote:
Parallel H1N1 Pandemics in 2010?
Recombinomics Commentary 03:50
July 7, 2010

An H1N1 influenza A virus, A/swine/Ohio/24366/07, was isolated from pigs in an Ohio county fair. Twenty-six people who came in contact with the infected pigs developed respiratory disease and two of these people were laboratory confirmed as H1N1 by the Centers for Disease Control and Prevention (CDC). The A/swine/Ohio/24366/07 virus we isolated from swine was shown at the CDC to have 100% identical genome sequence to the human virus associated with the county fair.

Many of the interal genes in MN/11/2010 are closely related to those from human isolates from the above Huron County fair in 2007. This cluster was the largest reported swine flu outbreak since the Fox Dix outbreak in 1976. These internal genes are present in tha vast majority of trH3N2 human isolates. In the US, all reported trH3N2 cases followed the H1N1 pademic in 2009.

Image

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Sat Aug 06, 2011 12:10 pm 
Online

Joined: Wed Aug 19, 2009 10:42 am
Posts: 27399
Location: Pittsburgh, PA USA
Commentary

http://www.recombinomics.com/News/08061 ... N1_OH.html

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Sat Aug 06, 2011 12:43 pm 
Online

Joined: Wed Aug 19, 2009 10:42 am
Posts: 27399
Location: Pittsburgh, PA USA
niman wrote:
niman wrote:
niman wrote:
Parallel H1N1 Pandemics in 2010?
Recombinomics Commentary 03:50
July 7, 2010

An H1N1 influenza A virus, A/swine/Ohio/24366/07, was isolated from pigs in an Ohio county fair. Twenty-six people who came in contact with the infected pigs developed respiratory disease and two of these people were laboratory confirmed as H1N1 by the Centers for Disease Control and Prevention (CDC). The A/swine/Ohio/24366/07 virus we isolated from swine was shown at the CDC to have 100% identical genome sequence to the human virus associated with the county fair.

Many of the interal genes in MN/11/2010 are closely related to those from human isolates from the above Huron County fair in 2007. This cluster was the largest reported swine flu outbreak since the Fox Dix outbreak in 1976. These internal genes are present in tha vast majority of trH3N2 human isolates. In the US, all reported trH3N2 cases followed the H1N1 pademic in 2009.

Image

http://www.huroncountyfair.com/

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Sat Aug 06, 2011 1:07 pm 
Online

Joined: Wed Aug 19, 2009 10:42 am
Posts: 27399
Location: Pittsburgh, PA USA
First five cases:

The Pennsylvania and Wisconsin cases bring the number of reports swine origin A (H3N2) infections in humans in the United States to five. The viruses identified in Pennsylvania and Wisconsin are similar to viruses that infected a patient in Iowa in September 2009, a patient in Kansas in August 2009 and a patient in Minnesota in May 2010.

Reports of Human Infections with Swine Origin Influenza A (H3N2)

The November 12, 2010 FluView reports two human infections with swine origin influenza A (H3N2) viruses in the United States. Test samples from two patients submitted by Wisconsin and Pennsylvania have been confirmed at CDC as positive for swine origin triple-reassortant (tr) H3N2 influenza viruses—viruses that normally infect pigs. While human infection with swine influenza viruses is rare, it can occur. This is most likely to occur when people are in close proximity to infected pigs, such as in pig barns and livestock exhibits housing pigs at fairs. Both of the patients with confirmed trH3N2 infection reported in FluView were in the vicinity of live pigs. Dates of illness onset in the two patients are more than six weeks apart and the viruses from the two patients have some genetic differences, confirming that these two cases are not linked. Ongoing investigations in both states have not shown any evidence of community transmission of these viruses. The most likely scenario at this point is that these are two isolated cases of human infection with swine influenza viruses that, while very rare, do occur from time to time. Both patients have fully recovered from their illnesses; however, these two cases do underscore the importance of human and animal surveillance for influenza.

These two cases reported in FluView bring the total number of human infections with swine origin influenza viruses reported to CDC since 2005 to 18. Previously, three of these reports had been swine origin A (H3N2) viruses. The Pennsylvania and Wisconsin cases bring the number of reports swine origin A (H3N2) infections in humans in the United States to five. The viruses identified in Pennsylvania and Wisconsin are similar to viruses that infected a patient in Iowa in September 2009, a patient in Kansas in August 2009 and a patient in Minnesota in May 2010.

Swine Influenza (swine flu) is a respiratory disease of pigs caused by type A influenza viruses that regularly causes outbreaks of influenza in pigs. Swine flu viruses cause high levels of illness and low death rates in pigs. Swine influenza viruses may circulate among swine throughout the year, but most outbreaks occur during the late fall and winter months similar to outbreaks in humans. There are four main influenza type A virus subtypes that have been isolated in pigs: H1N1, H1N2, H3N2, and H3N1. Most flu viruses circulating in pigs are referred to as "triple-reassortant" viruses because these flu viruses contain genes from human, swine and avian influenza viruses.

Most commonly, cases of human infection with swine-origin influenza viruses occur in people with direct exposure to pigs. The patient in Pennsylvania lives in an area where live pigs are farmed and the patient in Wisconsin became sick two days after attending a state fair where pigs were exhibited. It's important to note that swine influenza viruses are not transmitted to humans by food. You can not get swine influenza from eating pork or pork products. Eating properly handled and cooked pork and pork products is safe.

In the past, CDC received reports of approximately one human infection with a swine influenza virus every one to two years, but in the past few years, about three cases have been reported per year. Increased reporting of human infections with swine influenza could be the result of increased influenza testing capacity and capabilities in public health laboratories.

These trH3N2 viruses are different from the 2009 H1N1 virus that has been circulating in the United States since late April 2009. They are also different from human seasonal influenza A (H3N2) viruses that typically circulate among people during the flu season. Swine trH3N2 viruses commonly circulate in pigs in North America, but rarely infect humans. These viruses are different from the swine classical H1N1 or swine trH1N1 influenza viruses that also circulate in pigs in North America because they have H3N2 surface antigens. Tr H3N2 viruses first emerged in North American swine herds in the late 1990s. The H3 and N2 genes which first emerged in swine flu viruses originated from human seasonal H3N2 influenza viruses that circulated globally among humans in the late 1990s.

Although the vast majority of instances of human infection with animal influenza viruses do not result in human to human transmission, each case should be fully investigated to be sure that such viruses are not spreading among humans and to limit further exposure of humans to infected animals if infected animals are identified. Surveillance for both seasonal and novel influenza viruses is conducted by the CDC and its state and local health partners year round.

For more information about swine influenza, visit http://www.cdc.gov/flu/swineflu/

Weekly U.S. surveillance updates are published in FluView and posted at http://www.cdc.gov/flu/weekly/fluactivitysurv.htm

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Sat Aug 06, 2011 1:33 pm 
Online

Joined: Wed Aug 19, 2009 10:42 am
Posts: 27399
Location: Pittsburgh, PA USA
niman wrote:
Earlier report on cluster

http://www.cdc.gov/mmwr/preview/mmwrhtm ... mm6021a5_w

Two of the five cases were hospitalized.

The above comment indicates one of the two cluster cases was hospitalized, because only of of the three earlier cases (WI/12) was hospitalized. Neither PA cases (PA/40 and PA/14) were hospitalized.

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Sat Aug 06, 2011 1:55 pm 
Online

Joined: Wed Aug 19, 2009 10:42 am
Posts: 27399
Location: Pittsburgh, PA USA
niman wrote:
niman wrote:
Earlier report on cluster

http://www.cdc.gov/mmwr/preview/mmwrhtm ... mm6021a5_w

Two of the five cases were hospitalized.

The above comment indicates one of the two cluster cases was hospitalized, because only of of the three earlier cases (WI/12) was hospitalized. Neither PA cases (PA/40 and PA/14) were hospitalized.

PA/40 case:

One case of human infection with a novel influenza A virus was reported by the Pennsylvania Department of Health. The patient was infected with a swine origin influenza A (H3N2) virus. The patient reported contact with pigs in the week preceding symptom onset on September 6, 2010, did not require hospitalization, and has since fully recovered. Initial testing of the specimen indicated a seasonal influenza A (H3N2) virus and the specimen was submitted to CDC as a routine surveillance sample. The delay from onset to detection occurred because attempts to culture the virus were unsuccessful. RT-PCR testing confirmed swine-origin influenza A (H3N2). Six other human infections with swine origin influenza A (H3N2) viruses have been identified in the United States during 2009 through 2010, including one other case from Pennsylvania in week 44 of 2010. No epidemiologic links between this case and any of the other cases of swine-origin H3N2 infection have been identified and the viruses from all seven cases have genetic differences indicating different sources of infection.

There is no evidence of human-to-human transmission with this virus; however, early identification and investigation of all human infections with novel influenza A viruses is critical to evaluate the extent of the outbreak and possible human-to-human transmission. Surveillance for human infections with novel influenza A viruses continues year round.

http://www.cdc.gov/flu/weekly/weeklyarc ... ekly04.htm

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Sat Aug 06, 2011 2:00 pm 
Online

Joined: Wed Aug 19, 2009 10:42 am
Posts: 27399
Location: Pittsburgh, PA USA
niman wrote:
Three cases of human infection with a novel influenza A virus were reported during November and December, one each from Wisconsin, Pennsylvania, and Minnesota. Onset of the illnesses occurred in September, October, and November, respectively. All three patients were infected with swine-origin influenza A (H3N2) viruses. Two of the three cases occurred in adults, and the third occurred in a child. Two of the three patients were hospitalized; all three have fully recovered from their illness. The three cases are not related, and influenza viruses recovered from each of these cases were similar but not identical, indicating that they did not come from a common source. All three patients had either contact with swine or lived in areas close to swine farms. No evidence of human-to-human transmission of these viruses was identified in the first two cases, and investigation of the third case is ongoing.

http://www.cdc.gov/mmwr/preview/mmwrhtml/mm5950a4.htm

The above quote indicates the two hospitalized patients were the Wisconsin child (A/WI/12/2010) and Minnesota cluster index case (31M, A/MN/11/2010).

_________________
www.twitter.com/hniman


Top
 Profile  
 
Display posts from previous:  Sort by  
Post new topic Reply to topic  [ 35 posts ]  Go to page Previous  1, 2, 3, 4  Next

All times are UTC - 5 hours [ DST ]


Who is online

Users browsing this forum: niman and 77 guests


You cannot post new topics in this forum
You cannot reply to topics in this forum
You cannot edit your posts in this forum
You cannot delete your posts in this forum
You cannot post attachments in this forum

Search for:
Jump to:  
Powered by phpBB® Forum Software © phpBB Group