Rhiza Labs FluTracker Forum

The place to discuss the flu
It is currently Fri May 24, 2013 9:07 am

All times are UTC - 5 hours [ DST ]




Post new topic Reply to topic  [ 209 posts ]  Go to page Previous  1 ... 11, 12, 13, 14, 15, 16, 17 ... 21  Next
Author Message
PostPosted: Thu May 05, 2011 12:40 pm 
Online

Joined: Wed Aug 19, 2009 10:42 am
Posts: 27536
Location: Pittsburgh, PA USA
gsgs wrote:
waiting for your estimate how many % of this season's H1 in USA was chi

no chi in Europe

You will be waiting for a LONG time. The distribution of the Chihuahua sub-clade has been posted (MANY times).

You should look at the real data and stay away from irrelevant questions, which simply show you have no clue (which was established long ago).

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Thu May 05, 2011 3:06 pm 
Online

Joined: Wed Aug 19, 2009 10:42 am
Posts: 27536
Location: Pittsburgh, PA USA
gsgs wrote:
waiting for your estimate how many % of this season's H1 in USA was chi

no chi in Europe

A/Denmark/111/2010 is in Europe.

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Thu May 05, 2011 3:13 pm 
Online

Joined: Wed Aug 19, 2009 10:42 am
Posts: 27536
Location: Pittsburgh, PA USA
gsgs wrote:
waiting for your estimate how many % of this season's H1 in USA was chi

no chi in Europe

Spain and Denmark are in Europe:
EPI306130 A/Denmark/111/2010 (A/H1N1 swl) segment 4 (HA) 27.0 6.40951
EPI304927 A/Galicia/RR6720/2010 (A/H1N1 swl) segment 4 (HA) 27.0 6.40951
EPI304926 A/Galicia/RR6722/2010 (A/H1N1 swl) segment 4 (HA) 27.0 6.40951
EPI304925 A/Galicia/RR6723/2010 (A/H1N1 swl) segment 4 (HA) 27.0 6.40951
EPI304924 A/Galicia/RR6724/2010 (A/H1N1 swl) segment 4 (HA) 27.0 6.40951
EPI304923 A/Galicia/RR6725/2010 (A/H1N1 swl) segment 4 (HA) 27.0 6.40951
EPI304922 A/Galicia/RR6726/2010 (A/H1N1 swl) segment 4 (HA) 27.0 6.40951
EPI304921 A/Galicia/RR6727/2010 (A/H1N1 swl) segment 4 (HA) 27.0 6.40951
EPI304907 A/Galicia/RR6669/2010 (A/H1N1 swl) segment 4 (HA) 27.0 6.40951
EPI304873 A/LaRioja/RR6478/2009 (A/H1N1 swl) segment 4 (HA) 27.0 6.40951
EPI304729 A/CastillaLaMancha/RR4990/2009 (A/H1N1 swl) segment 4 (HA) 27.0 6.40951
EPI301814 A/Aragon/RR6925/2010 (A/H1N1 swl) segment 4 (HA) 27.0 6.40951

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Thu May 05, 2011 4:28 pm 
Online

Joined: Wed Aug 19, 2009 10:42 am
Posts: 27536
Location: Pittsburgh, PA USA
niman wrote:
gsgs wrote:
waiting for your estimate how many % of this season's H1 in USA was chi

no chi in Europe

A/Denmark/111/2010 is in Europe.

Note location, isolation date, S165N, and A189T in large font:

LOCUS HQ880591 1578 bp cRNA linear VRL 25-JAN-2011
DEFINITION Influenza A virus (A/Denmark/111/2010(H1N1)) segment 4
hemagglutinin (HA) gene, partial cds.
ACCESSION HQ880591
VERSION HQ880591.1 GI:319741045
DBLINK Project: 37813
KEYWORDS .
SOURCE Influenza A virus (A/Denmark/111/2010(H1N1))
ORGANISM Influenza A virus (A/Denmark/111/2010(H1N1))
Viruses; ssRNA negative-strand viruses; Orthomyxoviridae;
Influenzavirus A.
REFERENCE 1 (bases 1 to 1578)
AUTHORS Andresen,B.S. and Nielsen,L.P.
TITLE Direct Submission
JOURNAL Submitted (13-JAN-2011) Influenza Laboratory, Statens Serum
Institut, Artillierivej 5, Copenhagen S 2300, Denmark
FEATURES Location/Qualifiers
source 1..1578
/organism="Influenza A virus (A/Denmark/111/2010(H1N1))"
/mol_type="viral cRNA"
/strain="A/Denmark/111/2010"
/serotype="H1N1"
/host="Homo sapiens"
/db_xref="taxon:945908"
/segment="4"
/country="Denmark"
/collection_date="07-Dec-2010"
/note="lineage: swl"
gene <1..>1578
/gene="HA"
CDS <1..>1578
/gene="HA"
/codon_start=3
/product="hemagglutinin"
/protein_id="ADV69045.1"
/db_xref="GI:319741046"
/translation="TLCIGYHANNSTDTVDTVLEKNVTVTHSVDLLEDKHNGKLCKLR
GVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETSSSDNGTCYPGDFIDYEELRE
QLSSVSSFERFEIFPKTSSWPNHDSNKGVTAACPHAGAKSFYKNLIWLVKKGNSYPKL
NKSYINDKGKEVLVLWGIHHPSTSTDQQSLYQNADAYVFVGTSRYSKKFKPEIAIRPK
VRDQEGRMNYYWTLVEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPIHDCNT
TCQTPKGAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAIAG
FIEGGWTGMVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVIEKMNTQFTAV
GKEFNHLEKRIENLNKKVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLYEKVRS
QLKNNAKEIGNGCFEFYHKCDNTCMESVKNGTYDYPKYSEEAKLNREEIDGVKLESTR
IYQILAIYSTVASSLVL"
ORIGIN
1 acacattatg tataggttat catgcgaaca attcaacaga cactgtagac acagtactag
61 aaaagaatgt aacagtaaca cactctgttg accttctaga agacaagcat aacgggaaac
121 tatgcaaact aagaggggta gccccattgc atttgggtaa atgtaacatt gctggctgga
181 tcctgggaaa tccagagtgt gaatcactct ccacagcaag ctcatggtcc tacattgtgg
241 aaacatctag ctcagacaat ggaacgtgtt acccaggaga tttcatcgat tatgaggagc
301 taagagagca attgagctca gtgtcatcat ttgaaaggtt tgaaatattc cccaagacaa
361 gttcatggcc caatcatgac tcgaacaaag gtgtaacggc agcatgtcct catgctggag
421 caaaaagctt ctacaaaaat ttaatatggc tagttaaaaa aggaaattca tacccaaagc
481 tcaacaaatc ctacattaat gataaaggga aagaagtcct cgtgctatgg ggcattcacc
541 atccatctac tagtactgac caacaaagtc tctatcagaa tgcagatgca tatgtttttg
601 tggggacatc aagatacagc aagaagttta agccggaaat agcaataaga cccaaagtga
661 gggatcaaga agggagaatg aactattact ggacactagt agagccggga gacaaaataa
721 cattcgaagc aactggaaat ctagtggtac cgagatatgc attcgcaatg gaaagaaatg
781 ctggatctgg tattatcatt tcagatacac caatccacga ttgcaataca acttgtcaga
841 cacccaaggg ggctataaac accagcctcc catttcagaa tatacatccg atcacaattg
901 gaaagtgtcc aaaatatgta aaaagcacaa aattgagact ggccacagga ttgaggaatg
961 tcccgtctat tcaatctaga ggcctatttg gggccattgc cggtttcatt gaaggggggt
1021 ggacaggaat ggtagatgga tggtacggtt atcaccatca aaatgagcag gggtcaggat
1081 atgcagccga cctgaagagc acacagaatg ccattgacga gattactaac aaagtaaatt
1141 ctgttattga aaagatgaat acacagttca cagcagtagg caaagagttc aaccacctgg
1201 aaaaaagaat agagaattta aataaaaaag ttgatgatgg tttcctggac atttggactt
1261 acaatgccga actgttggtt ctattggaaa atgaaagaac tttggactac cacgattcaa
1321 atgtgaagaa cttatatgaa aaggtaagaa gccagttaaa aaacaatgcc aaggaaattg
1381 gaaacggctg ctttgagttt taccacaaat gcgataacac gtgcatggaa agtgtcaaaa
1441 atgggactta tgactaccca aaatactcag aggaagcaaa attaaacaga gaagaaatag
1501 atggggtaaa gctggaatca acaaggattt accagatttt ggcgatctat tcaactgtcg
1561 ccagttcatt ggtactgg
//

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Sat May 07, 2011 2:53 pm 
Online
User avatar

Joined: Tue Sep 01, 2009 11:54 pm
Posts: 1782
Location: germany
phylotree here:

page 11

http://www.fda.gov/downloads/AdvisoryCo ... 246395.pdf

hattip mixin


(DoD+17)*3=gs to get my nucleotide-positions
DoD+3=niman

seems that Chi was in Columbia 2010
(and also Ecuador 2010 ?)

except V272I(DoD)
which was also missing in Germany/2207,Jan.2010

_________________
no patents on genes, publish the GISAID sequences !


Top
 Profile  
 
PostPosted: Sat May 07, 2011 3:58 pm 
Online

Joined: Wed Aug 19, 2009 10:42 am
Posts: 27536
Location: Pittsburgh, PA USA
gsgs wrote:
phylotree here:

page 11

http://www.fda.gov/downloads/AdvisoryCo ... 246395.pdf

hattip mixin


(DoD+17)*3=gs to get my nucleotide-positions
DoD+3=niman

seems that Chi was in Columbia 2010
(and also Ecuador 2010 ?)

except V272I(DoD)
which was also missing in Germany/2207,Jan.2010

These are some of the unpublished sequences I had mention. Note D225N in Ecuador case, as well as WHO alert which specifically mentioned H1N1 in Ecuador in January. The WHO alert is ALL about Chihuahua sub-clade with D225N. Note also that the 4 sequences from Ecuador also have K149N, which is in the Chihuahua sub-clade sequences from Mexico, as well as the eight sequences from the United States.

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Sat May 07, 2011 4:34 pm 
Online

Joined: Wed Aug 19, 2009 10:42 am
Posts: 27536
Location: Pittsburgh, PA USA
Note that three of the Ecuador sequences, A/Ecuador/IEC00012/2010, A/Ecuador/IEC00027/2010, A/Ecuador/IEC00032/2010 were collected in December 2010, and A/Ecuador/IEC00043/2011 was in January, 2011 corresponding to the citation in the WHO pandemic alert of H1N1 in Ecuador in January, 2011. Note also the presence of D225N in A/Ecuador/IEC00012/2010, consistant with "anectdotal" report of the Chihuahua sub-clade in South America and D225N in severe and fatal cases.

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Sat May 07, 2011 5:31 pm 
Online

Joined: Wed Aug 19, 2009 10:42 am
Posts: 27536
Location: Pittsburgh, PA USA
Commentary

http://www.recombinomics.com/News/05071 ... D225N.html

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Sat May 07, 2011 5:59 pm 
Online

Joined: Wed Aug 19, 2009 10:42 am
Posts: 27536
Location: Pittsburgh, PA USA
Note that the glycosylation site S165N is present on multiple sub-clades, providing addition support for recombination leading to the same polymorphisms jumping from one genetic backbone to another.

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Sat May 07, 2011 8:21 pm 
Online

Joined: Wed Aug 19, 2009 10:42 am
Posts: 27536
Location: Pittsburgh, PA USA
http://www.youtube.com/watch?v=E9YScKEB ... ture=share

_________________
www.twitter.com/hniman


Top
 Profile  
 
Display posts from previous:  Sort by  
Post new topic Reply to topic  [ 209 posts ]  Go to page Previous  1 ... 11, 12, 13, 14, 15, 16, 17 ... 21  Next

All times are UTC - 5 hours [ DST ]


Who is online

Users browsing this forum: gsgs, littlebird, MSN [Bot], Spook5365 and 57 guests


You cannot post new topics in this forum
You cannot reply to topics in this forum
You cannot edit your posts in this forum
You cannot delete your posts in this forum
You cannot post attachments in this forum

Search for:
Jump to:  
Powered by phpBB® Forum Software © phpBB Group