Rhiza Labs FluTracker Forum

The place to discuss the flu
It is currently Thu May 23, 2013 7:37 pm

All times are UTC - 5 hours [ DST ]




Post new topic Reply to topic  [ 209 posts ]  Go to page Previous  1, 2, 3, 4, 5, 6 ... 21  Next
Author Message
PostPosted: Tue Apr 26, 2011 3:17 am 
Offline
User avatar

Joined: Tue Sep 01, 2009 11:54 pm
Posts: 1781
Location: germany
does WHO/PAHO even mention D225N ?

_________________
no patents on genes, publish the GISAID sequences !


Top
 Profile  
 
PostPosted: Tue Apr 26, 2011 3:22 am 
Online

Joined: Wed Aug 19, 2009 10:42 am
Posts: 27506
Location: Pittsburgh, PA USA
gsgs wrote:
what do you guess is the first occurrance of the Chi-strain ?

I have A/Germany/AF2207/2010/01/19 with
A142G,G536A,G607A,C681T,A957G

AF seems to be from an US-airforce base in Germany,
could have come from anywhere in the world

Larger series were in the spring and summer of 2010 with the largest number from Spain. It pretty much disappeared in the fall of 2010 and then started to take off in Ecuador, as indicated in WHO report, in early 2011.

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Tue Apr 26, 2011 3:29 am 
Online

Joined: Wed Aug 19, 2009 10:42 am
Posts: 27506
Location: Pittsburgh, PA USA
gsgs wrote:
does WHO/PAHO even mention D225N ?

Please. They cite the first 3 sequences of of Chihuahua, which have D225N.
Anyone REMOTELY paying attention knows that Chihuahua and the pandemic alert is all about D225N in the UPPER respiratory tract, no WHO head fakes required.

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Tue Apr 26, 2011 3:33 am 
Online

Joined: Wed Aug 19, 2009 10:42 am
Posts: 27506
Location: Pittsburgh, PA USA
niman wrote:
gsgs wrote:
does WHO/PAHO even mention D225N ?

Please. They cite the first 3 sequences out of Chihuahua, which have D225N.
Anyone REMOTELY paying attention knows that Chihuahua and the pandemic alert are all about D225N in the UPPER respiratory tract, no WHO head fakes required.

Reality check

http://www.recombinomics.com/News/04031 ... Novel.html

LOCUS CY089387 1777 bp cRNA linear VRL 02-APR-2011
DEFINITION Influenza A virus (A/Mexico/InDRE1945/2011(H1N1)) hemagglutinin
(HA) gene, complete cds.
ACCESSION CY089387
VERSION CY089387.1 GI:327412375
DBLINK Project: 37813
KEYWORDS .
SOURCE Influenza A virus (A/Mexico/InDRE1945/2011(H1N1))
ORGANISM Influenza A virus (A/Mexico/InDRE1945/2011(H1N1))
Viruses; ssRNA negative-strand viruses; Orthomyxoviridae;
Influenzavirus A.
REFERENCE 1 (bases 1 to 1777)
AUTHORS Ramirez-Gonzalez,J.E., Alcantara-Perez,P., Rodriguez-Maldonado,A.,
Wong-Arambula,C., Del-Mazo,J.C., Esau,D., Olivera-Diaz,H.,
Barrera-Badillo,G., Lopez-Martinez,I., Guzman-Bracho,C. and
Alpuche-Aranda,C.
TITLE Detection of D222N substitution in Pandemic Influenza A (H1N1)
Virus in Chihuahua, Mexico
JOURNAL Unpublished
REFERENCE 2 (bases 1 to 1777)
AUTHORS Ramirez-Gonzalez,J.E., Alcantara-Perez,P., Rodriguez-Maldonado,A.,
Wong-Arambula,C., Del-Mazo,J.C., Esau,D., Olivera-Diaz,H.,
Barrera-Badillo,G., Lopez-Martinez,I., Guzman-Bracho,C. and
Alpuche-Aranda,C.
TITLE Direct Submission
JOURNAL Submitted (02-APR-2011) Laboratorio de Genoma de Patogenos,
Instituto de Diagnostico y Referencia Epidemiologicos, Crpio 470
Col. Sto Tomas, Mexico, DF 11340, Mexico
FEATURES Location/Qualifiers
source 1..1777
/organism="Influenza A virus
(A/Mexico/InDRE1945/2011(H1N1))"
/mol_type="viral cRNA"
/strain="A/Mexico/InDRE1945/2011"
/serotype="H1N1"
/isolation_source="Pharyngeal swab"
/host="human; gender M; age 36"
/db_xref="taxon:1003291"
/segment="4"
/country="Mexico: Chihuahua"
/collection_date="Mar-2011"
gene 33..1733
/gene="HA"
CDS 33..1733
/gene="HA"
/function="receptor binding and fusion protein"
/codon_start=1
/product="hemagglutinin"
/protein_id="AEA74031.1"
/db_xref="GI:327412376"
/translation="MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVT
HSVDLLEDKHNGKLCKLRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETSSS
DNGTCYPGDFIDYEELREQLSSVSSFERFEIFPKTSSWPNHDSNKGVTAACPHAGAKS
FYNNLIWLVKKGNSYPKLNKSYINDKGKEVLVLWGIHHPSTSTDQQSLYQNADAYVFV
GTSRYSKKFKPEIAIRPKVRNQEGRMNYYWTLVEPGDKITFEATGNLVVPRYAFAMER
NAGSGIIISDTPIHDCNTTCQTPKGAINTSLPFQNIHPITIGKCPKYVKSTKLRLATG
LRNVPSIQSRGLFGAIAGFIEGGWTGMVDGWYGYHHQNEQGSGYAADLKSTQNAIDEI
TNKVNSVIEKMNTQFTAVGKEFNHLEKRIENLNKKVDDGFLDIWTYNAELLVLLENER
TLDYHDSNVKNLYEKVRSQLKNNAKEIGNGCFEFYHKCDNTCMESVKNGTYDYPKYSE
EAKLNREEIDGVKLESTRIYQILAIYSTVASSLVLVVSLGAISFWMCSNGSLQCRICI
"
sig_peptide 33..83
/gene="HA"
mat_peptide 84..1064
/gene="HA"
/product="HA1"
mat_peptide 1065..1730
/gene="HA"
/product="HA2"
ORIGIN
1 agcaaaagca ggggaaaaca aaagcaacaa aaatgaaggc aatactagta gttctgctat
61 atacatttgc aaccgcaaat gcagacacat tatgtatagg ttatcatgcg aacaattcaa
121 cagacactgt agacacagta ctagaaaaga atgtaacagt aacacattct gttgaccttc
181 tagaagacaa gcataacggg aaactatgca aactaagagg ggtagcccca ttgcatttag
241 gtaaatgtaa cattgctggc tggatcctgg gaaatccaga gtgtgaatca ctctccacag
301 caagctcatg gtcttacatt gtggaaacat ctagttcaga caatggaacg tgttacccag
361 gagatttcat cgattatgag gagctaagag agcaattgag ctcagtgtca tcatttgaaa
421 ggtttgaaat attccccaag acaagttcat ggcccaatca tgactcgaac aaaggtgtaa
481 cggcagcatg tccacatgct ggagcaaaaa gcttctacaa caatttaata tggctagtta
541 aaaaaggaaa ttcataccca aagctcaaca aatcctacat taatgataaa gggaaagaag
601 tcctcgtgct atggggcatt caccatccat ctactagtac tgaccaacaa agtctctatc
661 agaatgcaga tgcatatgtt tttgtgggga catcaagata cagcaagaag tttaagccgg
721 aaatagcaat aagacccaaa gtgaggaatc aagaagggag aatgaactat tactggacac
781 tagtagagcc gggagacaaa ataacattcg aagcaactgg aaatctagtg gtaccgagat
841 atgcattcgc aatggaaaga aatgctggat ctggtattat catttcagat acaccaatcc
901 acgattgcaa tacaacttgt cagacaccca agggggctat aaacaccagc ctcccatttc
961 agaatataca tccgatcaca attggaaagt gtccaaaata tgtaaaaagc acaaaattga
1021 gactggccac aggattgagg aatgtcccgt ctattcaatc tagaggccta tttggggcca
1081 ttgccggttt cattgaaggg gggtggacag gaatggtaga tggatggtac ggttatcacc
1141 atcaaaatga gcaggggtca ggatatgcag ccgacctgaa gagcacacag aatgccattg
1201 acgagattac taacaaagta aattctgtta ttgaaaagat gaatacgcag ttcacagcag
1261 taggcaaaga gttcaaccac ctggaaaaaa gaatagagaa tttaaataaa aaagttgatg
1321 atggtttcct ggacatttgg acttacaatg ccgaactgtt ggttctattg gaaaatgaaa
1381 gaactttgga ctaccacgat tcaaatgtga agaacttata tgaaaaggta agaagccagt
1441 taaaaaacaa tgccaaggaa attggaaacg gctgctttga attttaccac aaatgcgata
1501 acacgtgcat ggaaagtgtc aaaaatggga cttatgacta cccaaaatac tcagaggaag
1561 caaaattaaa cagagaagaa atagatgggg taaagctgga atcaacaagg atttaccaga
1621 ttttggcgat ctattcaact gtcgccagtt cattggtact ggtagtctcc ctgggggcaa
1681 tcagtttctg gatgtgctct aatgggtctc tacagtgtag aatatgtatt taacattagg
1741 atttcagaag catgagaaaa acacccttgt ttctact

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Tue Apr 26, 2011 3:36 am 
Offline
User avatar

Joined: Tue Sep 01, 2009 11:54 pm
Posts: 1781
Location: germany
was there increased virulence or anything unusual (D225N etc.)
in that strain before ?

Spain,Ecuador

_________________
no patents on genes, publish the GISAID sequences !


Top
 Profile  
 
PostPosted: Tue Apr 26, 2011 3:37 am 
Online

Joined: Wed Aug 19, 2009 10:42 am
Posts: 27506
Location: Pittsburgh, PA USA
gsgs wrote:
does WHO/PAHO even mention D225N ?

You remain data analysis challenged.
From WHO April 6 report:

Institute of Diagnosis and Epidemiological Reference (InDRE) of Mexico carried out genetic sequencing of the first three pandemic (H1N1) 2009 influenza cases (two fatal cases and one mild),

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Tue Apr 26, 2011 3:38 am 
Offline
User avatar

Joined: Tue Sep 01, 2009 11:54 pm
Posts: 1781
Location: germany
seems to go away in Northern summer now
like last year

_________________
no patents on genes, publish the GISAID sequences !


Top
 Profile  
 
PostPosted: Tue Apr 26, 2011 3:41 am 
Offline
User avatar

Joined: Tue Sep 01, 2009 11:54 pm
Posts: 1781
Location: germany
> Detection of D222N substitution in Pandemic Influenza A (H1N1)
> Virus in Chihuahua, Mexico

"detection" doesn't say how prevalent it was/is

_________________
no patents on genes, publish the GISAID sequences !


Top
 Profile  
 
PostPosted: Tue Apr 26, 2011 3:41 am 
Online

Joined: Wed Aug 19, 2009 10:42 am
Posts: 27506
Location: Pittsburgh, PA USA
gsgs wrote:
seems to go away in Northern summer now
like last year

In 2009 it went to summer camp (but without D225N in the upper respiratory tract).

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Tue Apr 26, 2011 3:44 am 
Offline
User avatar

Joined: Tue Sep 01, 2009 11:54 pm
Posts: 1781
Location: germany
could it be, that the Chi-strain is better adapted to summer weather,
but can't stand the competition (via human immunity) during
waves of other flus ?

_________________
no patents on genes, publish the GISAID sequences !


Top
 Profile  
 
Display posts from previous:  Sort by  
Post new topic Reply to topic  [ 209 posts ]  Go to page Previous  1, 2, 3, 4, 5, 6 ... 21  Next

All times are UTC - 5 hours [ DST ]


Who is online

Users browsing this forum: DokyPydroky, Exabot [Bot], Google [Bot], niman and 44 guests


You cannot post new topics in this forum
You cannot reply to topics in this forum
You cannot edit your posts in this forum
You cannot delete your posts in this forum
You cannot post attachments in this forum

Search for:
Jump to:  
Powered by phpBB® Forum Software © phpBB Group