Rhiza Labs FluTracker Forum

The place to discuss the flu
It is currently Sun May 19, 2013 11:43 pm

All times are UTC - 5 hours [ DST ]




Post new topic Reply to topic  [ 11 posts ]  Go to page 1, 2  Next
Author Message
PostPosted: Tue Mar 08, 2011 1:38 pm 
Online

Joined: Wed Aug 19, 2009 10:42 am
Posts: 27289
Location: Pittsburgh, PA USA
St Jude has released a full set of sequences for an H1N2 isolate from Indiana, A/swine/Indiana/240218/2010, collected on Feb 12, 2010. It has a pandemic H1N1 genetic background with a human N2 from 1996 H3N2 and swine H1N1 and NP genes. This isolate is part of a growing trend of reassortment between pandemic H1N1 and various swine triple reassortants worldwide.

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Tue Mar 08, 2011 1:39 pm 
Online

Joined: Wed Aug 19, 2009 10:42 am
Posts: 27289
Location: Pittsburgh, PA USA
LOCUS CY086880 1745 bp cRNA linear VRL 02-MAR-2011
DEFINITION Influenza A virus (A/swine/Indiana/240218/2010(H1N2)) hemagglutinin
(HA) gene, complete cds.
ACCESSION CY086880
VERSION CY086880.1 GI:325111427
KEYWORDS .
SOURCE Influenza A virus (A/swine/Indiana/240218/2010(H1N2))
ORGANISM Influenza A virus (A/swine/Indiana/240218/2010(H1N2))
Viruses; ssRNA negative-strand viruses; Orthomyxoviridae;
Influenzavirus A.
REFERENCE 1 (bases 1 to 1745)
AUTHORS Ducatez,M.F., Webby,R.J., Hause,B., Evelyn,S.-R., Darnel,D.,
Corzo,C., Juleen,K., Simonson,R., Rubrum,A., Lowe,J. and Gramer,M.
TITLE unpublished
JOURNAL Unpublished
REFERENCE 2 (bases 1 to 1745)
AUTHORS Ducatez,M.F., Webby,R.J., Hause,B., Evelyn,S.-R., Darnel,D.,
Corzo,C., Juleen,K., Simonson,R., Rubrum,A., Lowe,J. and Gramer,M.
TITLE Direct Submission
JOURNAL Submitted (02-MAR-2011) Infectious Diseases, St. Jude Children's
Research Hospital, 262 Danny Thomas Place, Memphis, Tennessee
38105, USA
FEATURES Location/Qualifiers
source 1..1745
/organism="Influenza A virus
(A/swine/Indiana/240218/2010(H1N2))"
/mol_type="viral cRNA"
/strain="A/swine/Indiana/240218/2010"
/serotype="H1N2"
/host="swine"
/db_xref="taxon:991766"
/segment="4"
/country="USA: Indiana"
/collection_date="21-Feb-2010"
misc_feature 1..1745
/db_xref="IRD:CEIRS-SJC001-215928.4"
gene 1..1701
/gene="HA"
CDS 1..1701
/gene="HA"
/function="receptor binding and fusion protein"
/codon_start=1
/product="hemagglutinin"
/protein_id="ADY80044.1"
/db_xref="GI:325111428"
/translation="MKTILVVLLYTFATADADTLCIGYHANNSTDTVDTVLEKNVTVT
HSVNLLENKHNGKLCKLRGIAPLHLGKCNIAGWLLGNPECESLFTASSWSYIVETPNS
DNGTCYPGDFINYEELREHLSSVSSFERFEIFPKANSWPNHDTNKGVTTACPYAGAKS
FYRNLVWLVKKGNSYPKLSKSYTNNKKKEVLVIWGIHHPPTSTDQQTLYQNADAYVFV
GSSKYSKRFTPEIAVRPKVRDQAGRMDYYWALIEPGDTITFEATGNLVVPRYAFAMKR
GSGSGIIVSNAPVHDCNTTCQTPNGAINTSLPFQNIHPVTIGECPKYVKSTNLRMATG
LRNIPSIQSRGLFGAIAGFIEGGWTGMIEGWYGYHHQNEQGSGYAADQKSTQNAIDGI
TNKVNSIIEKMNTQFTAVGKEFSQLERRIESLNNKVDDGFLDIWTYNAELLVLLENER
TLDYHDSNVKNLYEKVRSQLKNNAKEIGNGCFEFYHKCDDTCMESVKNGTYDYPKYSE
EARLNREEIDGVKLESTKIYQILAIYSTVASSLVLLISLGAVSFWMCSNGSLQCRICI
"
sig_peptide 1..51
/gene="HA"
mat_peptide 52..1032
/gene="HA"
/product="HA1"
mat_peptide 1033..1698
/gene="HA"
/product="HA2"
ORIGIN
1 atgaagacaa tactagtagt cttgctatat acatttgcaa ctgcagatgc tgacacatta
61 tgtataggct atcatgcaaa taattcaaca gacactgttg acacagtgct agaaaagaat
121 gtaacagtaa cacactctgt taaccttcta gaaaacaaac ataacgggaa actatgtaaa
181 ctaagaggga tagccccatt gcatttaggt aaatgtaaca ttgctggatg gctcttggga
241 aacccagagt gtgaatcact attcacagca agctcatggt cctacatagt ggaaacacct
301 aattcagaca atgggacatg ctatccagga gatttcatca attatgagga actaagagag
361 catttgagct ctgtgtcatc atttgaaagg tttgagatat tccccaaggc aaattcatgg
421 cccaatcatg atacgaacaa aggggtgacg acagcatgtc cttatgctgg agcaaaaagc
481 ttttacagaa atttagtatg gctagttaaa aaaggaaatt catacccaaa gctcagtaaa
541 tcctacacta acaataagaa gaaggaagtc ctcgtaatat ggggaatcca tcatccacct
601 accagtactg accaacaaac tctctaccag aatgcagatg cctatgtttt tgtgggatca
661 tcaaaataca gcaaaagatt cacgccagaa atagcagtaa gacccaaggt gagggatcaa
721 gctggaagaa tggactatta ctgggcacta atagaacctg gagacacaat aacattcgaa
781 gcaactggaa atctagtggt accaagatat gccttcgcaa tgaaaagagg ctctgggtct
841 ggcattatcg tttcaaacgc acctgttcac gattgtaaca cgacttgtca aacacccaac
901 ggtgctataa acaccagcct tccatttcag aatatacatc cagtcacaat tggagaatgt
961 ccaaaatatg tcaaaagcac aaatttgaga atggctacag gattaagaaa tatcccgtct
1021 attcaatcaa gaggcctatt tggggccatt gctggcttca ttgaaggagg gtggacagga
1081 atgatagaag gatggtacgg ttaccaccat caaaatgagc aggggtcagg atatgcagcc
1141 gatcaaaaga gcacacagaa tgccattgac gggatcacta acaaagtaaa ttctattatt
1201 gaaaagatga acacacaatt cacagcagtg ggcaaagaat tcagccaatt ggaaagaaga
1261 atagagagtt taaacaataa ggttgatgat gggtttctgg atatttggac ttacaatgcc
1321 gaactgctgg ttctattgga aaatgaaaga actctggatt atcacgattc aaatgtgaag
1381 aacctatatg aaaaagtaag aagccagcta aaaaacaatg ccaaagaaat tggaaatggc
1441 tgctttgaat tttaccacaa atgcgatgac acgtgcatgg agagtgtcaa aaatgggact
1501 tatgattacc caaaatactc agaagaagca agactaaata gagaggagat agatggggta
1561 aagctggaat caacaaagat ttaccagatt ttggcgatct actcaactgt cgccagctca
1621 ttggtactgt taatctctct gggggcagtc agtttctgga tgtgctccaa tgggtcttta
1681 cagtgcagaa tatgtatcta agattaggat ttcagagaca taagaaaaac acccttgttt
1741 ctact

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Tue Mar 08, 2011 1:53 pm 
Online

Joined: Wed Aug 19, 2009 10:42 am
Posts: 27289
Location: Pittsburgh, PA USA
Top 100 HA matches

CY086880.1 Influenza A virus (A/swine/Indiana/240218/2010(H1N2)) hemagglutinin (HA) gene, complete cds 3459 3459 100% 0.0 100%
GQ452235.1 Influenza A virus (A/swine/Iowa/H04YS2/2004(H1N1)) segment 4 hemagglutinin (HA) gene, complete cds 2976 2976 97% 0.0 97%
HM125974.1 Influenza A virus (A/swine/MN/48683/2002(H1N1)) segment 4 hemagglutinin (HA) gene, complete cds 2968 2968 97% 0.0 97%
EU139832.1 Influenza A virus (A/swine/Iowa/00239/2004(H1N1)) hemagglutinin (HA) gene, complete cds 2968 2968 97% 0.0 97%
EU798779.1 Influenza A virus (A/swine/Korea/CAS08/2005(H1N1)) segment 4 hemagglutinin (HA) gene, complete cds 2952 2952 97% 0.0 96%
GU135973.1 Influenza A virus (A/swine/Iowa/H03UWF2/2003(H1N1)) segment 4 hemagglutinin (HA) gene, complete cds 2936 2936 97% 0.0 96%
GU135867.1 Influenza A virus (A/swine/Iowa/H02NJ56371/2002(H1N1)) segment 4 hemagglutinin (HA) gene, complete cds 2928 2928 97% 0.0 96%
GU135910.1 Influenza A virus (A/swine/Iowa/H03G1/2003(H1N1)) segment 4 hemagglutinin (HA) gene, complete cds 2920 2920 97% 0.0 96%
GU135957.1 Influenza A virus (A/swine/Iowa/H03LS4/2003(H1N1)) segment 4 hemagglutinin (HA) gene, complete cds 2912 2912 97% 0.0 96%
EU798778.1 Influenza A virus (A/swine/Korea/CAN01/2004(H1N1)) segment 4 hemagglutinin (HA) gene, complete cds 2912 2912 97% 0.0 96%
GU135875.1 Influenza A virus (A/swine/Iowa/H02NJ56391/2002(H1N1)) segment 4 hemagglutinin (HA) gene, complete cds 2904 2904 97% 0.0 96%
DQ889689.1 Influenza A virus (A/Iowa/CEID23/2005(H1N1)) hemagglutinin (HA) gene, complete cds 2878 2878 97% 0.0 96%
GU135965.1 Influenza A virus (A/swine/Iowa/H03US3/2003(H1N1)) segment 4 hemagglutinin (HA) gene, complete cds 2872 2872 97% 0.0 96%
FJ986618.1 Influenza A virus (A/Iowa/01/2006(H1N1)) segment 4 hemagglutinin (HA) gene, partial cds 2863 2863 96% 0.0 96%
AY060049.1 Influenza A virus (A/SW/MO/1877/01(H1N2)) hemagglutinin (HA) gene, complete cds 2835 2835 99% 0.0 95%
FJ750522.1 Influenza A virus (A/ferret/Iowa/15828B/2008(H1N1)) segment 4 hemagglutinin (HA) gene, complete cds 2825 2825 97% 0.0 95%
AF455679.1 Influenza A virus (A/Swine/Iowa/930/01(H1N2)) hemagglutinin (HA) gene, complete cds 2825 2825 97% 0.0 95%
GU289665.1 Influenza A virus (A/swine/Wisconsin/R33f/2001(H1N2)) segment 4 hemagglutinin (HA) gene, complete cds 2809 2809 97% 0.0 95%
AY129156.1 Influenza A virus (A/Swine/Korea/CY02/02(H1N2)) hemagglutinin (HA) mRNA, complete cds 2801 2801 100% 0.0 95%
HQ378735.1 Influenza A virus(A/swine/Iowa/46519-3/2008(H1N1)) segment 4 hemagglutinin (HA) gene, complete cds 2761 2761 97% 0.0 95%
HQ378738.1 Influenza A virus(A/swine/Iowa/46519-4/2008(H1N1)) segment 4 hemagglutinin (HA) gene, complete cds 2746 2746 97% 0.0 95%
HM125982.1 Influenza A virus (A/swine/MN/23506/2009(H1N1)) segment 4 hemagglutinin (HA) gene, complete cds 2746 2746 97% 0.0 95%
GU135883.1 Influenza A virus (A/swine/Iowa/H02PW7/2002(H1N1)) segment 4 hemagglutinin (HA) gene, complete cds 2744 2744 97% 0.0 95%
HM461842.1 Influenza A virus (A/swine/Iowa/02096/2008(H1N1)) segment 4 hemagglutinin (HA) gene, partial cds 2714 2714 97% 0.0 95%
GU135905.1 Influenza A virus (A/swine/Iowa/H02HE4/2002(H1N1)) segment 4 hemagglutinin (HA) gene, complete cds 2712 2712 97% 0.0 95%
AY233393.1 Influenza A virus (A/duck/NC/91347/01(H1N2)) hemagglutinin (HA) gene, complete cds 2698 2698 99% 0.0 94%
HM585494.1 Influenza A virus (A/swine/Iowa/03031/2010(H1N1)) hemagglutinin (HA) gene, complete cds 2684 2684 97% 0.0 94%
AY060046.1 Influenza A virus (A/SW/CO/17871/01(H1N2)) hemagglutinin (HA) gene, complete cds 2684 2684 99% 0.0 94%
HQ378732.1 Influenza A virus(A/swine/Iowa/46519-2/2008(H1N1)) segment 4 hemagglutinin (HA) gene, complete cds 2682 2682 97% 0.0 94%
GU135933.1 Influenza A virus (A/swine/Iowa/H03HS5/2003(H1N1)) segment 4 hemagglutinin (HA) gene, complete cds 2674 2674 97% 0.0 94%
EU139829.1 Influenza A virus (A/swine/North Carolina/36883/2002(H1N1)) hemagglutinin (HA) gene, complete cds 2658 2658 97% 0.0 94%
AF455678.1 Influenza A virus (A/Swine/Minnesota/55551/00 (H1N2)) hemagglutinin (HA) gene, complete cds 2627 2627 97% 0.0 94%
CY040597.1 Influenza A virus (A/swine/North Carolina/29698/2003(H1)) segment 4 sequence 2599 2599 98% 0.0 94%
CY040604.1 Influenza A virus (A/swine/North Carolina/9675/2003(H1)) segment 4 sequence 2583 2583 98% 0.0 94%
HM461834.1 Influenza A virus (A/swine/Nebraska/02013/2008(H1N1)) segment 4 hemagglutinin (HA) gene, partial cds 2577 2577 90% 0.0 95%
CY040587.1 Influenza A virus (A/swine/North Carolina/29482/2003(H1)) segment 4 sequence 2563 2563 98% 0.0 93%
CY040589.1 Influenza A virus (A/swine/North Carolina/37895/2003(H1)) segment 4 sequence 2561 2561 98% 0.0 93%
GU135949.1 Influenza A virus (A/swine/Iowa/H03LJ10/2003(H1N1)) segment 4 hemagglutinin (HA) gene, complete cds 2539 2539 97% 0.0 93%
HM461826.1 Influenza A virus (A/swine/North Carolina/02084/2008(H1N1)) segment 4 hemagglutinin (HA) gene, partial cds 2535 2535 87% 0.0 95%
CY040553.1 Influenza A virus (A/swine/North Carolina/46203/2003(H1N1)) segment 4 sequence 2535 2535 98% 0.0 93%
CY035070.1 Influenza A virus (A/swine/Memphis/1/1990(H1N1)) segment 4, complete sequence 2531 2531 98% 0.0 93%
CY028780.1 Influenza A virus (A/swine/California/T9001707/1991(H1N1)) segment 4, complete sequence 2516 2516 98% 0.0 93%
CY022477.1 Influenza A virus (A/swine/Maryland/23239/1991(H1N1)) segment 4, complete sequence 2500 2500 98% 0.0 93%
CY040598.1 Influenza A virus (A/swine/North Carolina/36681/2003(H1)) segment 4 sequence 2496 2496 96% 0.0 93%
EU743159.1 Influenza A virus (A/turkey/IA/21089-3/1992(H1N1)) segment 4 hemagglutinin (HA) gene, complete cds 2492 2492 99% 0.0 93%
CY027155.1 Influenza A virus (A/swine/Iowa/24297/1991(H1N1)) segment 4, complete sequence 2484 2484 98% 0.0 93%
CY040588.1 Influenza A virus (A/swine/North Carolina/35279/2003(H1)) segment 4 sequence 2472 2472 97% 0.0 93%
CY085073.1 Influenza A virus (A/swine/Hong Kong/1286/1993(H1N1)) hemagglutinin (HA) gene, complete cds 2444 2444 97% 0.0 93%
CY087056.1 Influenza A virus (A/swine/Hong Kong/2422/1994(H1N1)) hemagglutinin (HA) gene, complete cds 2434 2434 97% 0.0 92%
CY085121.1 Influenza A virus (A/swine/Hong Kong/1937/1994(H1N1)) hemagglutinin (HA) gene, complete cds 2432 2432 97% 0.0 93%
CY085049.1 Influenza A virus (A/swine/Hong Kong/1219/1993(H1N1)) hemagglutinin (HA) gene, complete cds 2432 2432 98% 0.0 92%
CY085057.1 Influenza A virus (A/swine/Hong Kong/1223/1993(H1N1)) hemagglutinin (HA) gene, complete cds 2430 2430 97% 0.0 92%
CY087120.1 Influenza A virus (A/swine/Hong Kong/2603/1994(H1N1)) hemagglutinin (HA) gene, partial cds 2428 2428 97% 0.0 93%
CY085105.1 Influenza A virus (A/swine/Hong Kong/1795/1994(H1N1)) hemagglutinin (HA) gene, complete cds 2428 2428 97% 0.0 93%
CY084961.1 Influenza A virus (A/swine/Hong Kong/128/1993(H1N1)) hemagglutinin (HA) gene, complete cds 2428 2428 97% 0.0 93%
CY087104.1 Influenza A virus (A/swine/Hong Kong/2518/1994(H1N1)) hemagglutinin (HA) gene, complete cds 2426 2426 97% 0.0 92%
CY087096.1 Influenza A virus (A/swine/Hong Kong/2507/1994(H1N1)) hemagglutinin (HA) gene, complete cds 2426 2426 97% 0.0 92%
CY087080.1 Influenza A virus (A/swine/Hong Kong/2461/1994(H1N1)) hemagglutinin (HA) gene, complete cds 2426 2426 97% 0.0 92%
CY087072.1 Influenza A virus (A/swine/Hong Kong/2445/1994(H1N1)) hemagglutinin (HA) gene, complete cds 2426 2426 97% 0.0 92%
CY087064.1 Influenza A virus (A/swine/Hong Kong/2428/1994(H1N1)) hemagglutinin (HA) gene, complete cds 2426 2426 97% 0.0 92%
CY087048.1 Influenza A virus (A/swine/Hong Kong/2161/1994(H1N1)) hemagglutinin (HA) gene, complete cds 2424 2424 97% 0.0 92%
CY087112.1 Influenza A virus (A/swine/Hong Kong/2592/1994(H1N1)) hemagglutinin (HA) gene, partial cds 2420 2420 97% 0.0 92%
CY087088.1 Influenza A virus (A/swine/Hong Kong/2503/1994(H1N1)) hemagglutinin (HA) gene, partial cds 2420 2420 97% 0.0 92%
CY085113.1 Influenza A virus (A/swine/Hong Kong/1845/1994(H1N1)) hemagglutinin (HA) gene, partial cds 2420 2420 97% 0.0 92%
CY085097.1 Influenza A virus (A/swine/Hong Kong/1767/1994(H1N1)) hemagglutinin (HA) gene, complete cds 2420 2420 97% 0.0 92%
CY085081.1 Influenza A virus (A/swine/Hong Kong/1290/1993(H1N1)) hemagglutinin (HA) gene, complete cds 2420 2420 97% 0.0 92%
CY084977.1 Influenza A virus (A/swine/Hong Kong/249/1993(H1N1)) hemagglutinin (HA) gene, complete cds 2413 2413 97% 0.0 92%
CY084969.1 Influenza A virus (A/swine/Hong Kong/158/1993(H1N1)) hemagglutinin (HA) gene, complete cds 2407 2407 97% 0.0 92%
EU735786.1 Influenza A virus (A/turkey/NC/19762/1988(H1N1)) hemagglutinin (HA) gene, complete cds 2391 2391 100% 0.0 92%
GQ229277.1 Influenza A virus (A/swine/Hong Kong/103/1993(H1N1)) segment 4 hemagglutinin (HA) gene, partial cds 2389 2389 94% 0.0 93%
CY040596.1 Influenza A virus (A/swine/North Carolina/26762/2003(H1)) segment 4 sequence 2389 2389 98% 0.0 92%
AF455676.1 Influenza A virus (A/Swine/North Carolina/98225/01(H1N2)) hemagglutinin (HA) gene, complete cds 2389 2389 97% 0.0 92%
CY085001.1 Influenza A virus (A/swine/Hong Kong/574/1993(H1N1)) hemagglutinin (HA) gene, complete cds 2387 2387 97% 0.0 92%
CY085089.1 Influenza A virus (A/swine/Hong Kong/1374/1993(H1N1)) hemagglutinin (HA) gene, partial cds 2381 2381 97% 0.0 92%
CY085033.1 Influenza A virus (A/swine/Hong Kong/813/1993(H1N1)) hemagglutinin (HA) gene, complete cds 2379 2379 97% 0.0 92%
CY085017.1 Influenza A virus (A/swine/Hong Kong/172/1993(H1N1)) hemagglutinin (HA) gene, partial cds 2379 2379 95% 0.0 92%
CY084993.1 Influenza A virus (A/swine/Hong Kong/347/1993(H1N1)) hemagglutinin (HA) gene, complete cds 2379 2379 97% 0.0 92%
CY085065.1 Influenza A virus (A/swine/Hong Kong/835/1993(H1N1)) hemagglutinin (HA) gene, complete cds 2377 2377 97% 0.0 92%
U53163.1 Influenza A virus (A/WI/4755/1994(H1N1)) hemagglutinin (HA) mRNA, complete cds 2375 2375 100% 0.0 92%
U53162.1 Influenza A virus (A/WI/4754/1994(H1N1)) hemagglutinin (HA) mRNA, complete cds 2375 2375 100% 0.0 92%
CY084985.1 Influenza A virus (A/swine/Hong Kong/299/1993(H1N1)) hemagglutinin (HA) gene, complete cds 2373 2373 97% 0.0 92%
CY085041.1 Influenza A virus (A/swine/Hong Kong/829/1993(H1N1)) hemagglutinin (HA) gene, complete cds 2371 2371 97% 0.0 92%
FJ357104.1 Influenza A virus (A/turkey/NC/17026/1988(H1N1)) segment 4 hemagglutinin (HA) gene, complete cds 2365 2365 99% 0.0 92%
CY022333.1 Influenza A virus (A/swine/Iowa/17672/1988(H1N1)) segment 4, complete sequence 2365 2365 98% 0.0 92%
GU052267.1 Influenza A virus (A/Swine/Indiana/1726/1988(H1N1)) segment 4 hemagglutinin (HA) gene, complete cds 2357 2357 99% 0.0 92%
M81707.1 Influenza A virus (A/Swine/Indiana/1726/1988(H1N1)) haemagglutinin gene, complete cds 2351 2351 100% 0.0 92%
CY039925.1 Influenza A Virus (A/swine/Indiana/1726/1988(H1N1)) segment 4, complete sequence 2349 2349 98% 0.0 92%
CY039917.1 Influenza A Virus (A/swine/Wisconsin/1915/1988(H1N1)) segment 4, complete sequence 2349 2349 98% 0.0 92%
CY025010.1 Influenza A virus (A/swine/Kansas/3024/1987(H1N1)) segment 4, complete sequence 2349 2349 98% 0.0 92%
CY022429.1 Influenza A virus (A/swine/Wisconsin/1915/1988(H1N1)) segment 4, complete sequence 2349 2349 98% 0.0 92%
CY022469.1 Influenza A virus (A/swine/Kansas/3228/1987(H1N1)) segment 4, complete sequence 2349 2349 98% 0.0 92%
FJ789832.1 Influenza A virus (A/swine/Shanghai/3/2005(H1N1)) segment 4 hemagglutinin (HA) gene, complete cds 2343 2343 100% 0.0 91%
CY022970.1 Influenza A virus (A/swine/Iowa/31483/1988(H1N1)) segment 4, complete sequence 2341 2341 98% 0.0 92%
GU086009.1 Influenza A virus (A/swine/Guangdong/33/2006(H1N1)) segment 4 hemagglutinin (HA) gene, complete cds 2335 2335 100% 0.0 91%
EU502885.1 Influenza A virus (A/swine/Shanghai/2/2005(H1N1)) hemagglutinin (HA) gene, complete cds 2335 2335 100% 0.0 91%
EU502884.1 Influenza A virus (A/swine/Shanghai/1/2005(H1N1)) hemagglutinin (HA) gene, complete cds 2335 2335 100% 0.0 91%
L24362.1 Influenza A virus (A/MD/12/1991(H1N1)) hemagglutinin (HA) gene, complete cds 2335 2335 99% 0.0 92%
CY024925.1 Influenza A virus (A/Ohio/3559/1988(H1N1)) segment 4, complete sequence 2333 2333 99% 0.0 92%
GU086041.1 Influenza A virus (A/swine/Guangdong/611/2006(H1N1)) segment 4 hemagglutinin (HA) gene, complete cds 2327 2327 100% 0.0 91%
GQ422385.1 Influenza A virus (A/swine/Guangdong/103/2002(H1N1)) segment 4 hemagglutinin (HA) gene, complete cds 2327 2327 100% 0.0 91%

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Tue Mar 08, 2011 1:55 pm 
Online

Joined: Wed Aug 19, 2009 10:42 am
Posts: 27289
Location: Pittsburgh, PA USA
Top 100 NA matches

CY086882.1 Influenza A virus (A/swine/Indiana/240218/2010(H1N2)) neuraminidase (NA) gene, complete cds 2795 2795 100% 0.0 100%
AY129157.1 Influenza A virus (A/Swine/Korea/CY02/02(H1N2)) neuraminidase (NA) mRNA, complete cds 2367 2367 100% 0.0 96%
CY041881.1 Influenza A virus (A/mallard/South Dakota/Sg-00128/2007(H3N2)) segment 6 sequence 2335 2335 100% 0.0 95%
CY041873.1 Influenza A virus (A/mallard/South Dakota/Sg-00127/2007(H3N2)) segment 6 sequence 2335 2335 100% 0.0 95%
CY041865.1 Influenza A virus (A/northern pintail/South Dakota/Sg-00126/2007(H3N2)) segment 6 sequence 2335 2335 100% 0.0 95%
CY041857.1 Influenza A virus (A/mallard/South Dakota/Sg-00125/2007(H3N2)) segment 6 sequence 2335 2335 100% 0.0 95%
AF455698.1 Influenza A virus (A/Swine/Illinois/100084/01 (H1N2)) neuraminidase (NA) gene, complete cds 2327 2327 100% 0.0 95%
AF455697.1 Influenza A virus (A/Swine/Illinois/100085A/01 (H1N2)) neuraminidase (NA) gene, complete cds 2319 2319 100% 0.0 95%
AF455695.1 Influenza A virus (A/Swine/Iowa/930/01(H1N2)) neuraminidase (NA) gene, complete cds 2319 2319 100% 0.0 95%
GU135927.1 Influenza A virus (A/swine/Iowa/H03HO7/2003(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 2303 2303 100% 0.0 95%
AF455691.1 Influenza A virus (A/Swine/Ohio/891/01(H1N2)) neuraminidase (NA) gene, complete cds 2303 2303 100% 0.0 95%
EU798824.1 Influenza A virus (A/swine/Korea/Asan04/2006(H1N2)) segment 6 neuraminidase (NA) gene, complete cds 2296 2296 100% 0.0 95%
AF251428.2 Influenza A virus (A/Swine/Minnesota/593/99 (H3N2)) neuraminidase (NA) gene, complete cds 2296 2296 100% 0.0 95%
AF251412.3 Influenza A virus (A/Swine/Iowa/533/99 (H3N2)) neuraminidase (NA) gene, complete cds 2296 2296 100% 0.0 95%
AY038015.1 Influenza A virus (A/Turkey/MO/24093/99(H1N2)) neuraminidase (N2) gene, complete cds 2296 2296 100% 0.0 95%
GU135893.1 Influenza A virus (A/swine/Iowa/H03BF5/2003(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 2294 2294 99% 0.0 95%
AF268135.1 Influenza A virus (A/Swine/Illinois/21587/99(H3N2)) neuraminidase protein gene, partial cds 2292 2292 98% 0.0 95%
EU798823.1 Influenza A virus (A/swine/Korea/JL04/2005(H1N2)) segment 6 neuraminidase (NA) gene, complete cds 2288 2288 100% 0.0 95%
EU798820.1 Influenza A virus (A/swine/Korea/Hongsong2/2004(H1N2)) segment 6 neuraminidase (NA) gene, complete cds 2288 2288 100% 0.0 95%
AF251404.1 Influenza A virus (A/Swine/Nebraska/209/98 (H3N2)) neuraminidase (NA) gene, complete cds 2288 2288 100% 0.0 95%
AF153237.1 Influenza A virus (A/Swine/Texas/4199-2/98 (H3N2)) neuraminidase gene, partial cds 2288 2288 98% 0.0 95%
AF268140.1 Influenza A virus (A/Swine/Oklahoma/18089/99(H3N2)) neuraminidase protein gene, partial cds 2286 2286 98% 0.0 95%
AF268136.1 Influenza A virus (A/Swine/Oklahoma/18717/99(H3N2)) neuraminidase protein gene, partial cds 2286 2286 99% 0.0 95%
EU798821.1 Influenza A virus (A/swine/Korea/JL01/2005(H1N2)) segment 6 neuraminidase (NA) gene, complete cds 2280 2280 100% 0.0 95%
AF251420.1 Influenza A virus (A/Swine/Iowa/569/99 (H3N2)) neuraminidase (NA) gene, complete cds 2280 2280 100% 0.0 95%
AF153238.1 Influenza A virus (A/Swine/Minnesota/9088-2/98 (H3N2)) neuraminidase gene, partial cds 2280 2280 98% 0.0 95%
AY233391.1 Influenza A virus (A/duck/NC/91347/01(H1N2)) neuraminidase (NA) gene, complete cds 2272 2272 100% 0.0 95%
DQ666927.1 Influenza A virus (A/swine/Korea/S5/2005(H1N2)) segment 6 neuraminidase gene, complete cds 2256 2256 100% 0.0 95%
EF584366.1 Influenza A virus (A/Athens/23/97 (H3N2)) segment 6 neuraminidase (NA) gene, complete cds 2256 2256 100% 0.0 95%
AF455696.1 Influenza A virus (A/Swine/Indiana/P12439/00 (H1N2)) neuraminidase (NA) gene, complete cds 2254 2254 99% 0.0 95%
EU798825.1 Influenza A virus (A/swine/Korea/PZ4/2006(H1N2)) segment 6 neuraminidase (NA) gene, complete cds 2248 2248 100% 0.0 95%
CY010006.1 Influenza A virus (A/New York/563/1996(H3N2)) segment 6, complete sequence 2248 2248 100% 0.0 95%
AF533995.1 Influenza A virus (A/Buenos Aires/4459/96(H3N2)) neuraminidase (NA) gene, complete cds 2248 2248 100% 0.0 95%
AF268137.1 Influenza A virus (A/Swine/Wisconsin/14094/99(H3N2)) neuraminidase protein gene, partial cds 2242 2242 98% 0.0 95%
CY036849.1 Influenza A virus (A/Siena/1/1997(H3N2)) segment 6, complete sequence 2240 2240 100% 0.0 95%
EF584343.1 Influenza A virus (A/Bur/23/1996(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 2240 2240 100% 0.0 95%
AF533998.1 Influenza A virus (A/Buenos Aires/32/96(H3N2)) neuraminidase (NA) gene, complete cds 2240 2240 100% 0.0 95%
AF533996.1 Influenza A virus (A/Buenos Aires/4559/96(H3N2)) neuraminidase (NA) gene, complete cds 2240 2240 100% 0.0 95%
AF268139.1 Influenza A virus (A/Swine/NorthCarolina/16497/99(H3N2)) neuraminidase protein gene, partial cds 2234 2234 98% 0.0 95%
EU857298.1 Influenza A virus (A/Hong Kong/CUHK4803/1997(H3N2)) neuraminidase (NA) gene, complete cds 2232 2232 100% 0.0 94%
EU857289.1 Influenza A virus (A/Hong Kong/CUHK4245/1997(H3N2)) neuraminidase (NA) gene, complete cds 2232 2232 100% 0.0 94%
EU857169.1 Influenza A virus (A/Hong Kong/CUHK20010/1997(H3N2)) neuraminidase (NA) gene, complete cds 2232 2232 100% 0.0 94%
DQ666943.1 Influenza A virus (A/swine/Korea/S14/2006(H1N2)) segment 6 neuraminidase gene, complete cds 2232 2232 100% 0.0 94%
CY012850.1 Influenza A virus (A/New York/554/1996(H3N2)) segment 6, complete sequence 2232 2232 100% 0.0 94%
CY011418.1 Influenza A virus (A/New York/571/1996(H3N2)) segment 6, complete sequence 2232 2232 100% 0.0 94%
CY011258.1 Influenza A virus (A/New York/557/1996(H3N2)) segment 6, complete sequence 2232 2232 100% 0.0 94%
CY010798.1 Influenza A virus (A/New York/555/1996(H3N2)) segment 6, complete sequence 2232 2232 100% 0.0 94%
CY010614.1 Influenza A virus (A/New York/603/1996(H3N2)) segment 6, complete sequence 2232 2232 100% 0.0 94%
CY009494.1 Influenza A virus (A/New York/570/1996(H3N2)) segment 6, complete sequence 2232 2232 100% 0.0 94%
CY010062.1 Influenza A virus (A/New York/596/1996(H3N2)) segment 6, complete sequence 2232 2232 100% 0.0 94%
CY010014.1 Influenza A virus (A/New York/567/1996(H3N2)) segment 6, complete sequence 2232 2232 100% 0.0 94%
CY009502.1 Influenza A virus (A/New York/573/1996(H3N2)) segment 6, complete sequence 2232 2232 100% 0.0 94%
CY009486.1 Influenza A virus (A/New York/569/1997(H3N2)) segment 6, complete sequence 2232 2232 100% 0.0 94%
AF533997.1 Influenza A virus (A/Buenos Aires/4634/96(H3N2)) neuraminidase (NA) gene, complete cds 2232 2232 100% 0.0 94%
AF455693.1 Influenza A virus (A/Swine/North Carolina/93523/01 (H1N2)) neuraminidase (NA) gene, complete cds 2232 2232 100% 0.0 94%
AJ457942.1 Influenza A virus (A/South Africa/1147/96(H3N2)) NA gene for neuraminidase, genomic RNA 2232 2232 100% 0.0 94%
AF038264.1 Influenza A virus H3N2 A/Shiga/25/97 neuraminidase (NA) gene, complete cds 2232 2232 100% 0.0 94%
GQ229314.1 Influenza A virus (A/swine/Hong Kong/78/2003(H1N2)) segment 6 neuraminidase (NA) gene, complete cds 2228 2228 100% 0.0 94%
CY010054.1 Influenza A virus (A/New York/595/1996(H3N2)) segment 6, complete sequence 2226 2226 99% 0.0 94%
CY010022.1 Influenza A virus (A/New York/582/1996(H3N2)) segment 6, complete sequence 2226 2226 99% 0.0 94%
EU798826.1 Influenza A virus (A/swine/Korea/PZ7/2006(H1N2)) segment 6 neuraminidase (NA) gene, complete cds 2224 2224 100% 0.0 94%
EU857297.1 Influenza A virus (A/Hong Kong/CUHK4622/1997(H3N2)) neuraminidase (NA) gene, complete cds 2224 2224 100% 0.0 94%
EU857296.1 Influenza A virus (A/Hong Kong/CUHK4542/1997(H3N2)) neuraminidase (NA) gene, complete cds 2224 2224 100% 0.0 94%
EU857182.1 Influenza A virus (A/Hong Kong/CUHK20731/1997(H3N2)) neuraminidase (NA) gene, complete cds 2224 2224 100% 0.0 94%
EU857130.1 Influenza A virus (A/Hong Kong/CUHK12626/1997(H3N2)) neuraminidase (NA) gene, complete cds 2224 2224 100% 0.0 94%
DQ666946.1 Influenza A virus (A/swine/Korea/S15/2006(H1N2)) segment 6 neuraminidase gene, complete cds 2224 2224 100% 0.0 94%
DQ666935.1 Influenza A virus (A/swine/Korea/S11/2005(H1N2)) segment 6 neuraminidase gene, complete cds 2224 2224 100% 0.0 94%
EF584375.1 Influenza A virus (A/Brazil/97/1997(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 2224 2224 100% 0.0 94%
EF584360.1 Influenza A virus (A/Moscow/41/1997(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 2224 2224 100% 0.0 94%
CY015518.1 Influenza A virus (A/New York/601/1996(H3N2)) segment 6, complete sequence 2224 2224 100% 0.0 94%
CY011426.1 Influenza A virus (A/New York/577/1996(H3N2)) segment 6, complete sequence 2224 2224 100% 0.0 94%
CY011266.1 Influenza A virus (A/New York/559/1996(H3N2)) segment 6, complete sequence 2224 2224 100% 0.0 94%
CY010030.1 Influenza A virus (A/New York/591/1996(H3N2)) segment 6, complete sequence 2224 2224 100% 0.0 94%
CY009710.1 Influenza A virus (A/New York/586/1996(H3N2)) segment 6, complete sequence 2224 2224 100% 0.0 94%
CY009662.1 Influenza A virus (A/New York/568/1996(H3N2)) segment 6, complete sequence 2224 2224 100% 0.0 94%
CY008926.1 Influenza A virus (A/New York/504/1998(H3N2)) segment 6, complete sequence 2224 2224 100% 0.0 94%
CY008974.1 Influenza A virus (A/New York/549/1998(H3N2)) segment 6, complete sequence 2224 2224 100% 0.0 94%
CY008182.1 Influenza A virus (A/New York/502/1998(H3N2)) segment 6, complete sequence 2224 2224 100% 0.0 94%
AF250126.1 Influenza A virus (A/Swine/Indiana/9K035/99 (H1N2)) neuraminidase (NA) gene, complete cds 2224 2224 100% 0.0 94%
CY006269.1 Influenza A virus (A/New York/513/1997(H3N2)) segment 6, complete sequence 2224 2224 100% 0.0 94%
CY006261.1 Influenza A virus (A/New York/511/1997(H3N2)) segment 6, complete sequence 2224 2224 100% 0.0 94%
CY006253.1 Influenza A virus (A/New York/510/1998(H3N2)) segment 6, complete sequence 2224 2224 100% 0.0 94%
CY006533.1 Influenza A virus (A/New York/525/1998(H3N2)) segment 6, complete sequence 2224 2224 100% 0.0 94%
CY006629.1 Influenza A virus (A/New York/547/1997(H3N2)) segment 6, complete sequence 2224 2224 100% 0.0 94%
CY006605.1 Influenza A virus (A/New York/543/1998(H3N2)) segment 6, complete sequence 2224 2224 100% 0.0 94%
CY006549.1 Influenza A virus (A/New York/531/1998(H3N2)) segment 6, complete sequence 2224 2224 100% 0.0 94%
CY006525.1 Influenza A virus (A/New York/524/1997(H3N2)) segment 6, complete sequence 2224 2224 100% 0.0 94%
CY006485.1 Influenza A virus (A/New York/519/1998(H3N2)) segment 6, complete sequence 2224 2224 100% 0.0 94%
CY006469.1 Influenza A virus (A/New York/516/1997(H3N2)) segment 6, complete sequence 2224 2224 100% 0.0 94%
CY006245.1 Influenza A virus (A/New York/508/1997(H3N2)) segment 6, complete sequence 2224 2224 100% 0.0 94%
CY006229.1 Influenza A virus (A/New York/503/1997(H3N2)) segment 6, complete sequence 2224 2224 100% 0.0 94%
AF153239.1 Influenza A virus (A/Swine/Iowa/8548-1/98) neuraminidase gene, partial cds 2224 2224 98% 0.0 95%
EU139841.1 Influenza A virus (A/swine/Kansas/00246/2004(H1N2)) neuraminidase (NA) gene, partial cds 2222 2222 95% 0.0 95%
CY010606.1 Influenza A virus (A/New York/561/1996(H3N2)) segment 6, complete sequence 2218 2218 99% 0.0 94%
EU857293.1 Influenza A virus (A/Hong Kong/CUHK4391/1997(H3N2)) neuraminidase (NA) gene, complete cds 2216 2216 100% 0.0 94%
EU857212.1 Influenza A virus (A/Hong Kong/CUHK22736/1997(H3N2)) neuraminidase (NA) gene, complete cds 2216 2216 100% 0.0 94%
EU857180.1 Influenza A virus (A/Hong Kong/CUHK20320/1997(H3N2)) neuraminidase (NA) gene, complete cds 2216 2216 100% 0.0 94%
EU857176.1 Influenza A virus (A/Hong Kong/CUHK20236/1997(H3N2)) neuraminidase (NA) gene, complete cds 2216 2216 100% 0.0 94%
EU857175.1 Influenza A virus (A/Hong Kong/CUHK20217/1997(H3N2)) neuraminidase (NA) gene, complete cds 2216 2216 100% 0.0 94%
EU857107.1 Influenza A virus (A/Hong Kong/CUHK10632/1998(H3N2)) neuraminidase (NA) gene, complete cds 2216 2216 100% 0.0 94%

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Tue Mar 08, 2011 1:56 pm 
Online

Joined: Wed Aug 19, 2009 10:42 am
Posts: 27289
Location: Pittsburgh, PA USA
Top 100 PB2 matches

CY086877.1 Influenza A virus (A/swine/Indiana/240218/2010(H1N2)) polymerase PB2 (PB2) gene, complete cds 4587 4587 100% 0.0 100%
HQ011415.1 Influenza A virus (A/Guangdong/45/2009(H1N1)) segment 1 polymerase PB2 (PB2) gene, complete cds 4555 4555 100% 0.0 99%
CY060707.1 Influenza A virus (A/Ontario/315637/2009(H1N1)) segment 1 sequence 4555 4555 100% 0.0 99%
CY060691.1 Influenza A virus (A/Ontario/315187/2009(H1N1)) segment 1 sequence 4555 4555 100% 0.0 99%
CY060659.1 Influenza A virus (A/Ontario/315015/2009(H1N1)) segment 1 sequence 4555 4555 100% 0.0 99%
CY060603.1 Influenza A virus (A/Ontario/308054/2009(H1N1)) segment 1 sequence 4555 4555 100% 0.0 99%
CY060587.1 Influenza A virus (A/Ontario/305139/2009(H1N1)) segment 1 sequence 4555 4555 100% 0.0 99%
CY060515.1 Influenza A virus (A/Ontario/222656/2009(H1N1)) segment 1 sequence 4555 4555 100% 0.0 99%
GQ288369.1 Influenza A virus (A/Fuzhou/01/2009(H1N1)) segment 1 polymerase PB2 (PB2) gene, complete cds 4549 4549 99% 0.0 99%
GQ132137.1 Influenza A virus (A/Canada-ON/RV1526/2009(H1N1)) segment 1 polymerase PB2 (PB2) gene, complete cds 4549 4549 99% 0.0 99%
CY060699.1 Influenza A virus (A/Ontario/315613/2009(H1N1)) segment 1 sequence 4548 4548 100% 0.0 99%
CY060627.1 Influenza A virus (A/Ontario/314095/2009(H1N1)) segment 1 sequence 4548 4548 100% 0.0 99%
CY060579.1 Influenza A virus (A/Ontario/304434/2009(H1N1)) segment 1 sequence 4548 4548 100% 0.0 99%
CY055300.1 Influenza A virus (A/Singapore/GN285/2009(H1N1)) segment 1 sequence 4548 4548 100% 0.0 99%
CY049377.1 Influenza A virus (A/Singapore/ON442/2009(H1N1)) segment 1 sequence 4548 4548 100% 0.0 99%
CY045951.1 Influenza A virus (A/Toronto/T0106/2009(H1N1)) segment 1 sequence 4548 4548 100% 0.0 99%
CY060619.1 Influenza A virus (A/Ontario/313762/2009(H1N1)) segment 1 sequence 4546 4546 99% 0.0 99%
CY060523.1 Influenza A virus (A/Ontario/235657/2009(H1N1)) segment 1 sequence 4544 4544 99% 0.0 99%
CY049113.1 Influenza A virus (A/Singapore/ON923/2009(H1N1)) segment 1 sequence 4544 4544 99% 0.0 99%
GQ866917.1 Influenza A virus (A/Thailand/CU-H276/2009(H1N1)) segment 1 polymerase PB2 (PB2) gene, complete cds 4544 4544 100% 0.0 99%
GQ328865.1 Influenza A virus (A/Finland/553/2009(H1N1)) segment 1 polymerase PB2 (PB2) gene, complete cds 4544 4544 99% 0.0 99%
HQ664706.1 Influenza A virus (A/Taiwan/14/2009(H1N1)) segment 1 polymerase PB2 (PB2) gene, complete cds 4540 4540 100% 0.0 99%
CY076792.1 Influenza A virus (A/Ontario/156785/2009(H1N1)) segment 1 sequence 4540 4540 100% 0.0 99%
CY076784.1 Influenza A virus (A/Ontario/152846/2009(H1N1)) segment 1 sequence 4540 4540 100% 0.0 99%
CY076776.1 Influenza A virus (A/Ontario/152439/2009(H1N1)) segment 1 sequence 4540 4540 100% 0.0 99%
CY076760.1 Influenza A virus (A/Ontario/147265/2009(H1N1)) segment 1 sequence 4540 4540 100% 0.0 99%
GU480807.1 Influenza A virus (A/Hamburg/NY1580/2009(H1N1)) segment 1 polymerase PB2 (PB2) gene, complete cds 4540 4540 100% 0.0 99%
CY060611.1 Influenza A virus (A/Ontario/309862/2009(H1N1)) segment 1 sequence 4540 4540 100% 0.0 99%
CY060563.1 Influenza A virus (A/Ontario/296008/2009(H1N1)) segment 1 sequence 4540 4540 100% 0.0 99%
CY053749.1 Influenza A virus (A/Russia/200/2009(H1N1)) segment 1 sequence 4540 4540 100% 0.0 99%
CY049057.1 Influenza A virus (A/Singapore/ON305/2009(H1N1)) segment 1 sequence 4540 4540 100% 0.0 99%
GU108483.2 Influenza A virus (A/Zhejiang-Yiwu/11/2009(H1N1)) segment 1 polymerase PB2 (PB2) gene, complete cds 4540 4540 100% 0.0 99%
CY047741.1 Influenza A virus (A/Taiwan/526/2009(H1N1)) segment 1 sequence 4540 4540 100% 0.0 99%
CY046940.1 Influenza A virus (A/Netherlands/602/2009(H1N1)) segment 1 sequence 4540 4540 100% 0.0 99%
CY045231.1 Influenza A virus (A/Taiwan/126/2009(H1N1)) segment 1 sequence 4540 4540 100% 0.0 99%
CY045967.1 Influenza A virus (A/Toronto/T5362/2009(H1N1)) segment 1 sequence 4540 4540 100% 0.0 99%
CY045959.1 Influenza A virus (A/Toronto/T5294/2009(H1N1)) segment 1 sequence 4540 4540 100% 0.0 99%
GQ411904.1 Influenza A virus (A/Toronto/T5308/2009(H1N1)) segment 1 polymerase PB2 (PB2) gene, complete cds 4540 4540 100% 0.0 99%
GQ373259.1 Influenza A virus (A/Toronto/3141/2009(H1N1)) segment 1 polymerase PB2 (PB2) gene, complete cds 4540 4540 100% 0.0 99%
CY060643.1 Influenza A virus (A/Ontario/314603/2009(H1N1)) segment 1 sequence 4538 4538 99% 0.0 99%
GQ166207.1 Influenza A virus (A/Hamburg/4/2009(H1N1)) segment 1 polymerase PB2 (PB2) gene, complete cds 4538 4538 99% 0.0 99%
GQ251032.1 Influenza A virus (A/Italy/05/2009(H1N1)) segment 1 polymerase PB2 (PB2) gene, complete cds 4536 4536 99% 0.0 99%
CY060675.1 Influenza A virus (A/Ontario/315107/2009(H1N1)) segment 1 sequence 4534 4534 99% 0.0 99%
HQ728099.1 Influenza A virus (A/swine/Taiwan/PT-1204/2009(H1N1)) segment 1 polymerase PB2 (PB2) gene, complete cds 4532 4532 100% 0.0 99%
HQ728091.1 Influenza A virus (A/swine/Taiwan/HL-1125/2009(H1N1)) segment 1 polymerase PB2 (PB2) gene, complete cds 4532 4532 100% 0.0 99%
CY063785.1 Influenza A virus (A/Singapore/ON1868/2009(H1N1)) segment 1 sequence 4532 4532 100% 0.0 99%
CY063751.1 Influenza A virus (A/Singapore/GP3084/2009(H1N1)) segment 1 sequence 4532 4532 100% 0.0 99%
HM241701.1 Influenza A virus (A/Jalna/NIV9436/2009(H1N1)) segment 1 polymerase PB2 (PB2) gene, complete cds 4532 4532 100% 0.0 99%
CY060747.1 Influenza A virus (A/Ontario/9739/2009(H1N1)) segment 1 sequence 4532 4532 100% 0.0 99%
CY060739.1 Influenza A virus (A/Ontario/9698/2009(H1N1)) segment 1 sequence 4532 4532 100% 0.0 99%
CY060683.1 Influenza A virus (A/Ontario/315181/2009(H1N1)) segment 1 sequence 4532 4532 100% 0.0 99%
CY060651.1 Influenza A virus (A/Ontario/315003/2009(H1N1)) segment 1 sequence 4532 4532 100% 0.0 99%
CY060555.1 Influenza A virus (A/Ontario/26184/2009(H1N1)) segment 1 sequence 4532 4532 100% 0.0 99%
CY060539.1 Influenza A virus (A/Ontario/25389/2009(H1N1)) segment 1 sequence 4532 4532 100% 0.0 99%
CY054659.1 Influenza A virus (A/Russia/100/2009(H1N1)) segment 1 sequence 4532 4532 100% 0.0 99%
GQ866956.2 Influenza A virus (A/Thailand/CU-H9/2009(H1N1)) segment 1 polymerase PB2 (PB2) gene, complete cds 4532 4532 100% 0.0 99%
GQ332640.1 Influenza A virus (A/New York/1682-WC_RG1/2009(H1N1)) segment 1 polymerase PB2 (PB2) gene, complete cds 4532 4532 100% 0.0 99%
CY045975.1 Influenza A virus (A/Toronto/T9842/2009(H1N1)) segment 1 sequence 4532 4532 100% 0.0 99%
GQ464405.1 Influenza A virus (A/Catalonia/63/2009(H1N1)) segment 1 polymerase PB2 (PB2) gene, complete cds 4532 4532 100% 0.0 99%
GQ214155.1 Influenza A virus (A/Paris/2573/2009(H1N1)) segment 1 polymerase PB2 (PB2) gene, complete cds 4532 4532 100% 0.0 99%
GQ205443.1 Influenza A virus (A/Thailand/104/2009(H1N1)) segment 1 polymerase PB2 (PB2) gene, complete cds 4532 4532 100% 0.0 99%
CY060715.1 Influenza A virus (A/Ontario/320266/2009(H1N1)) segment 1 sequence 4530 4530 99% 0.0 99%
GU433040.1 Influenza A virus (A/Novosibirsk/02/2009(H1N1)) segment 1 polymerase PB2 (PB2) gene, complete cds 4530 4530 99% 0.0 99%
GQ375281.1 Influenza A virus (A/Moscow/03/2009(H1N1)) segment 1 polymerase PB2 (PB2) gene, complete cds 4530 4530 99% 0.0 99%
GQ247731.1 Influenza A virus (A/Moscow/IIV02/2009(H1N1)) segment 1 polymerase PB2 (PB2) gene, complete cds 4530 4530 99% 0.0 99%
CY060499.1 Influenza A virus (A/Ontario/10016/2009(H1N1)) segment 1 sequence 4528 4528 100% 0.0 99%
CY057509.1 Influenza A virus (A/Wisconsin/629-D00565/2009(H1N1)) segment 1, complete sequence 4528 4528 99% 0.0 99%
CY057501.1 Influenza A virus (A/Wisconsin/629-D00287/2009(H1N1)) segment 1, complete sequence 4528 4528 99% 0.0 99%
CY057405.1 Influenza A virus (A/Wisconsin/629-D01469/2009(H1N1)) segment 1, complete sequence 4528 4528 99% 0.0 99%
GQ328867.1 Influenza A virus (A/Finland/554/2009(H1N1)) segment 1 polymerase PB2 (PB2) gene, complete cds 4528 4528 99% 0.0 99%
CY083941.1 Influenza A virus (A/Warsaw/INS149/2009(H1N1)) polymerase PB2 (PB2) gene, complete cds 4526 4526 99% 0.0 99%
CY060667.1 Influenza A virus (A/Ontario/315047/2009(H1N1)) segment 1 sequence 4526 4526 99% 0.0 99%
CY045943.1 Influenza A virus (A/Toronto/C2781/2009(H1N1)) segment 1 sequence 4526 4526 99% 0.0 99%
CY045935.1 Influenza A virus (A/Toronto/C0270/2009(H1N1)) segment 1 sequence 4526 4526 99% 0.0 99%
GQ502903.1 Influenza A virus (A/Toronto/R8557/2009(H1N1)) segment 1 polymerase PB2 (PB2) gene, complete cds 4526 4526 99% 0.0 99%
GQ330652.1 Influenza A virus (A/Moscow/IIV03/2009(H1N1)) segment 1 polymerase PB2 (PB2) gene, complete cds 4526 4526 99% 0.0 99%
HQ728107.1 Influenza A virus (A/swine/Taiwan/CH-1204/2009(H1N1)) segment 1 polymerase PB2 (PB2) gene, complete cds 4524 4524 100% 0.0 99%
CY076752.1 Influenza A virus (A/Ontario/142358/2009(H1N1)) segment 1 sequence 4524 4524 100% 0.0 99%
CY060731.1 Influenza A virus (A/Ontario/35273/2009(H1N1)) segment 1 sequence 4524 4524 100% 0.0 99%
CY060723.1 Influenza A virus (A/Ontario/328474/2009(H1N1)) segment 1 sequence 4524 4524 100% 0.0 99%
CY060547.1 Influenza A virus (A/Ontario/25913/2009(H1N1)) segment 1 sequence 4524 4524 100% 0.0 99%
CY060531.1 Influenza A virus (A/Ontario/237882/2009(H1N1)) segment 1 sequence 4524 4524 100% 0.0 99%
HM014331.1 Influenza A virus (A/Guangzhou/GIRD07/2009(H1N1)) segment 1 polymerase PB2 (PB2) gene, complete cds 4524 4524 100% 0.0 99%
CY054667.1 Influenza A virus (A/Russia/171/2009(H1N1)) segment 1 sequence 4524 4524 100% 0.0 99%
CY054635.1 Influenza A virus (A/Russia/12/2009(H1N1)) segment 1 sequence 4524 4524 100% 0.0 99%
CY053741.1 Influenza A virus (A/Russia/190/2009(H1N1)) segment 1 sequence 4524 4524 100% 0.0 99%
CY053733.1 Influenza A virus (A/Russia/178/2009(H1N1)) segment 1 sequence 4524 4524 100% 0.0 99%
CY049065.1 Influenza A virus (A/Singapore/ON129/2009(H1N1)) segment 1 sequence 4524 4524 99% 0.0 99%
CY045479.1 Influenza A virus (A/Sachsen-Anhalt/101/2009(H1N1)) segment 1 sequence 4524 4524 100% 0.0 99%
CY083676.1 Influenza A virus (A/San Diego/INS62/2009(H1N1)) polymerase PB2 (PB2) gene, complete cds 4522 4522 99% 0.0 99%
CY081509.1 Influenza A virus (A/Cambodia/NHRCC00003/2009(H1N1)) polymerase PB2 (PB2) gene, complete cds 4522 4522 99% 0.0 99%
CY076768.1 Influenza A virus (A/Ontario/147723/2009(H1N1)) segment 1 sequence 4522 4522 99% 0.0 99%
GQ219589.1 Influenza A virus (A/Moscow/IIV01/2009(H1N1)) segment 1 polymerase PB2 (PB2) gene, complete cds 4522 4522 99% 0.0 99%
CY058627.1 Influenza A virus (A/Wisconsin/629-S1433/2009(H1N1)) segment 1, complete sequence 4520 4520 99% 0.0 99%
CY057565.1 Influenza A virus (A/Wisconsin/629-D00690/2009(H1N1)) segment 1, complete sequence 4520 4520 99% 0.0 99%
CY057477.1 Influenza A virus (A/Wisconsin/629-D00402/2009(H1N1)) segment 1, complete sequence 4520 4520 99% 0.0 99%
CY057429.1 Influenza A virus (A/Wisconsin/629-D00485/2009(H1N1)) segment 1, complete sequence 4520 4520 99% 0.0 99%
CY057413.1 Influenza A virus (A/Wisconsin/629-D00832/2009(H1N1)) segment 1, complete sequence 4520 4520 99% 0.0 99%
CY083901.1 Influenza A virus (A/San Diego/INS73/2009(H1N1)) polymerase PB2 (PB2) gene, complete cds 4518 4518 99% 0.0 99%
CY053686.1 Influenza A virus (A/Russia/191/2009(H1N1)) segment 1 sequence 4518 4518 100% 0.0 99%

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Tue Mar 08, 2011 1:57 pm 
Online

Joined: Wed Aug 19, 2009 10:42 am
Posts: 27289
Location: Pittsburgh, PA USA
Top 100 PB1 matches

CY086878.1 Influenza A virus (A/swine/Indiana/240218/2010(H1N2)) polymerase PB1 (PB1) gene, complete cds; and PB1-F2 gene, complete sequence 4593 4593 100% 0.0 100%
CY053625.1 Influenza A virus (A/Russia/165/2009(H1N1)) segment 2 sequence 4530 4530 100% 0.0 99%
CY046941.1 Influenza A virus (A/Netherlands/602/2009(H1N1)) segment 2 sequence 4530 4530 100% 0.0 99%
CY045232.1 Influenza A virus (A/Taiwan/126/2009(H1N1)) segment 2 sequence 4530 4530 100% 0.0 99%
CY054676.1 Influenza A virus (A/Russia/180/2009(H1N1)) segment 2 sequence 4526 4526 99% 0.0 99%
CY060676.1 Influenza A virus (A/Ontario/315107/2009(H1N1)) segment 2 sequence 4524 4524 99% 0.0 99%
CY060612.1 Influenza A virus (A/Ontario/309862/2009(H1N1)) segment 2 sequence 4524 4524 99% 0.0 99%
CY063778.1 Influenza A virus (A/Singapore/ON0801/2009(H1N1)) segment 2 sequence 4522 4522 100% 0.0 99%
HM014330.1 Influenza A virus (A/Guangzhou/GIRD07/2009(H1N1)) segment 2 polymerase PB1 (PB1) gene, complete cds; and nonfunctional PB1-F2 protein (PB1-F2) gene, complete sequence 4522 4522 100% 0.0 99%
CY055301.1 Influenza A virus (A/Singapore/GN285/2009(H1N1)) segment 2 sequence 4522 4522 100% 0.0 99%
CY054636.1 Influenza A virus (A/Russia/12/2009(H1N1)) segment 2 sequence 4522 4522 100% 0.0 99%
GQ259597.1 Influenza A virus (A/Thailand/104/2009(H1N1)) segment 2 polymerase PB1 (PB1) gene, complete cds; and nonfunctional PB1-F2 protein (PB1-F2) gene, complete sequence 4522 4522 100% 0.0 99%
CY054668.1 Influenza A virus (A/Russia/171/2009(H1N1)) segment 2 sequence 4518 4518 99% 0.0 99%
CY060716.1 Influenza A virus (A/Ontario/320266/2009(H1N1)) segment 2 sequence 4516 4516 99% 0.0 99%
CY060684.1 Influenza A virus (A/Ontario/315181/2009(H1N1)) segment 2 sequence 4516 4516 99% 0.0 99%
CY060620.1 Influenza A virus (A/Ontario/313762/2009(H1N1)) segment 2 sequence 4516 4516 99% 0.0 99%
CY060580.1 Influenza A virus (A/Ontario/304434/2009(H1N1)) segment 2 sequence 4516 4516 99% 0.0 99%
HQ728100.1 Influenza A virus (A/swine/Taiwan/PT-1204/2009(H1N1)) segment 2 polymerase PB1 (PB1) gene, complete cds 4514 4514 100% 0.0 99%
HQ728092.1 Influenza A virus (A/swine/Taiwan/HL-1125/2009(H1N1)) segment 2 polymerase PB1 (PB1) gene, complete cds 4514 4514 100% 0.0 99%
CY064789.2 Influenza A virus (A/Guangdong/SB1/2009(H1N1)) segment 2 sequence 4514 4514 100% 0.0 99%
CY063752.1 Influenza A virus (A/Singapore/GP3084/2009(H1N1)) segment 2 sequence 4514 4514 100% 0.0 99%
GU189655.1 Influenza A virus (A/Zhejiang/DTID-ZJU03/2009(H1N1)) segment 2 polymerase PB1 (PB1) gene, complete cds; and nonfunctional PB1-F2 protein (PB1-F2) gene, complete sequence 4514 4514 100% 0.0 99%
GU112096.1 Influenza A virus (A/Zhejiang/DTID-ZJU02/2009(H1N1)) segment 2 polymerase PB1 (PB1) gene, complete cds; and nonfunctional PB1-F2 protein (PB1-F2) gene, complete sequence 4514 4514 100% 0.0 99%
CY040040.1 Influenza A virus (A/Nonthaburi/102/2009(H1N1)) segment 2 sequence 4514 4514 100% 0.0 99%
CY045952.1 Influenza A virus (A/Toronto/T0106/2009(H1N1)) segment 2 sequence 4512 4512 99% 0.0 99%
GQ866957.1 Influenza A virus (A/Thailand/CU-H9/2009(H1N1)) segment 2 polymerase PB1 (PB1) gene, complete cds; and nonfunctional PB1-F2 protein (PB1-F2) gene, complete sequence 4510 4510 99% 0.0 99%
CY076793.1 Influenza A virus (A/Ontario/156785/2009(H1N1)) segment 2 sequence 4508 4508 99% 0.0 99%
CY076785.1 Influenza A virus (A/Ontario/152846/2009(H1N1)) segment 2 sequence 4508 4508 99% 0.0 99%
CY076777.1 Influenza A virus (A/Ontario/152439/2009(H1N1)) segment 2 sequence 4508 4508 99% 0.0 99%
CY076769.1 Influenza A virus (A/Ontario/147723/2009(H1N1)) segment 2 sequence 4508 4508 99% 0.0 99%
CY060692.1 Influenza A virus (A/Ontario/315187/2009(H1N1)) segment 2 sequence 4508 4508 99% 0.0 99%
CY060652.1 Influenza A virus (A/Ontario/315003/2009(H1N1)) segment 2 sequence 4508 4508 99% 0.0 99%
CY060524.1 Influenza A virus (A/Ontario/235657/2009(H1N1)) segment 2 sequence 4508 4508 99% 0.0 99%
CY063786.1 Influenza A virus (A/Singapore/ON1868/2009(H1N1)) segment 2 sequence 4506 4506 100% 0.0 99%
CY061795.1 Influenza A virus (A/swine/Hong Kong/2995/2009(H1N1)) segment 2 sequence 4506 4506 99% 0.0 99%
CY054660.1 Influenza A virus (A/Russia/100/2009(H1N1)) segment 2 sequence 4506 4506 100% 0.0 99%
GQ332641.1 Influenza A virus (A/New York/1682-WC_RG1/2009(H1N1)) segment 2 polymerase PB1 (PB1) gene, complete cds; and nonfunctional PB1-F2 protein (PB1-F2) gene, complete sequence 4506 4506 100% 0.0 99%
GQ288370.1 Influenza A virus (A/Fuzhou/01/2009(H1N1)) segment 2 polymerase PB1 (PB1) gene, complete cds; and nonfunctional PB1-F2 protein (PB1-F2) gene, complete sequence 4506 4506 99% 0.0 99%
GQ251033.1 Influenza A virus (A/Italy/05/2009(H1N1)) segment 2 polymerase PB1 (PB1) gene, complete cds; and nonfunctional PB1-F2 protein (PB1-F2) gene, complete sequence 4506 4506 100% 0.0 99%
GQ223442.1 Influenza A virus (A/GuangzhouSB/01/2009(H1N1)) segment 2 polymerase PB1 (PB1) gene, complete cds; and nonfunctional PB1-F2 protein (PB1-F2) gene, complete sequence 4506 4506 100% 0.0 99%
CY076761.1 Influenza A virus (A/Ontario/147265/2009(H1N1)) segment 2 sequence 4504 4504 99% 0.0 99%
GU562464.1 Influenza A virus (A/Karasuk/01/2010(H1N1)) segment 2 polymerase PB1 (PB1) gene, complete cds; and nonfunctional PB1-F2 protein (PB1-F2) gene, complete sequence 4504 4504 99% 0.0 99%
GU562456.1 Influenza A virus (A/Perm/01/2009(H1N1)) segment 2 polymerase PB1 (PB1) gene, complete cds; and nonfunctional PB1-F2 protein (PB1-F2) gene, complete sequence 4504 4504 99% 0.0 99%
GU433039.1 Influenza A virus (A/Novosibirsk/02/2009(H1N1)) segment 2 polymerase PB1 (PB1) gene, complete cds; and PB1-F2 gene, complete sequence 4504 4504 99% 0.0 99%
GU211241.1 Influenza A virus (A/Omsk/02/2009(H1N1)) segment 2 polymerase PB1 (PB1) gene, complete cds; and nonfunctional PB1-F2 protein (PB1-F2) gene, complete sequence 4504 4504 99% 0.0 99%
GQ375282.1 Influenza A virus (A/Moscow/03/2009(H1N1)) segment 2 polymerase PB1 (PB1) gene, complete cds; and nonfunctional PB1-F2 protein (PB1-F2) gene, complete sequence 4504 4504 99% 0.0 99%
GQ330651.1 Influenza A virus (A/Moscow/IIV03/2009(H1N1)) segment 2 polymerase PB1 (PB1) gene, complete cds; and nonfunctional PB1-F2 protein (PB1-F2) gene, complete sequence 4504 4504 99% 0.0 99%
GQ219590.1 Influenza A virus (A/Moscow/IIV01/2009(H1N1)) segment 2 polymerase PB1 (PB1) gene, complete cds; and nonfunctional PB1-F2 protein (PB1-F2) gene, complete sequence 4504 4504 99% 0.0 99%
CY072444.1 Influenza A virus (A/Athens/INS338/2009(H1N1)) segment 2, complete sequence 4502 4502 99% 0.0 99%
CY072404.1 Influenza A virus (A/Athens/INS333/2009(H1N1)) segment 2, complete sequence 4502 4502 99% 0.0 99%
CY065790.1 Influenza A virus (A/Netherlands/2629/2009(H1N1)) segment 2, complete sequence 4502 4502 99% 0.0 99%
CY057476.1 Influenza A virus (A/Wisconsin/629-D00402/2009(H1N1)) segment 2, complete sequence 4502 4502 99% 0.0 99%
CY045929.1 Influenza A virus (A/Toronto/3184/2009(H1N1)) segment 2 sequence 4502 4502 99% 0.0 99%
CY045480.1 Influenza A virus (A/Sachsen-Anhalt/101/2009(H1N1)) segment 2 sequence 4502 4502 99% 0.0 99%
GQ502904.1 Influenza A virus (A/Toronto/R8557/2009(H1N1)) segment 2 polymerase PB1 (PB1) gene, complete cds; and nonfunctional PB1-F2 protein (PB1-F2) gene, complete sequence 4502 4502 99% 0.0 99%
GQ373260.1 Influenza A virus (A/Toronto/3141/2009(H1N1)) segment 2 polymerase PB1 (PB1) gene, complete cds; and nonfunctional PB1-F2 protein (PB1-F2) gene, complete sequence 4502 4502 99% 0.0 99%
CY040756.1 Influenza A virus (A/New York/3243/2009(H1N1)) segment 2, complete sequence 4502 4502 99% 0.0 99%
CY041080.1 Influenza A virus (A/New York/3170/2009(H1N1)) segment 2, complete sequence 4502 4502 99% 0.0 99%
CY076753.1 Influenza A virus (A/Ontario/142358/2009(H1N1)) segment 2 sequence 4500 4500 99% 0.0 99%
CY061787.1 Influenza A virus (A/swine/Hong Kong/2974/2009(H1N1)) segment 2 sequence 4500 4500 99% 0.0 99%
CY061763.1 Influenza A virus (A/swine/Hong Kong/2885/2009(H1N1)) segment 2 sequence 4500 4500 99% 0.0 99%
CY049058.1 Influenza A virus (A/Singapore/ON305/2009(H1N1)) segment 2 sequence 4500 4500 99% 0.0 99%
GQ385298.1 Influenza A virus (A/Toronto/0462/2009(H1N1)) segment 2 polymerase PB1 (PB1) gene, complete cds; and nonfunctional PB1-F2 protein (PB1-F2) gene, complete sequence 4500 4500 99% 0.0 99%
CY083704.1 Influenza A virus (A/Warsaw/INS99/2009(mixed)) polymerase PB1 (PB1) gene, complete cds; and PB1-F2 gene, complete sequence 4498 4498 99% 0.0 99%
HQ011416.1 Influenza A virus (A/Guangdong/45/2009(H1N1)) segment 2 polymerase PB1 (PB1) gene, complete cds; and nonfunctional PB1-F2 protein (PB1-F2) gene, complete sequence 4498 4498 100% 0.0 99%
HQ011409.1 Influenza A virus (A/Guangdong/01/2009(H1N1)) segment 2 polymerase PB1 (PB1) gene, complete cds; and nonfunctional PB1-F2 protein (PB1-F2) gene, complete sequence 4498 4498 100% 0.0 99%
CY060564.1 Influenza A virus (A/Ontario/296008/2009(H1N1)) segment 2 sequence 4498 4498 99% 0.0 99%
CY054652.1 Influenza A virus (A/Russia/61/2009(H1N1)) segment 2 sequence 4498 4498 100% 0.0 99%
CY053750.1 Influenza A virus (A/Russia/200/2009(H1N1)) segment 2 sequence 4498 4498 100% 0.0 99%
CY061747.1 Influenza A virus (A/swine/Hong Kong/NS1809/2009(H1N1)) segment 2 sequence 4496 4496 99% 0.0 99%
GU592903.1 Influenza A virus (A/Bishkek/03/2009(H1N1)) segment 2 polymerase PB1 (PB1) gene, complete cds; and nonfunctional PB1-F2 protein (PB1-F2) gene, complete sequence 4496 4496 99% 0.0 99%
GU592895.1 Influenza A virus (A/Barnaul/04/2009(H1N1)) segment 2 polymerase PB1 (PB1) gene, complete cds; and nonfunctional PB1-F2 protein (PB1-F2) gene, complete sequence 4496 4496 99% 0.0 99%
GU433031.1 Influenza A virus (A/Tomsk/03/2009(H1N1)) segment 2 polymerase PB1 (PB1) gene, complete cds; and PB1-F2 gene, complete sequence 4496 4496 99% 0.0 99%
CY053414.1 Influenza A virus (A/Russia/149/2009(H1N1)) segment 2 sequence 4496 4496 99% 0.0 99%
CY050148.1 Influenza A virus (A/Wisconsin/629-D01058/2009(H1N1)) segment 2, complete sequence 4496 4496 99% 0.0 99%
CY046409.1 Influenza A virus (A/Wisconsin/629-D00807/2009(H1N1)) segment 2, complete sequence 4496 4496 99% 0.0 99%
GQ866920.1 Influenza A virus (A/Thailand/CU-H106/2009(H1N1)) segment 2 polymerase PB1 (PB1) gene, complete cds; and nonfunctional PB1-F2 protein (PB1-F2) gene, complete sequence 4496 4496 99% 0.0 99%
GQ496137.1 Influenza A virus (A/Moscow/IIV05/2009(H1N1)) segment 2 polymerase PB1 (PB1) gene, complete cds; and nonfunctional PB1-F2 protein (PB1-F2) gene, complete sequence 4496 4496 99% 0.0 99%
GQ392018.1 Influenza A virus (A/Moscow/IIV04/2009(H1N1)) segment 2 polymerase PB1 (PB1) gene, complete cds; and nonfunctional PB1-F2 protein (PB1-F2) gene, complete sequence 4496 4496 99% 0.0 99%
GQ247730.1 Influenza A virus (A/Moscow/IIV02/2009(H1N1)) segment 2 polymerase PB1 (PB1) gene, complete cds; and nonfunctional PB1-F2 protein (PB1-F2) gene, complete sequence 4496 4496 99% 0.0 99%
CY086975.1 Influenza A virus (A/New York/3198/2009(H1N1)) polymerase PB1 (PB1) gene, complete cds; and PB1-F2 gene, complete sequence 4494 4494 99% 0.0 99%
CY040723.2 Influenza A virus (A/New York/3238/2009(H1N1)) polymerase PB1 (PB1) gene, complete cds; and PB1-F2 gene, complete sequence 4494 4494 99% 0.0 99%
CY075506.1 Influenza A virus (A/Boston/591/2009(H1N1)) segment 2, complete sequence 4494 4494 99% 0.0 99%
CY075473.1 Influenza A virus (A/Chile/4438/2009(H1N1)) segment 2, complete sequence 4494 4494 99% 0.0 99%
CY075457.1 Influenza A virus (A/Chile/4257/2009(H1N1)) segment 2, complete sequence 4494 4494 99% 0.0 99%
CY075425.1 Influenza A virus (A/Chile/3935/2009(H1N1)) segment 2, complete sequence 4494 4494 99% 0.0 99%
CY075409.1 Influenza A virus (A/Chile/3819/2009(H1N1)) segment 2, complete sequence 4494 4494 99% 0.0 99%
CY075337.1 Influenza A virus (A/Chile/3349/2009(H1N1)) segment 2, complete sequence 4494 4494 99% 0.0 99%
CY075321.1 Influenza A virus (A/Chile/3244/2009(H1N1)) segment 2, complete sequence 4494 4494 99% 0.0 99%
CY075297.1 Influenza A virus (A/Chile/3123/2009(H1N1)) segment 2, complete sequence 4494 4494 99% 0.0 99%
CY075289.1 Influenza A virus (A/Chile/3056/2009(H1N1)) segment 2, complete sequence 4494 4494 99% 0.0 99%
CY075281.1 Influenza A virus (A/Chile/3019/2009(H1N1)) segment 2, complete sequence 4494 4494 99% 0.0 99%
CY075265.1 Influenza A virus (A/Chile/2911/2009(H1N1)) segment 2, complete sequence 4494 4494 99% 0.0 99%
CY075249.1 Influenza A virus (A/Chile/2362/2009(H1N1)) segment 2, complete sequence 4494 4494 99% 0.0 99%
CY075241.1 Influenza A virus (A/Chile/2851/2009(H1N1)) segment 2, complete sequence 4494 4494 99% 0.0 99%
CY075233.1 Influenza A virus (A/Chile/2239/2009(H1N1)) segment 2, complete sequence 4494 4494 99% 0.0 99%
CY075225.1 Influenza A virus (A/Chile/2009/2009(H1N1)) segment 2, complete sequence 4494 4494 99% 0.0 99%
CY075217.1 Influenza A virus (A/Chile/1624/2009(H1N1)) segment 2, complete sequence 4494 4494 99% 0.0 99%
CY075209.1 Influenza A virus (A/Chile/1603/2009(H1N1)) segment 2, complete sequence 4494 4494 99% 0.0 99%
CY075193.1 Influenza A virus (A/Chile/1599/2009(H1N1)) segment 2, complete sequence 4494 4494 99% 0.0 99%

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Tue Mar 08, 2011 1:58 pm 
Online

Joined: Wed Aug 19, 2009 10:42 am
Posts: 27289
Location: Pittsburgh, PA USA
Top 100 PA matches

CY086879.1 Influenza A virus (A/swine/Indiana/240218/2010(H1N2)) polymerase PA (PA) gene, complete cds 4264 4264 100% 0.0 100%
CY057507.1 Influenza A virus (A/Wisconsin/629-D00565/2009(H1N1)) segment 3, complete sequence 4256 4256 100% 0.0 99%
CY057475.1 Influenza A virus (A/Wisconsin/629-D00402/2009(H1N1)) segment 3, complete sequence 4256 4256 100% 0.0 99%
CY057427.1 Influenza A virus (A/Wisconsin/629-D00485/2009(H1N1)) segment 3, complete sequence 4256 4256 100% 0.0 99%
CY057411.1 Influenza A virus (A/Wisconsin/629-D00832/2009(H1N1)) segment 3, complete sequence 4256 4256 100% 0.0 99%
CY057403.1 Influenza A virus (A/Wisconsin/629-D01469/2009(H1N1)) segment 3, complete sequence 4256 4256 100% 0.0 99%
CY058625.1 Influenza A virus (A/Wisconsin/629-S1433/2009(H1N1)) segment 3, complete sequence 4248 4248 100% 0.0 99%
CY057563.1 Influenza A virus (A/Wisconsin/629-D00690/2009(H1N1)) segment 3, complete sequence 4248 4248 100% 0.0 99%
CY057499.1 Influenza A virus (A/Wisconsin/629-D00287/2009(H1N1)) segment 3, complete sequence 4240 4240 100% 0.0 99%
CY087005.1 Influenza A virus (A/New York/3256/2009(N1)) polymerase PA (PA) gene, complete cds 4224 4224 100% 0.0 99%
CY086998.1 Influenza A virus (A/New York/3251/2009(H1N1)) polymerase PA (PA) gene, complete cds 4224 4224 100% 0.0 99%
CY086974.1 Influenza A virus (A/New York/3198/2009(H1N1)) polymerase PA (PA) gene, complete cds 4224 4224 100% 0.0 99%
CY040722.2 Influenza A virus (A/New York/3238/2009(H1N1)) polymerase PA (PA) gene, complete cds 4224 4224 100% 0.0 99%
CY083891.1 Influenza A virus (A/San Diego/INS72/2009(H1N1)) polymerase PA (PA) gene, complete cds 4224 4224 100% 0.0 99%
CY083718.1 Influenza A virus (A/Madrid/INS112/2009(H1N1)) polymerase PA (PA) gene, complete cds 4224 4224 100% 0.0 99%
CY083486.1 Influenza A virus (A/Mexico City/WRAIR1691N/2009(H1N1)) polymerase PA (PA) gene, complete cds 4224 4224 100% 0.0 99%
CY083422.1 Influenza A virus (A/San Diego/WRAIR1667P/2009(H1N1)) polymerase PA (PA) gene, complete cds 4224 4224 100% 0.0 99%
CY083366.1 Influenza A virus (A/South Carolina/WRAIR1660P/2009(H1N1)) polymerase PA (PA) gene, complete cds 4224 4224 100% 0.0 99%
CY083358.1 Influenza A virus (A/San Diego/WRAIR1658P/2009(H1N1)) polymerase PA (PA) gene, complete cds 4224 4224 100% 0.0 99%
CY083350.1 Influenza A virus (A/San Diego/WRAIR1657P/2009(H1N1)) polymerase PA (PA) gene, complete cds 4224 4224 100% 0.0 99%
CY083311.1 Influenza A virus (A/San Diego/WRAIR1649P/2009(H1N1)) polymerase PA (PA) gene, complete cds 4224 4224 100% 0.0 99%
CY083239.1 Influenza A virus (A/Virginia/WRAIR1511P/2009(H1N1)) polymerase PA (PA) gene, complete cds 4224 4224 100% 0.0 99%
CY074022.1 Influenza A virus (A/Argentina/HNRG32/2009(H1N1)) segment 3 sequence 4224 4224 100% 0.0 99%
CY075665.1 Influenza A virus (A/Boston/628/2009(H1N1)) segment 3, complete sequence 4224 4224 100% 0.0 99%
CY075609.1 Influenza A virus (A/Boston/681/2009(H1N1)) segment 3, complete sequence 4224 4224 100% 0.0 99%
CY075593.1 Influenza A virus (A/Boston/666/2009(H1N1)) segment 3, complete sequence 4224 4224 100% 0.0 99%
CY075537.1 Influenza A virus (A/Boston/612/2009(H1N1)) segment 3, complete sequence 4224 4224 100% 0.0 99%
CY075472.1 Influenza A virus (A/Chile/4438/2009(H1N1)) segment 3, complete sequence 4224 4224 100% 0.0 99%
CY075464.1 Influenza A virus (A/Chile/4406/2009(H1N1)) segment 3, complete sequence 4224 4224 100% 0.0 99%
CY075456.1 Influenza A virus (A/Chile/4257/2009(H1N1)) segment 3, complete sequence 4224 4224 100% 0.0 99%
CY075448.1 Influenza A virus (A/Chile/4182/2009(H1N1)) segment 3, complete sequence 4224 4224 100% 0.0 99%
CY075440.1 Influenza A virus (A/Chile/4181/2009(H1N1)) segment 3, complete sequence 4224 4224 100% 0.0 99%
CY075416.1 Influenza A virus (A/Chile/3905/2009(H1N1)) segment 3, complete sequence 4224 4224 100% 0.0 99%
CY075392.1 Influenza A virus (A/Chile/3760/2009(H1N1)) segment 3, complete sequence 4224 4224 100% 0.0 99%
CY075368.1 Influenza A virus (A/Chile/3467/2009(H1N1)) segment 3, complete sequence 4224 4224 100% 0.0 99%
CY075344.1 Influenza A virus (A/Chile/3361/2009(H1N1)) segment 3, complete sequence 4224 4224 100% 0.0 99%
CY075296.1 Influenza A virus (A/Chile/3123/2009(H1N1)) segment 3, complete sequence 4224 4224 100% 0.0 99%
CY075288.1 Influenza A virus (A/Chile/3056/2009(H1N1)) segment 3, complete sequence 4224 4224 100% 0.0 99%
CY075272.1 Influenza A virus (A/Chile/2994/2009(H1N1)) segment 3, complete sequence 4224 4224 100% 0.0 99%
CY075264.1 Influenza A virus (A/Chile/2911/2009(H1N1)) segment 3, complete sequence 4224 4224 100% 0.0 99%
CY075240.1 Influenza A virus (A/Chile/2851/2009(H1N1)) segment 3, complete sequence 4224 4224 100% 0.0 99%
CY075232.1 Influenza A virus (A/Chile/2239/2009(H1N1)) segment 3, complete sequence 4224 4224 100% 0.0 99%
CY075224.1 Influenza A virus (A/Chile/2009/2009(H1N1)) segment 3, complete sequence 4224 4224 100% 0.0 99%
CY075216.1 Influenza A virus (A/Chile/1624/2009(H1N1)) segment 3, complete sequence 4224 4224 100% 0.0 99%
CY075208.1 Influenza A virus (A/Chile/1603/2009(H1N1)) segment 3, complete sequence 4224 4224 100% 0.0 99%
CY075200.1 Influenza A virus (A/Chile/1600/2009(H1N1)) segment 3, complete sequence 4224 4224 100% 0.0 99%
CY075184.1 Influenza A virus (A/Chile/1598/2009(H1N1)) segment 3, complete sequence 4224 4224 100% 0.0 99%
CY075168.1 Influenza A virus (A/Chile/180/2009(H1N1)) segment 3, complete sequence 4224 4224 100% 0.0 99%
CY075160.1 Influenza A virus (A/Chile/158/2009(H1N1)) segment 3, complete sequence 4224 4224 100% 0.0 99%
CY075152.1 Influenza A virus (A/Chile/95/2009(H1N1)) segment 3, complete sequence 4224 4224 100% 0.0 99%
CY075144.1 Influenza A virus (A/Chile/88/2009(H1N1)) segment 3, complete sequence 4224 4224 100% 0.0 99%
CY075136.1 Influenza A virus (A/Chile/56/2009(H1N1)) segment 3, complete sequence 4224 4224 100% 0.0 99%
CY075088.1 Influenza A virus (A/Chile/28/2009(H1N1)) segment 3, complete sequence 4224 4224 100% 0.0 99%
CY075013.1 Influenza A virus (A/Thailand/CU-H910/2009(H1N1)) segment 3 sequence 4224 4224 100% 0.0 99%
CY074973.1 Influenza A virus (A/Thailand/CU-C161/2009(H1N1)) segment 3 sequence 4224 4224 100% 0.0 99%
CY073417.1 Influenza A virus (A/San Diego/WR1640P/2009(H1N1)) segment 3 sequence 4224 4224 100% 0.0 99%
CY073409.1 Influenza A virus (A/San Diego/WR1639P/2009(H1N1)) segment 3 sequence 4224 4224 100% 0.0 99%
CY073253.1 Influenza A virus (A/Athens/WRAIR2962N/2009(H1N1)) segment 3 sequence 4224 4224 100% 0.0 99%
CY072787.1 Influenza A virus (A/Managua/5401.01/2009(H1N1)) segment 3, complete sequence 4224 4224 100% 0.0 99%
CY072731.1 Influenza A virus (A/Managua/4407.02/2009(H1N1)) segment 3, complete sequence 4224 4224 100% 0.0 99%
CY071473.1 Influenza A virus (A/California/WR1313P/2009(H1N1)) segment 3 sequence 4224 4224 100% 0.0 99%
CY071052.1 Influenza A virus (A/New York/NHRC0004/2009(H1N1)) segment 3, complete sequence 4224 4224 100% 0.0 99%
CY071044.1 Influenza A virus (A/New York/NHRC0003/2009(H1N1)) segment 3, complete sequence 4224 4224 100% 0.0 99%
CY069239.1 Influenza A virus (A/Munich/INS365/2009(H1N1)) segment 3, complete sequence 4224 4224 100% 0.0 99%
CY069111.1 Influenza A virus (A/Guam/NHRC0028/2009(H1N1)) segment 3, complete sequence 4224 4224 100% 0.0 99%
CY069087.1 Influenza A virus (A/Guam/NHRC0025/2009(H1N1)) segment 3, complete sequence 4224 4224 100% 0.0 99%
CY068919.1 Influenza A virus (A/Japan/NHRC0003/2009(H1N1)) segment 3, complete sequence 4224 4224 100% 0.0 99%
HM849037.1 Influenza A virus (A/Kurume/K0910/2009(H1N1)) segment 3 polymerase PA (PA) gene, complete cds 4224 4224 100% 0.0 99%
CY067020.1 Influenza A virus (A/Bochum/INS249/2009(H1N1)) segment 3, complete sequence 4224 4224 100% 0.0 99%
CY066828.1 Influenza A virus (A/Antwerp/INS221/2009(H1N1)) segment 3, complete sequence 4224 4224 100% 0.0 99%
CY065965.1 Influenza A virus (A/Japan/NHRC0002/2009(H1N1)) segment 3, complete sequence 4224 4224 100% 0.0 99%
CY065761.1 Influenza A virus (A/British Columbia/GFA0401/2009(H1N1)) segment 3 sequence 4224 4224 100% 0.0 99%
CY064900.1 Influenza A virus (A/Boston/136/2009(H1N1)) segment 3, complete sequence 4224 4224 100% 0.0 99%
CY064737.1 Influenza A virus (A/Mexico City/023/2009(H1N1)) segment 3, complete sequence 4224 4224 100% 0.0 99%
CY064729.1 Influenza A virus (A/Mexico City/022/2009(H1N1)) segment 3, complete sequence 4224 4224 100% 0.0 99%
CY064721.1 Influenza A virus (A/Mexico City/021/2009(H1N1)) segment 3, complete sequence 4224 4224 100% 0.0 99%
CY064713.1 Influenza A virus (A/Mexico City/020/2009(H1N1)) segment 3, complete sequence 4224 4224 100% 0.0 99%
CY064705.1 Influenza A virus (A/Mexico City/019/2009(H1N1)) segment 3, complete sequence 4224 4224 100% 0.0 99%
CY064657.1 Influenza A virus (A/Boston/137/2009(H1N1)) segment 3, complete sequence 4224 4224 100% 0.0 99%
CY064649.1 Influenza A virus (A/Boston/135/2009(H1N1)) segment 3, complete sequence 4224 4224 100% 0.0 99%
CY064601.1 Influenza A virus (A/Boston/129/2009(H1N1)) segment 3, complete sequence 4224 4224 100% 0.0 99%
CY064593.1 Influenza A virus (A/Boston/127/2009(H1N1)) segment 3, complete sequence 4224 4224 100% 0.0 99%
CY064577.1 Influenza A virus (A/Boston/125/2009(H1N1)) segment 3, complete sequence 4224 4224 100% 0.0 99%
CY064521.1 Influenza A virus (A/Boston/117/2009(H1N1)) segment 3, complete sequence 4224 4224 100% 0.0 99%
CY064505.1 Influenza A virus (A/Boston/115/2009(H1N1)) segment 3, complete sequence 4224 4224 100% 0.0 99%
CY064497.1 Influenza A virus (A/Boston/109/2009(H1N1)) segment 3, complete sequence 4224 4224 100% 0.0 99%
CY064481.1 Influenza A virus (A/Boston/106/2009(H1N1)) segment 3, complete sequence 4224 4224 100% 0.0 99%
CY064473.1 Influenza A virus (A/Boston/103/2009(H1N1)) segment 3, complete sequence 4224 4224 100% 0.0 99%
CY063539.1 Influenza A virus (A/Boston/148/2009(H1N1)) segment 3, complete sequence 4224 4224 100% 0.0 99%
CY063507.1 Influenza A virus (A/Boston/113/2009(H1N1)) segment 3, complete sequence 4224 4224 100% 0.0 99%
CY063491.1 Influenza A virus (A/Boston/110/2009(H1N1)) segment 3, complete sequence 4224 4224 100% 0.0 99%
CY062640.1 Influenza A virus (A/Mexico City/014/2009(H1N1)) segment 3, complete sequence 4224 4224 100% 0.0 99%
CY062497.1 Influenza A virus (A/Mexico city/CIA2/2009(H1N1)) segment 3 sequence 4224 4224 100% 0.0 99%
HM173604.1 Influenza A virus (A/Blagovechensk/01/2009(H1N1)) segment 3 polymerase PA (PA) gene, complete cds 4224 4224 100% 0.0 99%
CY061567.1 Influenza A virus (A/Texas/JMS367/2009(H1N1)) segment 3, complete sequence 4224 4224 100% 0.0 99%
CY060741.1 Influenza A virus (A/Ontario/9698/2009(H1N1)) segment 3 sequence 4224 4224 100% 0.0 99%
CY060733.1 Influenza A virus (A/Ontario/35273/2009(H1N1)) segment 3 sequence 4224 4224 100% 0.0 99%
CY058665.1 Influenza A virus (A/Wisconsin/629-D01913/2009(H1N1)) segment 3, complete sequence 4224 4224 100% 0.0 99%
CY058649.1 Influenza A virus (A/Wisconsin/629-D02329/2009(H1N1)) segment 3, complete sequence 4224 4224 100% 0.0 99%
CY072891.1 Influenza A virus (A/Managua/12.01/2009(H1N1)) segment 3, complete sequence 4220 4220 100% 0.0 99%

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Tue Mar 08, 2011 1:59 pm 
Online

Joined: Wed Aug 19, 2009 10:42 am
Posts: 27289
Location: Pittsburgh, PA USA
Top 100 NP matches

CY086881.1 Influenza A virus (A/swine/Indiana/240218/2010(H1N2)) nucleocapsid protein (NP) gene, complete cds 3013 3013 100% 0.0 100%
HQ840331.1 Influenza A virus (A/swine/South Dakota/152B/2009(H1N2)) segment 5 nucleocapsid protein (NP) gene, complete cds 2841 2841 98% 0.0 98%
CY041904.1 Influenza A virus (A/swine/Minnesota/SG-00239/2007(H1N2)) segment 5 sequence 2841 2841 99% 0.0 98%
GU937747.1 Influenza A virus (A/Kansas/13/2009(H3N2)) segment 5 nucleocapsid protein (NP) gene, complete cds 2825 2825 98% 0.0 98%
EU697205.1 Influenza A virus (A/turkey/Minnesota/366767/2005(H3N2)) nucleocapsid protein (NP) gene, complete cds 2815 2815 100% 0.0 98%
EU743213.1 Influenza A virus (A/turkey/MN/366767/2005(H3N2)) segment 5 nucleocapsid protein (NP) gene, complete cds 2815 2815 98% 0.0 98%
HM461803.1 Influenza A virus (A/swine/Minnesota/02011/2008(H1N2)) segment 5 nucleocapsid protein (NP) gene, partial cds 2807 2807 97% 0.0 98%
HQ734222.1 Influenza A virus (A/swine/Pennsylvania/62170-3/2010(H3N2)) segment 5 nucleocapsid protein (NP) gene, complete cds 2801 2801 98% 0.0 98%
HQ734228.1 Influenza A virus (A/swine/Pennsylvania/62170-4/2010(H3N2)) segment 5 nucleocapsid protein (NP) gene, complete cds 2793 2793 98% 0.0 98%
HM125975.1 Influenza A virus (A/swine/MN/48683/2002(H1N1)) segment 5 nucleocapsid protein (NP) gene, complete cds 2793 2793 98% 0.0 98%
EU798839.1 Influenza A virus (A/swine/Korea/CAS08/2005(H1N1)) segment 5 nucleocapsid protein (NP) gene, complete cds 2793 2793 98% 0.0 98%
HM461811.1 Influenza A virus (A/swine/Missouri/02060/2008(H1N1)) segment 5 nucleocapsid protein (NP) gene, complete cds 2791 2791 97% 0.0 98%
HQ734210.1 Influenza A virus (A/swine/Pennsylvania/62170-1/2010(H3N2)) segment 5 nucleocapsid protein (NP) gene, complete cds 2785 2785 98% 0.0 98%
EU798838.1 Influenza A virus (A/swine/Korea/CAN01/2004(H1N1)) segment 5 nucleocapsid protein (NP) gene, complete cds 2785 2785 98% 0.0 98%
HM461835.1 Influenza A virus (A/swine/Nebraska/02013/2008(H1N1)) segment 5 nucleocapsid protein (NP) gene, partial cds 2783 2783 97% 0.0 98%
CY086937.1 Influenza A virus (A/swine/North Carolina/239108/2010(H1N2)) nucleocapsid protein (NP) gene, complete cds 2777 2777 98% 0.0 98%
HQ734216.1 Influenza A virus (A/swine/Pennsylvania/62170-2/2010(H3N2)) segment 5 nucleocapsid protein (NP) gene, complete cds 2777 2777 98% 0.0 98%
GU135974.1 Influenza A virus (A/swine/Iowa/H03UWF2/2003(H1N1)) segment 5 nucleoprotein (NP) gene, complete cds 2769 2769 98% 0.0 98%
GU135911.1 Influenza A virus (A/swine/Iowa/H03G1/2003(H1N1)) segment 5 nucleoprotein (NP) gene, complete cds 2761 2761 98% 0.0 98%
GU135958.1 Influenza A virus (A/swine/Iowa/H03LS4/2003(H1N1)) segment 5 nucleoprotein (NP) gene, complete cds 2761 2761 98% 0.0 98%
GU135868.1 Influenza A virus (A/swine/Iowa/H02NJ56371/2002(H1N1)) segment 5 nucleoprotein (NP) gene, complete cds 2753 2753 98% 0.0 98%
GU135966.1 Influenza A virus (A/swine/Iowa/H03US3/2003(H1N1)) segment 5 nucleoprotein (NP) gene, complete cds 2753 2753 98% 0.0 98%
JF316644.1 Influenza A virus (A/swine/Pennsylvania/057108-1/2010(H3N2)) segment 5 nucleocapsid protein (NP) gene, complete cds 2746 2746 98% 0.0 98%
GU135876.1 Influenza A virus (A/swine/Iowa/H02NJ56391/2002(H1N1)) segment 5 nucleoprotein (NP) gene, complete cds 2746 2746 98% 0.0 98%
HM461819.1 Influenza A virus (A/swine/North Carolina/02023/2008(H1N1)) segment 5 nucleocapsid protein (NP) gene, partial cds 2744 2744 97% 0.0 98%
CY045552.1 Influenza A virus (A/swine/Oklahoma/001142/2009(H3N2)) segment 5 sequence 2744 2744 100% 0.0 97%
GU135884.1 Influenza A virus (A/swine/Iowa/H02PW7/2002(H1N1)) segment 5 nucleoprotein (NP) gene, complete cds 2738 2738 98% 0.0 98%
GU135926.1 Influenza A virus (A/swine/Iowa/H03HO7/2003(H3N2)) segment 5 nucleoprotein (NP) gene, complete cds 2738 2738 98% 0.0 98%
CY045560.1 Influenza A virus (A/swine/Kansas/015252/2009(H3N2)) segment 5 sequence 2728 2728 100% 0.0 97%
EF551054.1 Influenza A virus (A/swine/North Carolina/2003(H3N2)) segment 5 nucleoprotein (NP) gene, complete cds 2728 2728 100% 0.0 97%
DQ150426.1 Influenza A virus (A/swine/MI/PU243/04 (H3N1)) nucleoprotein (NP) gene, complete cds 2728 2728 100% 0.0 97%
GU135934.1 Influenza A virus (A/swine/Iowa/H03HS5/2003(H1N1)) segment 5 nucleoprotein (NP) gene, complete cds 2722 2722 98% 0.0 97%
DQ150434.1 Influenza A virus (A/swine/IN/PU542/04 (H3N1)) nucleoprotein (NP) gene, complete cds 2706 2706 100% 0.0 97%
FJ410141.1 Influenza A virus (A/swine/Minnesota/1145/2007(H3N2)) segment 5, complete sequence 2700 2700 100% 0.0 97%
GQ452238.1 Influenza A virus (A/swine/Iowa/H04YS2/2004(H1N1)) segment 5 nucleocapsid protein (NP) gene, complete cds 2698 2698 98% 0.0 97%
EU735821.1 Influenza A virus (A/turkey/OH/313053/2004(H3N2)) nucleocapsid protein (NP) gene, complete cds 2698 2698 99% 0.0 97%
EU735829.1 Influenza A virus (A/turkey/NC/353568/2005(H3N2)) nucleocapsid protein (NP) gene, complete cds 2696 2696 100% 0.0 97%
GU135892.1 Influenza A virus (A/swine/Iowa/H03BF5/2003(H3N2)) segment 5 nucleoprotein (NP) gene, complete cds 2690 2690 98% 0.0 97%
HM125983.1 Influenza A virus (A/swine/MN/23506/2009(H1N1)) segment 5 nucleocapsid protein (NP) gene, complete cds 2690 2690 98% 0.0 97%
DQ335774.1 Influenza A virus (A/turkey/Ohio/313053/04(H3N2)) nucleoprotein (NP) gene, complete cds 2690 2690 98% 0.0 97%
EU697210.1 Influenza A virus (A/turkey/North Carolina/353568/2005(H3N2)) nucleocapsid protein (NP) gene, complete cds 2684 2684 100% 0.0 97%
DQ889686.1 Influenza A virus (A/Iowa/CEID23/2005(H1N1)) nucleoprotein (NP) gene, complete cds 2682 2682 98% 0.0 97%
GU135950.1 Influenza A virus (A/swine/Iowa/H03LJ10/2003(H1N1)) segment 5 nucleoprotein (NP) gene, complete cds 2674 2674 98% 0.0 97%
DQ469999.1 Influenza A virus (A/turkey/Ontario/31232/2005(H3N2)) nucleoprotein (NP) gene, complete cds 2674 2674 98% 0.0 97%
DQ469991.1 Influenza A virus (A/swine/Ontario/33853/2005(H3N2)) nucleoprotein (NP) gene, complete cds 2674 2674 98% 0.0 97%
DQ469959.1 Influenza A virus (A/Ontario/RV1273/2005(H3N2)) nucleoprotein (NP) gene, complete cds 2674 2674 98% 0.0 97%
AY129159.1 Influenza A virus (A/Swine/Korea/CY02/02(H1N2)) nucleoprotein (NP) mRNA, complete cds 2674 2674 98% 0.0 97%
AF455699.1 Influenza A virus (A/Swine/Ohio/891/01(H1N2)) nucleoprotein (NP) gene, complete cds 2674 2674 98% 0.0 97%
EU826545.2 Influenza A virus (A/swine/Quebec/4001/2005(H3N2)) segment 5 nucleocapsid protein (NP) gene, complete cds 2666 2666 98% 0.0 97%
DQ469983.1 Influenza A virus (A/swine/Manitoba/12707/2005(H3N2)) nucleoprotein (NP) gene, complete cds 2666 2666 98% 0.0 97%
DQ469967.1 Influenza A virus (A/swine/Alberta/14722/2005(H3N2)) nucleoprotein (NP) gene, complete cds 2666 2666 98% 0.0 97%
CY045672.1 Influenza A virus (A/swine/Oklahoma/016179-9/2008(H1N2)) segment 5 sequence 2664 2664 100% 0.0 97%
CY045656.1 Influenza A virus (A/swine/Oklahoma/011521-4/2008(H1N2)) segment 5 sequence 2664 2664 100% 0.0 97%
CY045616.1 Influenza A virus (A/swine/Oklahoma/010710-8/2008(H1N2)) segment 5 sequence 2664 2664 100% 0.0 97%
CY045608.1 Influenza A virus (A/swine/Oklahoma/010710-9/2008(H1N2)) segment 5 sequence 2664 2664 100% 0.0 97%
CY045592.1 Influenza A virus (A/swine/Oklahoma/010226-16/2008(H1N2)) segment 5 sequence 2664 2664 100% 0.0 97%
CY041880.1 Influenza A virus (A/mallard/South Dakota/Sg-00128/2007(H3N2)) segment 5 sequence 2664 2664 100% 0.0 97%
DQ666936.1 Influenza A virus (A/swine/Korea/S11/2005(H1N2)) segment 5 nucleoprotein gene, complete cds 2662 2662 99% 0.0 97%
EU258936.1 Influenza A virus (A/swine/Missouri/2124514/2006(H2N3)) segment 5, complete sequence 2660 2660 99% 0.0 97%
DQ469975.1 Influenza A virus (A/swine/British Columbia/28103/2005(H3N2)) nucleoprotein (NP) gene, complete cds 2658 2658 98% 0.0 97%
CY045696.1 Influenza A virus (A/swine/Oklahoma/020736-2/2008(H1N2)) segment 5 sequence 2656 2656 100% 0.0 97%
CY045688.1 Influenza A virus (A/swine/Oklahoma/020734-3/2008(H1N2)) segment 5 sequence 2656 2656 100% 0.0 97%
CY045648.1 Influenza A virus (A/swine/Oklahoma/011521-5/2008(H1N2)) segment 5 sequence 2656 2656 100% 0.0 97%
CY045600.1 Influenza A virus (A/swine/Oklahoma/010226-17/2008(H1N2)) segment 5 sequence 2656 2656 100% 0.0 97%
CY045520.1 Influenza A virus (A/swine/Oklahoma/032726/2008(H1N2)) segment 5 sequence 2656 2656 100% 0.0 97%
CY041872.1 Influenza A virus (A/mallard/South Dakota/Sg-00127/2007(H3N2)) segment 5 sequence 2656 2656 100% 0.0 97%
CY041864.1 Influenza A virus (A/northern pintail/South Dakota/Sg-00126/2007(H3N2)) segment 5 sequence 2656 2656 100% 0.0 97%
CY041856.1 Influenza A virus (A/mallard/South Dakota/Sg-00125/2007(H3N2)) segment 5 sequence 2656 2656 100% 0.0 97%
EF551046.1 Influenza A virus (A/turkey/Illinois/2004(H3N2)) segment 5 nucleoprotein (NP) gene, partial cds 2656 2656 97% 0.0 97%
DQ145541.1 Influenza A virus (A/swine/Minnesota/00395/2004(H3N1)) nucleoprotein gene, partial cds 2654 2654 97% 0.0 97%
CY045568.1 Influenza A virus (A/swine/Oklahoma/008722/2007(H3N2)) segment 5 sequence 2652 2652 100% 0.0 96%
CY045704.1 Influenza A virus (A/swine/Oklahoma/020736-1/2008(H1N2)) segment 5 sequence 2648 2648 100% 0.0 96%
CY045680.1 Influenza A virus (A/swine/Oklahoma/020734-2/2008(H1N2)) segment 5 sequence 2648 2648 100% 0.0 96%
CY045632.1 Influenza A virus (A/swine/Oklahoma/011289-10/2008(H1N2)) segment 5 sequence 2648 2648 100% 0.0 96%
CY045536.1 Influenza A virus (A/swine/Texas/050625/2008(H1N2)) segment 5 sequence 2648 2648 100% 0.0 96%
GU135942.1 Influenza A virus (A/swine/Iowa/H03LDH5/2003(H3N2)) segment 5 nucleoprotein (NP) gene, complete cds 2642 2642 98% 0.0 97%
CY045664.1 Influenza A virus (A/swine/Oklahoma/016179-8/2008(H1N2)) segment 5 sequence 2640 2640 100% 0.0 96%
DQ666947.1 Influenza A virus (A/swine/Korea/S15/2006(H1N2)) segment 5 nucleoprotein gene, complete cds 2640 2640 100% 0.0 96%
DQ666928.1 Influenza A virus (A/swine/Korea/S5/2005(H1N2)) segment 5 nucleoprotein gene, complete cds 2640 2640 100% 0.0 96%
EU258946.1 Influenza A virus (A/swine/Missouri/4296424/2006(H2N3)) segment 5, complete sequence 2637 2637 99% 0.0 97%
CY045640.1 Influenza A virus (A/swine/Oklahoma/011289-8/2008(H1N2)) segment 5 sequence 2635 2635 99% 0.0 97%
CY045624.1 Influenza A virus (A/swine/Oklahoma/011289-9/2008(H1N2)) segment 5 sequence 2635 2635 99% 0.0 97%
EU798848.1 Influenza A virus (A/swine/Korea/CY08/2007(H1N2)) segment 5 nucleocapsid protein (NP) gene, complete cds 2635 2635 98% 0.0 97%
EU798847.1 Influenza A virus (A/swine/Korea/PZ14/2006(H1N2)) segment 5 nucleocapsid protein (NP) gene, complete cds 2635 2635 98% 0.0 97%
EU798846.1 Influenza A virus (A/swine/Korea/PZ7/2006(H1N2)) segment 5 nucleocapsid protein (NP) gene, complete cds 2635 2635 98% 0.0 97%
EU798845.1 Influenza A virus (A/swine/Korea/PZ4/2006(H1N2)) segment 5 nucleocapsid protein (NP) gene, complete cds 2635 2635 98% 0.0 97%
EU798842.1 Influenza A virus (A/swine/Korea/JL02/2005(H1N2)) segment 5 nucleocapsid protein (NP) gene, complete cds 2635 2635 98% 0.0 97%
CY045712.1 Influenza A virus (A/swine/Oklahoma/042169/2008(H1N2)) segment 5 sequence 2633 2633 100% 0.0 96%
AF251415.2 Influenza A virus (A/Swine/Iowa/533/99 (H3N2)) nucleoprotein (NP) gene, complete cds 2633 2633 100% 0.0 96%
AF455706.1 Influenza A virus (A/Swine/Illinois/100084/01 (H1N2)) nucleoprotein (NP) gene, complete cds 2627 2627 98% 0.0 97%
AF455705.1 Influenza A virus (A/Swine/Illinois/100085A/01 (H1N2)) nucleoprotein (NP) gene, complete cds 2627 2627 98% 0.0 97%
CY045544.1 Influenza A virus (A/swine/Oklahoma/053259/2008(H1N2)) segment 5 sequence 2625 2625 100% 0.0 96%
FJ461599.1 Influenza A virus (A/swine/Korea/C13/2008(H5N2)) segment 5 nucleocapsid protein (NP) gene, complete cds 2619 2619 98% 0.0 97%
AF251423.2 Influenza A virus (A/Swine/Iowa/569/99 (H3N2)) nucleoprotein (NP) gene, complete cds 2617 2617 100% 0.0 96%
DQ923513.1 Influenza A virus (A/swine/Korea/CN22/2006(H3N1)) nucleoprotein (NP) gene, complete cds 2613 2613 98% 0.0 97%
DQ923512.1 Influenza A virus (A/swine/Korea/PZ72-1/2006(H3N1)) nucleoprotein (NP) gene, complete cds 2613 2613 98% 0.0 97%
EU399754.1 Influenza A virus (A/Ontario/1252/2007(H3N2)) nucleoprotein (NP) gene, complete cds 2611 2611 98% 0.0 96%
HM461763.1 Influenza A virus (A/swine/Minnesota/02053/2008(H1N1)) segment 5 nucleocapsid protein (NP) gene, partial cds 2605 2605 98% 0.0 96%
EU798854.1 Influenza A virus (A/swine/Korea/CY05/2007(H3N2)) segment 5 nucleocapsid protein (NP) gene, complete cds 2603 2603 98% 0.0 96%
EU798853.1 Influenza A virus (A/swine/Korea/CY04/2007(H3N2)) segment 5 nucleocapsid protein (NP) gene, complete cds 2603 2603 98% 0.0 96%

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Tue Mar 08, 2011 2:00 pm 
Online

Joined: Wed Aug 19, 2009 10:42 am
Posts: 27289
Location: Pittsburgh, PA USA
Top 100 MP matches

CY086883.1 Influenza A virus (A/swine/Indiana/240218/2010(H1N2)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1986 1986 100% 0.0 100%
CY053622.1 Influenza A virus (A/swine/Italy/290271/2009(H1N1)) segment 7 sequence 1986 1986 100% 0.0 100%
HQ728113.1 Influenza A virus (A/swine/Taiwan/CH-1204/2009(H1N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1978 1978 100% 0.0 99%
HQ728105.1 Influenza A virus (A/swine/Taiwan/PT-1204/2009(H1N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1978 1978 100% 0.0 99%
HQ393496.1 Influenza A virus (A/swine/Taiwan/TD-2542/2010(H1N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1978 1978 100% 0.0 99%
CY069644.1 Influenza A virus (A/Singapore/527/2009(H1N1)) segment 7 sequence 1978 1978 100% 0.0 99%
CY069629.1 Influenza A virus (A/Singapore/471/2009(H1N1)) segment 7 sequence 1978 1978 100% 0.0 99%
CY063851.1 Influenza A virus (A/Singapore/KK066/2010(H1N1)) segment 7 sequence 1978 1978 100% 0.0 99%
CY063791.1 Influenza A virus (A/Singapore/ON1868/2009(H1N1)) segment 7 sequence 1978 1978 100% 0.0 99%
CY063783.1 Influenza A virus (A/Singapore/ON0801/2009(H1N1)) segment 7 sequence 1978 1978 100% 0.0 99%
CY054665.1 Influenza A virus (A/Russia/100/2009(H1N1)) segment 7 sequence 1978 1978 100% 0.0 99%
CY054657.1 Influenza A virus (A/Russia/61/2009(H1N1)) segment 7 sequence 1978 1978 100% 0.0 99%
GU211244.1 Influenza A virus (A/Tomsk/02/2009(H1N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1978 1978 100% 0.0 99%
CY045237.1 Influenza A virus (A/Taiwan/126/2009(H1N1)) segment 7 sequence 1978 1978 100% 0.0 99%
CY045498.1 Influenza A virus (A/Baden-Wurttemberg/448/2009(H1N1)) segment 7 sequence 1978 1978 100% 0.0 99%
CY076719.1 Influenza A virus (A/ferret/Washington/WADDL13230/2009(H1N1)) segment 7 sequence 1976 1976 99% 0.0 99%
CY084463.1 Influenza A virus (A/New York/6537/2009(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1974 1974 99% 0.0 99%
CY086915.1 Influenza A virus (A/swine/Minnesota/226128/2010(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1970 1970 100% 0.0 99%
CY081568.1 Influenza A virus (A/swine/South Dakota/4/2010(H1N2)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1970 1970 100% 0.0 99%
HQ661365.1 Influenza A virus (A/Russia/01-MA/2009(H1N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1970 1970 100% 0.0 99%
HQ652623.1 Influenza A virus (A/Jiangsu/S62/2009(H1N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1970 1970 100% 0.0 99%
HQ652622.1 Influenza A virus (A/Jiangsu/S61/2009(H1N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1970 1970 100% 0.0 99%
HQ011421.1 Influenza A virus (A/Guangdong/45/2009(H1N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1970 1970 100% 0.0 99%
CY063843.1 Influenza A virus (A/Singapore/GP999/2010(H1N1)) segment 7 sequence 1970 1970 100% 0.0 99%
CY060713.1 Influenza A virus (A/Ontario/315637/2009(H1N1)) segment 7 sequence 1970 1970 100% 0.0 99%
CY060697.1 Influenza A virus (A/Ontario/315187/2009(H1N1)) segment 7 sequence 1970 1970 100% 0.0 99%
CY060673.1 Influenza A virus (A/Ontario/315047/2009(H1N1)) segment 7 sequence 1970 1970 100% 0.0 99%
CY060665.1 Influenza A virus (A/Ontario/315015/2009(H1N1)) segment 7 sequence 1970 1970 100% 0.0 99%
CY060641.1 Influenza A virus (A/Ontario/314137/2009(H1N1)) segment 7 sequence 1970 1970 100% 0.0 99%
CY060625.1 Influenza A virus (A/Ontario/313762/2009(H1N1)) segment 7 sequence 1970 1970 100% 0.0 99%
CY060601.1 Influenza A virus (A/Ontario/305598/2009(H1N1)) segment 7 sequence 1970 1970 100% 0.0 99%
CY060585.1 Influenza A virus (A/Ontario/304434/2009(H1N1)) segment 7 sequence 1970 1970 100% 0.0 99%
CY060577.1 Influenza A virus (A/Ontario/29801/2009(H1N1)) segment 7 sequence 1970 1970 100% 0.0 99%
CY060569.1 Influenza A virus (A/Ontario/296008/2009(H1N1)) segment 7 sequence 1970 1970 100% 0.0 99%
CY055306.1 Influenza A virus (A/Singapore/GN285/2009(H1N1)) segment 7 sequence 1970 1970 100% 0.0 99%
GU592890.1 Influenza A virus (A/Barnaul/04/2009(H1N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1970 1970 100% 0.0 99%
GU560009.1 Influenza A virus (A/Tomsk/05/2009(H1N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1970 1970 100% 0.0 99%
GU367318.1 Influenza A virus (A/Tomsk/07/2009(H1N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1970 1970 100% 0.0 99%
CY053755.1 Influenza A virus (A/Russia/200/2009(H1N1)) segment 7 sequence 1970 1970 100% 0.0 99%
GQ360066.1 Influenza A virus (A/Stockholm/32/2009(H1N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1970 1970 100% 0.0 99%
CY060721.1 Influenza A virus (A/Ontario/320266/2009(H1N1)) segment 7 sequence 1966 1966 99% 0.0 99%
CY060705.1 Influenza A virus (A/Ontario/315613/2009(H1N1)) segment 7 sequence 1966 1966 99% 0.0 99%
CY060689.1 Influenza A virus (A/Ontario/315181/2009(H1N1)) segment 7 sequence 1966 1966 99% 0.0 99%
CY060649.1 Influenza A virus (A/Ontario/314603/2009(H1N1)) segment 7 sequence 1966 1966 99% 0.0 99%
CY060529.1 Influenza A virus (A/Ontario/235657/2009(H1N1)) segment 7 sequence 1966 1966 99% 0.0 99%
CY047747.1 Influenza A virus (A/Taiwan/526/2009(H1N1)) segment 7 sequence 1966 1966 99% 0.0 99%
CY045245.1 Influenza A virus (A/Taiwan/137/2009(H1N1)) segment 7 sequence 1966 1966 99% 0.0 99%
GQ359767.1 Influenza A virus (A/Stockholm/31/2009(H1N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1966 1966 100% 0.0 99%
CY043337.1 Influenza A virus (A/Denmark/523/2009(H1N1)) segment 7 sequence 1965 1965 99% 0.0 99%
FN423715.1 Influenza A virus (A/Luxembourg/43/2009(H1N1)) partial matrix protein 1 (M gene), segment 7, viral cRNA 1965 1965 99% 0.0 99%
CY086951.1 Influenza A virus (A/swine/Thailand/CU-M8_2/2009(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1963 1963 100% 0.0 99%
CY086907.1 Influenza A virus (A/swine/North Carolina/226126/2010(H1N2)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1963 1963 100% 0.0 99%
CY086899.1 Influenza A virus (A/swine/North Carolina/226125/2010(H1N2)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1963 1963 100% 0.0 99%
CY086891.1 Influenza A virus (A/swine/North Carolina/226124/2010(H1N2)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1963 1963 100% 0.0 99%
CY050370.1 Influenza A virus (A/Korea/S1/2009(H1N1)) segment 7 sequence 1963 1963 100% 0.0 99%
CY069637.1 Influenza A virus (A/Singapore/478/2009(H1N1)) segment 7 sequence 1963 1963 100% 0.0 99%
CY069622.1 Influenza A virus (A/Singapore/276/2009(H1N1)) segment 7 sequence 1963 1963 100% 0.0 99%
HM780473.1 Influenza A virus (A/Guangdong/06/2009(H1N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1963 1963 100% 0.0 99%
HM370970.1 Influenza A virus (A/turkey/Ontario/FAV110/2009(H1N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1963 1963 100% 0.0 99%
HM370963.1 Influenza A virus (A/turkey/Ontario/FAV110/2009(H1N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1963 1963 100% 0.0 99%
HM370978.1 Influenza A virus (A/turkey/Ontario/FAV114-17/2009(H1N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1963 1963 100% 0.0 99%
HM173600.1 Influenza A virus (A/Blagovechensk/01/2009(H1N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1963 1963 100% 0.0 99%
AB538392.1 Influenza A virus (A/Nagano/RC1/2009(H1N1)) M2, M1 genes for matrix protein 2, matrix protein 1, complete cds, segment: 7 1963 1963 99% 0.0 99%
CY060657.1 Influenza A virus (A/Ontario/315003/2009(H1N1)) segment 7 sequence 1963 1963 100% 0.0 99%
CY060561.1 Influenza A virus (A/Ontario/26184/2009(H1N1)) segment 7 sequence 1963 1963 100% 0.0 99%
HM014333.1 Influenza A virus (A/Guangzhou/GIRD07/2009(H1N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1963 1963 100% 0.0 99%
GU324342.1 Influenza A virus (A/swine/Taiwan/TD-4119B2/2009(H1N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1963 1963 100% 0.0 99%
CY046944.1 Influenza A virus (A/Netherlands/602/2009(H1N1)) segment 7 sequence 1963 1963 100% 0.0 99%
GQ866962.1 Influenza A virus (A/Thailand/CU-H9/2009(H1N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1963 1963 100% 0.0 99%
GQ332646.1 Influenza A virus (A/New York/1682-WC_RG1/2009(H1N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1963 1963 100% 0.0 99%
CY045957.1 Influenza A virus (A/Toronto/T0106/2009(H1N1)) segment 7 sequence 1963 1963 99% 0.0 99%
GQ369419.1 Influenza A virus (A/swine/Alberta/OTH-33-21/2009(H1N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1963 1963 100% 0.0 99%
GQ365365.1 Influenza A virus (A/Stockholm/36/2009(H1N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1963 1963 100% 0.0 99%
GQ360061.1 Influenza A virus (A/Stockholm/33/2009(H1N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1963 1963 100% 0.0 99%
GQ251038.1 Influenza A virus (A/Italy/05/2009(H1N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1963 1963 100% 0.0 99%
CY064794.1 Influenza A virus (A/Guangdong/SB1/2009(H1N1)) segment 7 sequence 1961 1961 99% 0.0 99%
HM230702.1 Influenza A virus (A/Zhoushan/52/2009(H1N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1959 1959 100% 0.0 99%
CY060633.1 Influenza A virus (A/Ontario/314095/2009(H1N1)) segment 7 sequence 1959 1959 99% 0.0 99%
CY060593.1 Influenza A virus (A/Ontario/305139/2009(H1N1)) segment 7 sequence 1959 1959 99% 0.0 99%
CY060521.1 Influenza A virus (A/Ontario/222656/2009(H1N1)) segment 7 sequence 1959 1959 99% 0.0 99%
GQ166660.1 Influenza A virus (A/England/195/2009(H1N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1959 1959 99% 0.0 99%
GU108489.1 Influenza A virus (A/Zhejiang-Yiwu/11/2009(H1N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1957 1957 98% 0.0 99%
CY081088.1 Influenza A virus (A/Ontario/741328/2010(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1955 1955 100% 0.0 99%
CY081072.1 Influenza A virus (A/Ontario/3620/2010(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1955 1955 100% 0.0 99%
HQ728097.1 Influenza A virus (A/swine/Taiwan/HL-1125/2009(H1N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1955 1955 100% 0.0 99%
CY076799.1 Influenza A virus (A/Ontario/156785/2009(H1N1)) segment 7 sequence 1955 1955 100% 0.0 99%
CY076790.1 Influenza A virus (A/Ontario/152846/2009(H1N1)) segment 7 sequence 1955 1955 100% 0.0 99%
CY076782.1 Influenza A virus (A/Ontario/152439/2009(H1N1)) segment 7 sequence 1955 1955 100% 0.0 99%
CY076766.1 Influenza A virus (A/Ontario/147265/2009(H1N1)) segment 7 sequence 1955 1955 100% 0.0 99%
CY076758.1 Influenza A virus (A/Ontario/142358/2009(H1N1)) segment 7 sequence 1955 1955 100% 0.0 99%
HQ011410.1 Influenza A virus (A/Guangdong/01/2009(H1N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1955 1955 100% 0.0 99%
HM230694.1 Influenza A virus (A/Zhoushan/1/2009(H1N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1955 1955 100% 0.0 99%
CY062311.1 Influenza A virus (A/swine/Thailand/CU-RA4/2009(H1N1)) segment 7 sequence 1955 1955 100% 0.0 99%
CY060729.1 Influenza A virus (A/Ontario/328474/2009(H1N1)) segment 7 sequence 1955 1955 100% 0.0 99%
CY060681.1 Influenza A virus (A/Ontario/315107/2009(H1N1)) segment 7 sequence 1955 1955 100% 0.0 99%
CY060553.1 Influenza A virus (A/Ontario/25913/2009(H1N1)) segment 7 sequence 1955 1955 100% 0.0 99%
CY060545.1 Influenza A virus (A/Ontario/25389/2009(H1N1)) segment 7 sequence 1955 1955 100% 0.0 99%
CY060513.1 Influenza A virus (A/Ontario/10296/2009(H1N1)) segment 7 sequence 1955 1955 100% 0.0 99%
CY060505.1 Influenza A virus (A/Ontario/10016/2009(H1N1)) segment 7 sequence 1955 1955 100% 0.0 99%
GU560017.1 Influenza A virus (A/Tomsk/06/2009(H1N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1955 1955 98% 0.0 99%

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Tue Mar 08, 2011 2:01 pm 
Online

Joined: Wed Aug 19, 2009 10:42 am
Posts: 27289
Location: Pittsburgh, PA USA
Top 100 NS matches

CY086884.1 Influenza A virus (A/swine/Indiana/240218/2010(H1N2)) nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1713 1713 100% 0.0 100%
CY050371.1 Influenza A virus (A/Korea/S1/2009(H1N1)) segment 8 sequence 1697 1697 100% 0.0 99%
CY060738.1 Influenza A virus (A/Ontario/35273/2009(H1N1)) segment 8 sequence 1697 1697 100% 0.0 99%
CY060682.1 Influenza A virus (A/Ontario/315107/2009(H1N1)) segment 8 sequence 1697 1697 100% 0.0 99%
CY060650.1 Influenza A virus (A/Ontario/314603/2009(H1N1)) segment 8 sequence 1697 1697 100% 0.0 99%
CY060570.1 Influenza A virus (A/Ontario/296008/2009(H1N1)) segment 8 sequence 1697 1697 100% 0.0 99%
CY055307.1 Influenza A virus (A/Singapore/GN285/2009(H1N1)) segment 8 sequence 1697 1697 100% 0.0 99%
CY054666.1 Influenza A virus (A/Russia/100/2009(H1N1)) segment 8 sequence 1697 1697 100% 0.0 99%
CY054658.1 Influenza A virus (A/Russia/61/2009(H1N1)) segment 8 sequence 1697 1697 100% 0.0 99%
GU108490.1 Influenza A virus (A/Zhejiang-Yiwu/11/2009(H1N1)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1697 1697 100% 0.0 99%
CY045246.1 Influenza A virus (A/Taiwan/137/2009(H1N1)) segment 8 sequence 1697 1697 100% 0.0 99%
CY045230.1 Influenza A virus (A/Taiwan/115/2009(H1N1)) segment 8 sequence 1697 1697 100% 0.0 99%
CY045934.1 Influenza A virus (A/Toronto/3184/2009(H1N1)) segment 8 sequence 1697 1697 100% 0.0 99%
CY045507.1 Influenza A virus (A/Bayern/66/2009(H1N1)) segment 8 sequence 1697 1697 100% 0.0 99%
GQ485660.1 Influenza A virus (A/Ekaterinburg/01/2009(H1N1)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1697 1697 100% 0.0 99%
GQ369280.1 Influenza A virus (A/Stockholm/41/2009(H1N1)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1697 1697 100% 0.0 99%
GQ365686.1 Influenza A virus (A/Stockholm/44/2009(H1N1)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1697 1697 100% 0.0 99%
GQ365681.1 Influenza A virus (A/Stockholm/38/2009(H1N1)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1697 1697 100% 0.0 99%
GQ360065.1 Influenza A virus (A/Stockholm/32/2009(H1N1)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1697 1697 100% 0.0 99%
GQ360063.1 Influenza A virus (A/Stockholm/33/2009(H1N1)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1697 1697 100% 0.0 99%
CY087012.1 Influenza A virus (A/New York/3565/2009(H1N1)) nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1695 1695 99% 0.0 99%
CY084466.1 Influenza A virus (A/New York/6537/2009(H1N1)) nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1695 1695 99% 0.0 99%
HQ840321.1 Influenza A virus (A/swine/Minnesota/165A/2009(H1N1)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1695 1695 99% 0.0 99%
HQ840313.1 Influenza A virus (A/swine/Minnesota/136B/2009(H1N1)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1695 1695 99% 0.0 99%
HQ840308.1 Influenza A virus (A/swine/Minnesota/130A/2009(H1N1)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1695 1695 99% 0.0 99%
HQ840294.1 Influenza A virus (A/swine/Minnesota/074A/2009(H1N1)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1695 1695 99% 0.0 99%
CY065766.1 Influenza A virus (A/British Columbia/GFA0401/2009(H1N1)) segment 8 sequence 1695 1695 99% 0.0 99%
HM569663.1 Influenza A virus (A/Argentina/07-09GP/2009(H1N1)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1695 1695 99% 0.0 99%
HM569679.1 Influenza A virus (A/Argentina/19527/2009(H1N1)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1695 1695 99% 0.0 99%
HM569687.1 Influenza A virus (A/Argentina/19618/2009(H1N1)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1695 1695 99% 0.0 99%
GQ457476.1 Influenza A virus (A/Utah/07/2009(H1N1)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1695 1695 99% 0.0 99%
GQ457459.1 Influenza A virus (A/Utah/05/2009(H1N1)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1695 1695 99% 0.0 99%
GQ377098.1 Influenza A virus (A/Ohio/07/2009(H1N1)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1695 1695 99% 0.0 99%
GQ377096.1 Influenza A virus (A/New York/09/2009(H1N1)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1695 1695 99% 0.0 99%
GQ377042.1 Influenza A virus (A/Montana/07/2009(H1N1)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1695 1695 99% 0.0 99%
GQ359768.1 Influenza A virus (A/Stockholm/31/2009(H1N1)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1695 1695 99% 0.0 99%
GQ323499.1 Influenza A virus (A/Michigan/06/2009(H1N1)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1695 1695 99% 0.0 99%
GQ200252.1 Influenza A virus (A/New York/21/2009(H1N1)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1695 1695 99% 0.0 99%
GQ200239.1 Influenza A virus (A/Georgia/01/2009(H1N1)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1695 1695 99% 0.0 99%
GQ168882.1 Influenza A virus (A/New York/13/2009(H1N1)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1695 1695 99% 0.0 99%
GQ168872.1 Influenza A virus (A/Ohio/07/2009(H1N1)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1695 1695 99% 0.0 99%
GQ168846.1 Influenza A virus (A/New York/22/2009(H1N1)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1695 1695 99% 0.0 99%
GQ160598.1 Influenza A virus (A/Nebraska/03/2009(H1N1)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1695 1695 99% 0.0 99%
FJ998221.1 Influenza A virus (A/Canada-ON/RV1527/2009(H1N1)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1695 1695 99% 0.0 99%
HQ165794.1 Influenza A virus (A/Mombasa/179/2009(H1N1)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1693 1693 99% 0.0 99%
GQ365369.1 Influenza A virus (A/Stockholm/35/2009(H1N1)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1693 1693 99% 0.0 99%
CY086952.1 Influenza A virus (A/swine/Thailand/CU-M8_2/2009(H1N1)) nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1691 1691 99% 0.0 99%
GQ334350.1 Influenza A virus (A/Shizuoka/759/2009(H1N1)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1691 1691 99% 0.0 99%
HQ728114.1 Influenza A virus (A/swine/Taiwan/CH-1204/2009(H1N1)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1689 1689 100% 0.0 99%
HQ652625.1 Influenza A virus (A/Jiangsu/S62/2009(H1N1)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1689 1689 100% 0.0 99%
HQ652624.1 Influenza A virus (A/Jiangsu/S61/2009(H1N1)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1689 1689 100% 0.0 99%
CY076798.1 Influenza A virus (A/Ontario/156785/2009(H1N1)) segment 8 sequence 1689 1689 100% 0.0 99%
CY076791.1 Influenza A virus (A/Ontario/152846/2009(H1N1)) segment 8 sequence 1689 1689 100% 0.0 99%
CY076783.1 Influenza A virus (A/Ontario/152439/2009(H1N1)) segment 8 sequence 1689 1689 100% 0.0 99%
CY076775.1 Influenza A virus (A/Ontario/147723/2009(H1N1)) segment 8 sequence 1689 1689 100% 0.0 99%
CY076767.1 Influenza A virus (A/Ontario/147265/2009(H1N1)) segment 8 sequence 1689 1689 100% 0.0 99%
CY076759.1 Influenza A virus (A/Ontario/142358/2009(H1N1)) segment 8 sequence 1689 1689 100% 0.0 99%
HM189508.1 Influenza A virus (A/Korea/CJ63/2009(H1N1)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1689 1689 100% 0.0 99%
CY069645.1 Influenza A virus (A/Singapore/527/2009(H1N1)) segment 8 sequence 1689 1689 100% 0.0 99%
CY069630.1 Influenza A virus (A/Singapore/471/2009(H1N1)) segment 8 sequence 1689 1689 100% 0.0 99%
CY069623.1 Influenza A virus (A/Singapore/276/2009(H1N1)) segment 8 sequence 1689 1689 100% 0.0 99%
HQ011422.1 Influenza A virus (A/Guangdong/45/2009(H1N1)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1689 1689 100% 0.0 99%
HM370971.1 Influenza A virus (A/turkey/Ontario/FAV110/2009(H1N1)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1689 1689 100% 0.0 99%
HM370979.1 Influenza A virus (A/turkey/Ontario/FAV114-17/2009(H1N1)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1689 1689 100% 0.0 99%
CY063852.1 Influenza A virus (A/Singapore/KK066/2010(H1N1)) segment 8 sequence 1689 1689 100% 0.0 99%
CY063834.1 Influenza A virus (A/Singapore/GP562/2010(H1N1)) segment 8 sequence 1689 1689 100% 0.0 99%
CY063784.1 Influenza A virus (A/Singapore/ON0801/2009(H1N1)) segment 8 sequence 1689 1689 100% 0.0 99%
HM230697.1 Influenza A virus (A/Zhoushan/1/2009(H1N1)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1689 1689 100% 0.0 99%
CY060754.1 Influenza A virus (A/Ontario/9739/2009(H1N1)) segment 8 sequence 1689 1689 100% 0.0 99%
CY060746.1 Influenza A virus (A/Ontario/9698/2009(H1N1)) segment 8 sequence 1689 1689 100% 0.0 99%
CY060730.1 Influenza A virus (A/Ontario/328474/2009(H1N1)) segment 8 sequence 1689 1689 100% 0.0 99%
CY060722.1 Influenza A virus (A/Ontario/320266/2009(H1N1)) segment 8 sequence 1689 1689 100% 0.0 99%
CY060690.1 Influenza A virus (A/Ontario/315181/2009(H1N1)) segment 8 sequence 1689 1689 100% 0.0 99%
CY060642.1 Influenza A virus (A/Ontario/314137/2009(H1N1)) segment 8 sequence 1689 1689 100% 0.0 99%
CY060618.1 Influenza A virus (A/Ontario/309862/2009(H1N1)) segment 8 sequence 1689 1689 100% 0.0 99%
CY060546.1 Influenza A virus (A/Ontario/25389/2009(H1N1)) segment 8 sequence 1689 1689 100% 0.0 99%
CY060514.1 Influenza A virus (A/Ontario/10296/2009(H1N1)) segment 8 sequence 1689 1689 100% 0.0 99%
CY060506.1 Influenza A virus (A/Ontario/10016/2009(H1N1)) segment 8 sequence 1689 1689 100% 0.0 99%
GU189653.1 Influenza A virus (A/Zhejiang/DTID-ZJU03/2009(H1N1)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1689 1689 100% 0.0 99%
GU112094.1 Influenza A virus (A/Zhejiang/DTID-ZJU02/2009(H1N1)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1689 1689 100% 0.0 99%
CY046945.1 Influenza A virus (A/Netherlands/602/2009(H1N1)) segment 8 sequence 1689 1689 100% 0.0 99%
GQ332647.1 Influenza A virus (A/New York/1682-WC_RG1/2009(H1N1)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1689 1689 100% 0.0 99%
CY045238.1 Influenza A virus (A/Taiwan/126/2009(H1N1)) segment 8 sequence 1689 1689 100% 0.0 99%
CY045982.1 Influenza A virus (A/Toronto/T9842/2009(H1N1)) segment 8 sequence 1689 1689 100% 0.0 99%
CY045974.1 Influenza A virus (A/Toronto/T5362/2009(H1N1)) segment 8 sequence 1689 1689 100% 0.0 99%
CY045958.1 Influenza A virus (A/Toronto/T0106/2009(H1N1)) segment 8 sequence 1689 1689 100% 0.0 99%
CY045950.1 Influenza A virus (A/Toronto/C2781/2009(H1N1)) segment 8 sequence 1689 1689 100% 0.0 99%
GQ375884.1 Influenza A virus (A/Iwate/1/2009(H1N1)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1689 1689 99% 0.0 99%
GQ365450.1 Influenza A virus (A/Sapporo/1/2009(H1N1)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1689 1689 99% 0.0 99%
GQ359770.1 Influenza A virus (A/Stockholm/30/2009(H1N1)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1689 1689 100% 0.0 99%
GQ166233.1 Influenza A virus (A/Nonthaburi/102/2009(H1N1)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1689 1689 100% 0.0 99%
HQ840329.1 Influenza A virus (A/swine/Minnesota/165A/2009(H1N1)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1687 1687 99% 0.0 99%
HQ840300.1 Influenza A virus (A/swine/Minnesota/130A/2009(H1N1)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1687 1687 99% 0.0 99%
HQ840298.1 Influenza A virus (A/swine/Minnesota/074A/2009(H1N1)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1687 1687 99% 0.0 99%
HM855243.1 Influenza A virus (A/Keiyo/96/2009(H1N1)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1687 1687 99% 0.0 99%
CY065774.1 Influenza A virus (A/Canada/GFA0402/2009(H1N1)) segment 8 sequence 1687 1687 99% 0.0 99%
HM569671.1 Influenza A virus (A/Argentina/08AR/2009(H1N1)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1687 1687 99% 0.0 99%
HM569695.1 Influenza A virus (A/Argentina/19656/2009(H1N1)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1687 1687 99% 0.0 99%
HM051343.1 Influenza A virus (A/Guangdong/SWL28/2009(H1N1)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, partial cds 1687 1687 99% 0.0 99%
HM014328.1 Influenza A virus (A/Guangzhou/GIRD07/2009(H1N1)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1687 1687 99% 0.0 99%

_________________
www.twitter.com/hniman


Top
 Profile  
 
Display posts from previous:  Sort by  
Post new topic Reply to topic  [ 11 posts ]  Go to page 1, 2  Next

All times are UTC - 5 hours [ DST ]


Who is online

Users browsing this forum: BeWell, stevevit and 44 guests


You cannot post new topics in this forum
You cannot reply to topics in this forum
You cannot edit your posts in this forum
You cannot delete your posts in this forum
You cannot post attachments in this forum

Search for:
Jump to:  
Powered by phpBB® Forum Software © phpBB Group