Rhiza Labs FluTracker Forum

The place to discuss the flu
It is currently Sat May 25, 2013 9:10 pm

All times are UTC - 5 hours [ DST ]




Post new topic Reply to topic  [ 68 posts ]  Go to page 1, 2, 3, 4, 5 ... 7  Next
Author Message
PostPosted: Tue Mar 08, 2011 12:38 pm 
Online

Joined: Wed Aug 19, 2009 10:42 am
Posts: 27559
Location: Pittsburgh, PA USA
Sequences for all 8 gene segments released by Seoul National University from H1N2 swine isoles from 2010 have a variety of constellations involving pandemic H1N1 genes. A/swine/Korea/4941/2010, collected in April, 2010 has 6 pandemic H1N1 gene segments. However, NA is N2 from H1N2 or H3N2 triple reassortants with human N2 from 1996. In addition it has a swine NP gene. Other isolates have other combinations.

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Tue Mar 08, 2011 12:51 pm 
Online

Joined: Wed Aug 19, 2009 10:42 am
Posts: 27559
Location: Pittsburgh, PA USA
LOCUS JF346726 237 bp cRNA linear VRL 01-MAR-2011
DEFINITION Influenza A virus (A/swine/Korea/4941/2010(H1N2)) segment 4
hemagglutinin (HA) gene, partial cds.
ACCESSION JF346726
VERSION JF346726.1 GI:324034233
KEYWORDS .
SOURCE Influenza A virus (A/swine/Korea/4941/2010(H1N2))
ORGANISM Influenza A virus (A/swine/Korea/4941/2010(H1N2))
Viruses; ssRNA negative-strand viruses; Orthomyxoviridae;
Influenzavirus A.
REFERENCE 1 (bases 1 to 237)
AUTHORS Park,B.K., Han,J.Y., Park,S.J., Kim,H.K., Rho,S. and Nguyen,V.G.
TITLE Swine influenza H1N2 reassortant with the pandemic H1N1 (2009)
virus in South Korea
JOURNAL Unpublished
REFERENCE 2 (bases 1 to 237)
AUTHORS Park,B.K., Han,J.Y., Park,S.J., Kim,H.K., Rho,S. and Nguyen,V.G.
TITLE Direct Submission
JOURNAL Submitted (17-FEB-2011) Department of Veterinary Medicine Virology
Lab, Seoul National University, Gwanak-gu, Seoul, 151-742, Korea,
Seoul 151-742, South Korea
COMMENT GenBank Accession Numbers JF346737, JF346701, JF346726, JF346719,
JF346710, JF346692, JF346683, JF346746 represent sequences from the
8 segments of Influenza A virus (A/swine/Korea/4941/2010(H1N2)).
FEATURES Location/Qualifiers
source 1..237
/organism="Influenza A virus
(A/swine/Korea/4941/2010(H1N2))"
/mol_type="viral cRNA"
/strain="A/swine/Korea/4941/2010"
/serotype="H1N2"
/host="swine"
/db_xref="taxon:986179"
/segment="4"
/country="South Korea"
/collection_date="Apr-2010"
gene <1..>237
/gene="HA"
CDS <1..>237
/gene="HA"
/codon_start=1
/product="hemagglutinin"
/protein_id="ADY16801.1"
/db_xref="GI:324034234"
/translation="DQQSLYQNADAYVFVGTSRYSKKFKPEIAIRPKVRDQEGRMNYY
WTLVEPGDKITFEATGNLVVPRYAFAMERNAGSGI"
ORIGIN
1 gaccaacaaa gtctctatca gaatgcagat gcatatgttt ttgtggggac atcaagatac
61 agcaagaagt tcaagccgga aatagcaata agacccaaag tgagggacca agaagggagg
121 atgaactatt actggacact agtagagccg ggagacaaaa taacattcga agcaactgga
181 aatctagtgg taccgagata tgcattcgca atggaaagaa atgctggatc tggtatt

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Tue Mar 08, 2011 1:08 pm 
Online

Joined: Wed Aug 19, 2009 10:42 am
Posts: 27559
Location: Pittsburgh, PA USA
Top 100 HA matches

JF346726.1 Influenza A virus (A/swine/Korea/4941/2010(H1N2)) segment 4 hemagglutinin (HA) gene, partial cds 470 470 100% 1e-131 100%
JF346725.1 Influenza A virus (A/swine/Korea/4940/2010(H1N2)) segment 4 hemagglutinin (HA) gene, partial cds 462 462 100% 3e-129 99%
CY081069.1 Influenza A virus (A/Ontario/3620/2010(H1N1)) hemagglutinin (HA) gene, complete cds 462 462 100% 3e-129 99%
CY081085.1 Influenza A virus (A/Ontario/741328/2010(H1N1)) hemagglutinin (HA) gene, complete cds 462 462 100% 3e-129 99%
CY045101.1 Influenza A virus (A/Peru/FLA8651/2009(H1)) segment 4 sequence 462 462 100% 3e-129 99%
CY072016.1 Influenza A virus (A/North Dakota/AF2510/2009(H1N1)) segment 4 sequence 462 462 100% 3e-129 99%
CY069975.1 Influenza A virus (A/Florida/AF2193/2009(H1N1)) segment 4 sequence 462 462 100% 3e-129 99%
CY061757.1 Influenza A virus (A/swine/Hong Kong/NS1810/2009(H1N1)) segment 4 sequence 462 462 100% 3e-129 99%
CY061749.1 Influenza A virus (A/swine/Hong Kong/NS1809/2009(H1N1)) segment 4 sequence 462 462 100% 3e-129 99%
GU371270.1 Influenza A virus (A/Hunan Kaifu/SWL4142/2009(H1N1)) segment 4 hemagglutinin (HA) gene, complete cds 462 462 100% 3e-129 99%
CY052162.1 Influenza A virus (A/New York/4788/2009(H1N1)) segment 4, complete sequence 462 462 100% 3e-129 99%
CY051743.1 Influenza A virus (A/New York/4810/2009(H1N1)) segment 4, complete sequence 462 462 100% 3e-129 99%
CY051735.1 Influenza A virus (A/New York/4791/2009(H1N1)) segment 4, complete sequence 462 462 100% 3e-129 99%
CY051727.1 Influenza A virus (A/New York/4790/2009(H1N1)) segment 4, complete sequence 462 462 100% 3e-129 99%
CY051719.1 Influenza A virus (A/New York/4789/2009(H1N1)) segment 4, complete sequence 462 462 100% 3e-129 99%
CY051711.1 Influenza A virus (A/New York/4787/2009(H1N1)) segment 4, complete sequence 462 462 100% 3e-129 99%
CY051703.1 Influenza A virus (A/New York/4780/2009(H1N1)) segment 4, complete sequence 462 462 100% 3e-129 99%
CY047224.1 Influenza A virus (A/Catalonia/S1221/2009(H1N1)) segment 4 sequence 462 462 100% 3e-129 99%
CY087016.1 Influenza A virus (A/New York/4764/2009(H1N1)) hemagglutinin (HA) gene, complete cds 454 454 100% 8e-127 99%
CY087008.1 Influenza A virus (A/New York/3565/2009(H1N1)) hemagglutinin (HA) gene, partial cds 454 454 100% 8e-127 99%
CY086985.1 Influenza A virus (A/New York/3250/2009(H1N1)) hemagglutinin (HA) gene, partial cds 454 454 100% 8e-127 99%
CY086977.1 Influenza A virus (A/New York/3217/2009(H1N1)) hemagglutinin (HA) gene, complete cds 454 454 100% 8e-127 99%
CY086969.1 Influenza A virus (A/New York/3198/2009(H1N1)) hemagglutinin (HA) gene, complete cds 454 454 100% 8e-127 99%
CY086948.1 Influenza A virus (A/swine/Thailand/CU-M8_2/2009(H1N1)) hemagglutinin (HA) gene, complete cds 454 454 100% 8e-127 99%
CY040717.2 Influenza A virus (A/New York/3238/2009(H1N1)) hemagglutinin (HA) gene, complete cds 454 454 100% 8e-127 99%
JF340083.1 Influenza A virus (A/St.Petersburg/14/2010(H1N1)) segment 4 hemagglutinin (HA) gene, complete cds 454 454 100% 8e-127 99%
CY084462.1 Influenza A virus (A/New York/6537/2009(H1N1)) hemagglutinin (HA) gene, complete cds 454 454 100% 8e-127 99%
CY084454.1 Influenza A virus (A/New York/6418/2009(H1N1)) hemagglutinin (HA) gene, complete cds 454 454 100% 8e-127 99%
CY084438.1 Influenza A virus (A/New York/6064/2009(H1N1)) hemagglutinin (HA) gene, complete cds 454 454 100% 8e-127 99%
AB568253.1 Influenza A virus (A/Kobe/91890/2009(H1N1)) HA gene for hemagglutinin, complete cds, segment: 4 454 454 100% 8e-127 99%
AB568243.1 Influenza A virus (A/Kobe/91825/2009(H1N1)) HA gene for hemagglutinin, complete cds, segment: 4 454 454 100% 8e-127 99%
AB568238.1 Influenza A virus (A/Kobe/91823/2009(H1N1)) HA gene for hemagglutinin, complete cds, segment: 4 454 454 100% 8e-127 99%
AB568223.1 Influenza A virus (A/Kobe/91780/2009(H1N1)) HA gene for hemagglutinin, complete cds, segment: 4 454 454 100% 8e-127 99%
AB568218.1 Influenza A virus (A/Kobe/91738/2009(H1N1)) HA gene for hemagglutinin, complete cds, segment: 4 454 454 100% 8e-127 99%
AB568208.1 Influenza A virus (A/Kobe/91660/2009(H1N1)) HA gene for hemagglutinin, complete cds, segment: 4 454 454 100% 8e-127 99%
AB568193.1 Influenza A virus (A/Kobe/91585/2009(H1N1)) HA gene for hemagglutinin, complete cds, segment: 4 454 454 100% 8e-127 99%
AB568188.1 Influenza A virus (A/Kobe/91571/2009(H1N1)) HA gene for hemagglutinin, complete cds, segment: 4 454 454 100% 8e-127 99%
AB568183.1 Influenza A virus (A/Kobe/91569/2009(H1N1)) HA gene for hemagglutinin, complete cds, segment: 4 454 454 100% 8e-127 99%
AB568178.1 Influenza A virus (A/Kobe/91559/2009(H1N1)) HA gene for hemagglutinin, complete cds, segment: 4 454 454 100% 8e-127 99%
AB568173.1 Influenza A virus (A/Kobe/91537/2009(H1N1)) HA gene for hemagglutinin, complete cds, segment: 4 454 454 100% 8e-127 99%
AB568168.1 Influenza A virus (A/Kobe/91533/2009(H1N1)) HA gene for hemagglutinin, complete cds, segment: 4 454 454 100% 8e-127 99%
AB568163.1 Influenza A virus (A/Kobe/91524/2009(H1N1)) HA gene for hemagglutinin, complete cds, segment: 4 454 454 100% 8e-127 99%
AB568158.1 Influenza A virus (A/Kobe/91508/2009(H1N1)) HA gene for hemagglutinin, complete cds, segment: 4 454 454 100% 8e-127 99%
AB558407.1 Influenza A virus (A/Sendai/TU1007/2009(H1N1)) HA gene for hemagglutinin, complete cds 454 454 100% 8e-127 99%
AB558405.1 Influenza A virus (A/Sendai/TU1005/2009(H1N1)) HA gene for hemagglutinin, complete cds 454 454 100% 8e-127 99%
AB558404.1 Influenza A virus (A/Sendai/TU1004/2009(H1N1)) HA gene for hemagglutinin, complete cds 454 454 100% 8e-127 99%
AB558398.1 Influenza A virus (A/Sendai/TU619/2009(H1N1)) HA gene for hemagglutinin, complete cds 454 454 100% 8e-127 99%
AB558395.1 Influenza A virus (A/Sendai/TU616/2009(H1N1)) HA gene for hemagglutinin, complete cds 454 454 100% 8e-127 99%
AB558394.1 Influenza A virus (A/Sendai/TU615/2009(H1N1)) HA gene for hemagglutinin, complete cds 454 454 100% 8e-127 99%
AB558390.1 Influenza A virus (A/Sendai/TU587/2009(H1N1)) HA gene for hemagglutinin, complete cds 454 454 100% 8e-127 99%
AB558383.1 Influenza A virus (A/Sendai/TU556/2009(H1N1)) HA gene for hemagglutinin, complete cds 454 454 100% 8e-127 99%
AB558375.1 Influenza A virus (A/Sendai/TU527/2009(H1N1)) HA gene for hemagglutinin, complete cds 454 454 100% 8e-127 99%
AB558372.1 Influenza A virus (A/Sendai/TU514/2009(H1N1)) HA gene for hemagglutinin, complete cds 454 454 100% 8e-127 99%
AB558370.1 Influenza A virus (A/Sendai/TU502/2009(H1N1)) HA gene for hemagglutinin, complete cds 454 454 100% 8e-127 99%
AB558367.1 Influenza A virus (A/Sendai/TU497/2009(H1N1)) HA gene for hemagglutinin, complete cds 454 454 100% 8e-127 99%
AB558362.1 Influenza A virus (A/Sendai/TU483/2009(H1N1)) HA gene for hemagglutinin, complete cds 454 454 100% 8e-127 99%
AB558361.1 Influenza A virus (A/Sendai/TU481/2009(H1N1)) HA gene for hemagglutinin, complete cds 454 454 100% 8e-127 99%
AB558356.1 Influenza A virus (A/Sendai/TU467/2009(H1N1)) HA gene for hemagglutinin, complete cds 454 454 100% 8e-127 99%
AB558352.1 Influenza A virus (A/Sendai/TU462/2009(H1N1)) HA gene for hemagglutinin, complete cds 454 454 100% 8e-127 99%
AB558351.1 Influenza A virus (A/Sendai/TU461/2009(H1N1)) HA gene for hemagglutinin, complete cds 454 454 100% 8e-127 99%
AB558349.1 Influenza A virus (A/Sendai/TU459/2009(H1N1)) HA gene for hemagglutinin, complete cds 454 454 100% 8e-127 99%
AB558347.1 Influenza A virus (A/Sendai/TU455/2009(H1N1)) HA gene for hemagglutinin, complete cds 454 454 100% 8e-127 99%
AB558346.1 Influenza A virus (A/Sendai/TU454/2009(H1N1)) HA gene for hemagglutinin, complete cds 454 454 100% 8e-127 99%
AB558345.1 Influenza A virus (A/Sendai/TU453/2009(H1N1)) HA gene for hemagglutinin, complete cds 454 454 100% 8e-127 99%
AB558342.1 Influenza A virus (A/Sendai/TU450/2009(H1N1)) HA gene for hemagglutinin, complete cds 454 454 100% 8e-127 99%
AB558340.1 Influenza A virus (A/Sendai/TU445/2009(H1N1)) HA gene for hemagglutinin, complete cds 454 454 100% 8e-127 99%
AB558337.1 Influenza A virus (A/Sendai/TU443/2009(H1N1)) HA gene for hemagglutinin, complete cds 454 454 100% 8e-127 99%
AB558334.1 Influenza A virus (A/Sendai/TU439/2009(H1N1)) HA gene for hemagglutinin, complete cds 454 454 100% 8e-127 99%
AB558333.1 Influenza A virus (A/Sendai/TU438/2009(H1N1)) HA gene for hemagglutinin, complete cds 454 454 100% 8e-127 99%
AB558329.1 Influenza A virus (A/Sendai/TU432/2009(H1N1)) HA gene for hemagglutinin, complete cds 454 454 100% 8e-127 99%
AB558328.1 Influenza A virus (A/Sendai/TU431/2009(H1N1)) HA gene for hemagglutinin, complete cds 454 454 100% 8e-127 99%
AB558327.1 Influenza A virus (A/Sendai/TU430/2009(H1N1)) HA gene for hemagglutinin, complete cds 454 454 100% 8e-127 99%
AB558326.1 Influenza A virus (A/Sendai/TU429/2009(H1N1)) HA gene for hemagglutinin, complete cds 454 454 100% 8e-127 99%
AB558322.1 Influenza A virus (A/Sendai/TU418/2009(H1N1)) HA gene for hemagglutinin, complete cds 454 454 100% 8e-127 99%
AB558321.1 Influenza A virus (A/Sendai/TU417/2009(H1N1)) HA gene for hemagglutinin, complete cds 454 454 100% 8e-127 99%
AB558319.1 Influenza A virus (A/Sendai/TU415/2009(H1N1)) HA gene for hemagglutinin, complete cds 454 454 100% 8e-127 99%
AB558318.1 Influenza A virus (A/Sendai/TU414/2009(H1N1)) HA gene for hemagglutinin, complete cds 454 454 100% 8e-127 99%
AB558316.1 Influenza A virus (A/Sendai/TU412/2009(H1N1)) HA gene for hemagglutinin, complete cds 454 454 100% 8e-127 99%
AB558315.1 Influenza A virus (A/Sendai/TU409/2009(H1N1)) HA gene for hemagglutinin, complete cds 454 454 100% 8e-127 99%
AB558314.1 Influenza A virus (A/Sendai/TU408/2009(H1N1)) HA gene for hemagglutinin, complete cds 454 454 100% 8e-127 99%
AB558312.1 Influenza A virus (A/Sendai/TU406/2009(H1N1)) HA gene for hemagglutinin, complete cds 454 454 100% 8e-127 99%
AB558311.1 Influenza A virus (A/Sendai/TU402/2009(H1N1)) HA gene for hemagglutinin, complete cds 454 454 100% 8e-127 99%
AB558310.1 Influenza A virus (A/Sendai/TU400/2009(H1N1)) HA gene for hemagglutinin, complete cds 454 454 100% 8e-127 99%
AB558309.1 Influenza A virus (A/Sendai/TU399/2009(H1N1)) HA gene for hemagglutinin, complete cds 454 454 100% 8e-127 99%
AB558307.1 Influenza A virus (A/Sendai/TU397/2009(H1N1)) HA gene for hemagglutinin, complete cds 454 454 100% 8e-127 99%
AB558306.1 Influenza A virus (A/Sendai/TU396/2009(H1N1)) HA gene for hemagglutinin, complete cds 454 454 100% 8e-127 99%
AB558305.1 Influenza A virus (A/Sendai/TU395/2009(H1N1)) HA gene for hemagglutinin, complete cds 454 454 100% 8e-127 99%
AB558304.1 Influenza A virus (A/Sendai/TU394/2009(H1N1)) HA gene for hemagglutinin, complete cds 454 454 100% 8e-127 99%
AB558302.1 Influenza A virus (A/Sendai/TU392/2009(H1N1)) HA gene for hemagglutinin, complete cds 454 454 100% 8e-127 99%
AB558300.1 Influenza A virus (A/Sendai/TU386/2009(H1N1)) HA gene for hemagglutinin, complete cds 454 454 100% 8e-127 99%
AB558294.1 Influenza A virus (A/Sendai/TU376/2009(H1N1)) HA gene for hemagglutinin, complete cds 454 454 100% 8e-127 99%
AB601606.1 Influenza A virus (A/Yamagata/158/2010(H1N1)) HA gene for hemagglutinin, partial cds 454 454 100% 8e-127 99%
AB601605.1 Influenza A virus (A/Yamagata/143/2010(H1N1)) HA gene for hemagglutinin, partial cds 454 454 100% 8e-127 99%
AB601603.1 Influenza A virus (A/Yamagata/708/2009(H1N1)) HA gene for hemagglutinin, partial cds 454 454 100% 8e-127 99%
AB601602.1 Influenza A virus (A/Yamagata/232/2009(H1N1)) HA gene for hemagglutinin, partial cds 454 454 100% 8e-127 99%
AB601601.1 Influenza A virus (A/Yamagata/163/2009(H1N1)) HA gene for hemagglutinin, partial cds 454 454 100% 8e-127 99%
HQ622586.1 Influenza A virus (A/swine/Minnesota/54354/2010(H1N1)) segment 4 hemagglutinin (HA) gene, complete cds 454 454 100% 8e-127 99%
HQ606480.1 Influenza A virus (A/Thailand/ST_0113/2010(H1N1)) segment 4 hemagglutinin (HA) gene, partial cds 454 454 100% 8e-127 99%
HQ011423.1 Influenza A virus (A/Guangdong/55/2009(H1N1)) segment 4 hemagglutinin (HA) gene, complete cds 454 454 100% 8e-127 99%
CY087033.1 Influenza A virus (A/New York/4631/2009(H1N1)) hemagglutinin (HA) gene, partial cds 450 450 100% 1e-125 98%

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Tue Mar 08, 2011 1:10 pm 
Online

Joined: Wed Aug 19, 2009 10:42 am
Posts: 27559
Location: Pittsburgh, PA USA
Top 100 NA matches

JF346737.1 Influenza A virus (A/swine/Korea/4941/2010(H1N2)) segment 6 neuraminidase (NA) gene, partial cds 630 630 100% 8e-180 100%
JF346732.1 Influenza A virus (A/swine/Korea/4382/2009(H1N2)) segment 6 neuraminidase (NA) gene, partial cds 615 615 100% 5e-175 99%
JF346731.1 Influenza A virus (A/swine/Korea/4381/2009(H1N2)) segment 6 neuraminidase (NA) gene, partial cds 615 615 100% 5e-175 99%
DQ666946.1 Influenza A virus (A/swine/Korea/S15/2006(H1N2)) segment 6 neuraminidase gene, complete cds 583 583 100% 2e-165 98%
AY129157.1 Influenza A virus (A/Swine/Korea/CY02/02(H1N2)) neuraminidase (NA) mRNA, complete cds 583 583 100% 2e-165 98%
AF455698.1 Influenza A virus (A/Swine/Illinois/100084/01 (H1N2)) neuraminidase (NA) gene, complete cds 583 583 100% 2e-165 98%
AF455697.1 Influenza A virus (A/Swine/Illinois/100085A/01 (H1N2)) neuraminidase (NA) gene, complete cds 583 583 100% 2e-165 98%
EU139840.1 Influenza A virus (A/swine/Minnesota/00194/2003(H1N2)) neuraminidase (NA) gene, partial cds 575 575 100% 4e-163 97%
DQ666943.1 Influenza A virus (A/swine/Korea/S14/2006(H1N2)) segment 6 neuraminidase gene, complete cds 575 575 100% 4e-163 97%
CY040525.1 Influenza A virus (A/swine/Minnesota/5547/2005(H3N2)) segment 6 sequence 571 571 100% 6e-162 97%
CY041881.1 Influenza A virus (A/mallard/South Dakota/Sg-00128/2007(H3N2)) segment 6 sequence 567 567 100% 1e-160 97%
CY041873.1 Influenza A virus (A/mallard/South Dakota/Sg-00127/2007(H3N2)) segment 6 sequence 567 567 100% 1e-160 97%
CY041865.1 Influenza A virus (A/northern pintail/South Dakota/Sg-00126/2007(H3N2)) segment 6 sequence 567 567 100% 1e-160 97%
CY041857.1 Influenza A virus (A/mallard/South Dakota/Sg-00125/2007(H3N2)) segment 6 sequence 567 567 100% 1e-160 97%
EU798824.1 Influenza A virus (A/swine/Korea/Asan04/2006(H1N2)) segment 6 neuraminidase (NA) gene, complete cds 567 567 100% 1e-160 97%
EU798821.1 Influenza A virus (A/swine/Korea/JL01/2005(H1N2)) segment 6 neuraminidase (NA) gene, complete cds 567 567 100% 1e-160 97%
AF455691.1 Influenza A virus (A/Swine/Ohio/891/01(H1N2)) neuraminidase (NA) gene, complete cds 567 567 100% 1e-160 97%
AF153237.1 Influenza A virus (A/Swine/Texas/4199-2/98 (H3N2)) neuraminidase gene, partial cds 567 567 100% 1e-160 97%
EU798823.1 Influenza A virus (A/swine/Korea/JL04/2005(H1N2)) segment 6 neuraminidase (NA) gene, complete cds 559 559 100% 2e-158 97%
EU798820.1 Influenza A virus (A/swine/Korea/Hongsong2/2004(H1N2)) segment 6 neuraminidase (NA) gene, complete cds 559 559 100% 2e-158 97%
DQ666927.1 Influenza A virus (A/swine/Korea/S5/2005(H1N2)) segment 6 neuraminidase gene, complete cds 559 559 100% 2e-158 97%
AF455695.1 Influenza A virus (A/Swine/Iowa/930/01(H1N2)) neuraminidase (NA) gene, complete cds 559 559 100% 2e-158 97%
AF268140.1 Influenza A virus (A/Swine/Oklahoma/18089/99(H3N2)) neuraminidase protein gene, partial cds 559 559 100% 2e-158 97%
AF268137.1 Influenza A virus (A/Swine/Wisconsin/14094/99(H3N2)) neuraminidase protein gene, partial cds 559 559 100% 2e-158 97%
AF268135.1 Influenza A virus (A/Swine/Illinois/21587/99(H3N2)) neuraminidase protein gene, partial cds 559 559 100% 2e-158 97%
AF250126.1 Influenza A virus (A/Swine/Indiana/9K035/99 (H1N2)) neuraminidase (NA) gene, complete cds 559 559 100% 2e-158 97%
AF153238.1 Influenza A virus (A/Swine/Minnesota/9088-2/98 (H3N2)) neuraminidase gene, partial cds 559 559 100% 2e-158 97%
AF268136.1 Influenza A virus (A/Swine/Oklahoma/18717/99(H3N2)) neuraminidase protein gene, partial cds 557 557 99% 1e-157 97%
AF268139.1 Influenza A virus (A/Swine/NorthCarolina/16497/99(H3N2)) neuraminidase protein gene, partial cds 551 551 100% 6e-156 96%
CY086898.1 Influenza A virus (A/swine/North Carolina/226125/2010(H1N2)) neuraminidase (NA) gene, complete cds 543 543 100% 1e-153 96%
GQ229314.1 Influenza A virus (A/swine/Hong Kong/78/2003(H1N2)) segment 6 neuraminidase (NA) gene, complete cds 543 543 100% 1e-153 96%
EU798825.1 Influenza A virus (A/swine/Korea/PZ4/2006(H1N2)) segment 6 neuraminidase (NA) gene, complete cds 543 543 100% 1e-153 96%
EU224368.1 Influenza A virus (A/swine/Korea/GC0502/2005(H1N2)) neuraminidase gene, partial cds 543 543 100% 1e-153 96%
EU139841.1 Influenza A virus (A/swine/Kansas/00246/2004(H1N2)) neuraminidase (NA) gene, partial cds 543 543 100% 1e-153 96%
DQ666935.1 Influenza A virus (A/swine/Korea/S11/2005(H1N2)) segment 6 neuraminidase gene, complete cds 543 543 100% 1e-153 96%
AY233391.1 Influenza A virus (A/duck/NC/91347/01(H1N2)) neuraminidase (NA) gene, complete cds 543 543 100% 1e-153 96%
AF455696.1 Influenza A virus (A/Swine/Indiana/P12439/00 (H1N2)) neuraminidase (NA) gene, complete cds 543 543 100% 1e-153 96%
AF455694.1 Influenza A virus (A/Swine/Minnesota/55551/00 (H1N2)) neuraminidase (NA) gene, complete cds 543 543 100% 1e-153 96%
CY012850.1 Influenza A virus (A/New York/554/1996(H3N2)) segment 6, complete sequence 541 541 99% 6e-153 96%
CY011426.1 Influenza A virus (A/New York/577/1996(H3N2)) segment 6, complete sequence 541 541 99% 6e-153 96%
CY011258.1 Influenza A virus (A/New York/557/1996(H3N2)) segment 6, complete sequence 541 541 99% 6e-153 96%
CY010614.1 Influenza A virus (A/New York/603/1996(H3N2)) segment 6, complete sequence 541 541 99% 6e-153 96%
CY010030.1 Influenza A virus (A/New York/591/1996(H3N2)) segment 6, complete sequence 541 541 99% 6e-153 96%
CY010014.1 Influenza A virus (A/New York/567/1996(H3N2)) segment 6, complete sequence 541 541 99% 6e-153 96%
CY009710.1 Influenza A virus (A/New York/586/1996(H3N2)) segment 6, complete sequence 541 541 99% 6e-153 96%
AF533996.1 Influenza A virus (A/Buenos Aires/4559/96(H3N2)) neuraminidase (NA) gene, complete cds 541 541 99% 6e-153 96%
CY086906.1 Influenza A virus (A/swine/North Carolina/226126/2010(H1N2)) neuraminidase (NA) gene, complete cds 537 537 100% 9e-152 96%
CY086890.1 Influenza A virus (A/swine/North Carolina/226124/2010(H1N2)) neuraminidase (NA) gene, complete cds 537 537 100% 9e-152 96%
AF251428.2 Influenza A virus (A/Swine/Minnesota/593/99 (H3N2)) neuraminidase (NA) gene, complete cds 535 535 100% 4e-151 96%
AF251412.3 Influenza A virus (A/Swine/Iowa/533/99 (H3N2)) neuraminidase (NA) gene, complete cds 535 535 100% 4e-151 96%
AF455692.1 Influenza A virus (A/Swine/North Carolina/98225/01(H1N2)) neuraminidase (NA) gene, complete cds 535 535 100% 4e-151 96%
AF251420.1 Influenza A virus (A/Swine/Iowa/569/99 (H3N2)) neuraminidase (NA) gene, complete cds 535 535 100% 4e-151 96%
AF153239.1 Influenza A virus (A/Swine/Iowa/8548-1/98) neuraminidase gene, partial cds 535 535 100% 4e-151 96%
EF584366.1 Influenza A virus (A/Athens/23/97 (H3N2)) segment 6 neuraminidase (NA) gene, complete cds 533 533 99% 1e-150 96%
CY015518.1 Influenza A virus (A/New York/601/1996(H3N2)) segment 6, complete sequence 533 533 99% 1e-150 96%
CY012210.1 Influenza A virus (A/New York/598/1996(H3N2)) segment 6, complete sequence 533 533 99% 1e-150 96%
CY011266.1 Influenza A virus (A/New York/559/1996(H3N2)) segment 6, complete sequence 533 533 99% 1e-150 96%
CY011138.1 Influenza A virus (A/New York/602/1996(H3N2)) segment 6, complete sequence 533 533 99% 1e-150 96%
CY010606.1 Influenza A virus (A/New York/561/1996(H3N2)) segment 6, complete sequence 533 533 99% 1e-150 96%
CY010598.1 Influenza A virus (A/New York/578/1996(H3N2)) segment 6, complete sequence 533 533 99% 1e-150 96%
CY009494.1 Influenza A virus (A/New York/570/1996(H3N2)) segment 6, complete sequence 533 533 99% 1e-150 96%
CY010062.1 Influenza A virus (A/New York/596/1996(H3N2)) segment 6, complete sequence 533 533 99% 1e-150 96%
CY010054.1 Influenza A virus (A/New York/595/1996(H3N2)) segment 6, complete sequence 533 533 99% 1e-150 96%
CY010006.1 Influenza A virus (A/New York/563/1996(H3N2)) segment 6, complete sequence 533 533 99% 1e-150 96%
CY009734.1 Influenza A virus (A/New York/589/1996(H3N2)) segment 6, complete sequence 533 533 99% 1e-150 96%
CY009726.1 Influenza A virus (A/New York/588/1996(H3N2)) segment 6, complete sequence 533 533 99% 1e-150 96%
CY009662.1 Influenza A virus (A/New York/568/1996(H3N2)) segment 6, complete sequence 533 533 99% 1e-150 96%
CY009486.1 Influenza A virus (A/New York/569/1997(H3N2)) segment 6, complete sequence 533 533 99% 1e-150 96%
AF533999.1 Influenza A virus (A/Santa Fe/5456/97(H3N2)) neuraminidase (NA) gene, complete cds 533 533 99% 1e-150 96%
AF533998.1 Influenza A virus (A/Buenos Aires/32/96(H3N2)) neuraminidase (NA) gene, complete cds 533 533 99% 1e-150 96%
AF533995.1 Influenza A virus (A/Buenos Aires/4459/96(H3N2)) neuraminidase (NA) gene, complete cds 533 533 99% 1e-150 96%
AJ457942.1 Influenza A virus (A/South Africa/1147/96(H3N2)) NA gene for neuraminidase, genomic RNA 533 533 99% 1e-150 96%
AJ307600.1 Influenza A virus (A/human/Montreal/MTL63816/00(H3N2)) NA gene for neuramindase, genomic RNA 533 533 99% 1e-150 96%
AF316814.1 Influenza A virus (A/Athens/1/98 (H3N2)) truncated N2 neuraminidase gene, partial cds 533 533 99% 1e-150 96%
AF316812.1 Influenza A virus (A/Athens/2/97 (H3N2)) N2 neuraminidase gene, partial cds 533 533 99% 1e-150 96%
CY006621.1 Influenza A virus (A/New York/546/1998(H3N2)) segment 6, complete sequence 533 533 99% 1e-150 96%
CY006493.1 Influenza A virus (A/New York/520/1998(H3N2)) segment 6, complete sequence 533 533 99% 1e-150 96%
CY086938.1 Influenza A virus (A/swine/North Carolina/239108/2010(H1N2)) neuraminidase (NA) gene, complete cds 527 527 100% 9e-149 95%
EU798837.1 Influenza A virus (A/swine/Korea/CY10/2007(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 527 527 100% 9e-149 95%
EU798828.1 Influenza A virus (A/swine/Korea/CY08/2007(H1N2)) segment 6 neuraminidase (NA) gene, complete cds 527 527 100% 9e-149 95%
EU798827.1 Influenza A virus (A/swine/Korea/PZ14/2006(H1N2)) segment 6 neuraminidase (NA) gene, complete cds 527 527 100% 9e-149 95%
EU798826.1 Influenza A virus (A/swine/Korea/PZ7/2006(H1N2)) segment 6 neuraminidase (NA) gene, complete cds 527 527 100% 9e-149 95%
EU798822.1 Influenza A virus (A/swine/Korea/JL02/2005(H1N2)) segment 6 neuraminidase (NA) gene, complete cds 527 527 100% 9e-149 95%
AY038015.1 Influenza A virus (A/Turkey/MO/24093/99(H1N2)) neuraminidase (N2) gene, complete cds 527 527 100% 9e-149 95%
AF455693.1 Influenza A virus (A/Swine/North Carolina/93523/01 (H1N2)) neuraminidase (NA) gene, complete cds 527 527 100% 9e-149 95%
AF251404.1 Influenza A virus (A/Swine/Nebraska/209/98 (H3N2)) neuraminidase (NA) gene, complete cds 527 527 100% 9e-149 95%
CY039081.1 Influenza A virus (A/Sydney/5/1997(H3N2)) segment 6, complete sequence 525 525 99% 3e-148 95%
CY036849.1 Influenza A virus (A/Siena/1/1997(H3N2)) segment 6, complete sequence 525 525 99% 3e-148 95%
EU857298.1 Influenza A virus (A/Hong Kong/CUHK4803/1997(H3N2)) neuraminidase (NA) gene, complete cds 525 525 99% 3e-148 95%
EU857268.1 Influenza A virus (A/Hong Kong/CUHK33915/1999(H3N2)) neuraminidase (NA) gene, complete cds 525 525 99% 3e-148 95%
EU857163.1 Influenza A virus (A/Hong Kong/CUHK18230/1998(H3N2)) neuraminidase (NA) gene, complete cds 525 525 99% 3e-148 95%
EU857160.1 Influenza A virus (A/Hong Kong/CUHK18036/1998(H3N2)) neuraminidase (NA) gene, complete cds 525 525 99% 3e-148 95%
EU857120.1 Influenza A virus (A/Hong Kong/CUHK12160/1997(H3N2)) neuraminidase (NA) gene, complete cds 525 525 99% 3e-148 95%
EU789366.1 Influenza A virus (A/swine/Korea/GC0407/2005(H3N2)) neuraminidase (NA) gene, partial cds 525 525 99% 3e-148 95%
EU301273.1 Influenza A virus (A/swine/Korea/JNS06/2004(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 525 525 99% 3e-148 95%
EF584372.1 Influenza A virus (A/Victoria/69/1997(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 525 525 99% 3e-148 95%
EF584360.1 Influenza A virus (A/Moscow/41/1997(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 525 525 99% 3e-148 95%
EF584359.1 Influenza A virus (A/Japan/1268/1998(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 525 525 99% 3e-148 95%
EF584354.1 Influenza A virus (A/Texas/8/1997(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 525 525 99% 3e-148 95%
EF584349.1 Influenza A virus (A/Turkey/419/1998(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 525 525 99% 3e-148 95%

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Tue Mar 08, 2011 1:11 pm 
Online

Joined: Wed Aug 19, 2009 10:42 am
Posts: 27559
Location: Pittsburgh, PA USA
Top 100 PB2 matches

JF346719.1 Influenza A virus (A/swine/Korea/4941/2010(H1N2)) segment 1 polymerase PB2 (PB2) gene, partial cds 1100 1100 100% 0.0 100%
JF346718.1 Influenza A virus (A/swine/Korea/4940/2010(H1N2)) segment 1 polymerase PB2 (PB2) gene, partial cds 1100 1100 100% 0.0 100%
CY075011.1 Influenza A virus (A/Thailand/CU-H910/2009(H1N1)) segment 1 sequence 1092 1092 100% 0.0 99%
CY075003.1 Influenza A virus (A/Thailand/CU-H847/2009(H1N1)) segment 1 sequence 1092 1092 100% 0.0 99%
CY074995.1 Influenza A virus (A/Thailand/CU-H572/2009(H1N1)) segment 1 sequence 1092 1092 100% 0.0 99%
CY074987.1 Influenza A virus (A/Thailand/CU-H567/2009(H1N1)) segment 1 sequence 1092 1092 100% 0.0 99%
CY068921.1 Influenza A virus (A/Japan/NHRC0003/2009(H1N1)) segment 1, complete sequence 1092 1092 100% 0.0 99%
CY065967.1 Influenza A virus (A/Japan/NHRC0002/2009(H1N1)) segment 1, complete sequence 1092 1092 100% 0.0 99%
CY065959.1 Influenza A virus (A/Japan/NHRC0001/2009(H1N1)) segment 1, complete sequence 1092 1092 100% 0.0 99%
CY057741.1 Influenza A virus (A/Wisconsin/629-D01140/2009(H1N1)) segment 1, complete sequence 1092 1092 100% 0.0 99%
CY057629.1 Influenza A virus (A/Wisconsin/629-S1313/2009(H1N1)) segment 1, complete sequence 1092 1092 100% 0.0 99%
CY057002.1 Influenza A virus (A/Wisconsin/629-D00734/2009(H1N1)) segment 1, complete sequence 1092 1092 100% 0.0 99%
CY054762.1 Influenza A virus (A/California/VRDL19/2009(H1N1)) segment 1, complete sequence 1092 1092 100% 0.0 99%
CY080328.1 Influenza A virus (A/Thailand/H1818/2010(H1N1)) segment 1 sequence 1088 1088 100% 0.0 99%
CY087032.1 Influenza A virus (A/New York/4557/2009(H1N1)) polymerase PB2 (PB2) gene, complete cds 1084 1084 100% 0.0 99%
CY087040.1 Influenza A virus (A/New York/4631/2009(H1N1)) polymerase PB2 (PB2) gene, complete cds 1084 1084 100% 0.0 99%
CY087015.1 Influenza A virus (A/New York/3565/2009(H1N1)) PB2 gene, complete sequence 1084 1084 100% 0.0 99%
CY087007.1 Influenza A virus (A/New York/3256/2009(N1)) polymerase PB2 (PB2) gene, complete cds 1084 1084 100% 0.0 99%
CY086992.1 Influenza A virus (A/New York/3250/2009(H1N1)) polymerase PB2 (PB2) gene, partial cds 1084 1084 100% 0.0 99%
CY086984.1 Influenza A virus (A/New York/3217/2009(H1N1)) polymerase PB2 (PB2) gene, complete cds 1084 1084 100% 0.0 99%
CY086976.1 Influenza A virus (A/New York/3198/2009(H1N1)) polymerase PB2 (PB2) gene, complete cds 1084 1084 100% 0.0 99%
CY086968.1 Influenza A virus (A/New York/3197/2009(N1)) polymerase PB2 (PB2) gene, complete cds 1084 1084 100% 0.0 99%
CY040724.2 Influenza A virus (A/New York/3238/2009(H1N1)) polymerase PB2 (PB2) gene, partial cds 1084 1084 100% 0.0 99%
CY084461.1 Influenza A virus (A/New York/6418/2009(H1N1)) polymerase PB2 (PB2) gene, complete cds 1084 1084 100% 0.0 99%
CY084445.1 Influenza A virus (A/New York/6064/2009(H1N1)) polymerase PB2 (PB2) gene, complete cds 1084 1084 100% 0.0 99%
CY083949.1 Influenza A virus (A/San Diego/INS194/2009(H1N1)) polymerase PB2 (PB2) gene, complete cds 1084 1084 100% 0.0 99%
CY083941.1 Influenza A virus (A/Warsaw/INS149/2009(H1N1)) polymerase PB2 (PB2) gene, complete cds 1084 1084 100% 0.0 99%
CY083933.1 Influenza A virus (A/Warsaw/INS148/2009(H1N1)) polymerase PB2 (PB2) gene, complete cds 1084 1084 100% 0.0 99%
CY083917.1 Influenza A virus (A/Aalborg/INS132/2009(H1N1)) polymerase PB2 (PB2) gene, complete cds 1084 1084 100% 0.0 99%
CY083893.1 Influenza A virus (A/San Diego/INS72/2009(H1N1)) polymerase PB2 (PB2) gene, complete cds 1084 1084 100% 0.0 99%
CY083869.1 Influenza A virus (A/District of Columbia/INS47/2009(H1N1)) polymerase PB2 (PB2) gene, complete cds 1084 1084 100% 0.0 99%
CY083861.1 Influenza A virus (A/Pensacola/INS39/2009(H1N1)) polymerase PB2 (PB2) gene, complete cds 1084 1084 100% 0.0 99%
CY083845.1 Influenza A virus (A/San Diego/INS14/2009(H1N1)) polymerase PB2 (PB2) gene, complete cds 1084 1084 100% 0.0 99%
CY083837.1 Influenza A virus (A/San Diego/INS07/2009(H1N1)) polymerase PB2 (PB2) gene, complete cds 1084 1084 100% 0.0 99%
CY083812.1 Influenza A virus (A/Madrid/INS377/2009(H1N1)) polymerase PB2 (PB2) gene, partial cds 1084 1084 100% 0.0 99%
CY083794.1 Influenza A virus (A/Odense/INS309/2009(H1N1)) polymerase PB2 (PB2) gene, complete cds 1084 1084 100% 0.0 99%
CY083782.1 Influenza A virus (A/Aalborg/INS282/2009(H1N1)) polymerase PB2 (PB2) gene, complete cds 1084 1084 100% 0.0 99%
CY083744.1 Influenza A virus (A/Madrid/INS130/2009(H1N1)) polymerase PB2 (PB2) gene, complete cds 1084 1084 100% 0.0 99%
CY083720.1 Influenza A virus (A/Madrid/INS112/2009(H1N1)) polymerase PB2 (PB2) gene, complete cds 1084 1084 100% 0.0 99%
CY083697.1 Influenza A virus (A/Terrassa/INS94/2009(H1N1)) polymerase PB2 (PB2) gene, partial cds 1084 1084 100% 0.0 99%
CY083676.1 Influenza A virus (A/San Diego/INS62/2009(H1N1)) polymerase PB2 (PB2) gene, complete cds 1084 1084 100% 0.0 99%
CY083668.1 Influenza A virus (A/San Diego/INS41/2009(H1N1)) polymerase PB2 (PB2) gene, partial cds 1084 1084 100% 0.0 99%
CY083654.1 Influenza A virus (A/District of Columbia/INS22/2009(H1N1)) polymerase PB2 (PB2) gene, partial cds 1084 1084 100% 0.0 99%
CY083604.1 Influenza A virus (A/Managua/WRAIR8997F/2009(H1N1)) polymerase PB2 (PB2) gene, complete cds 1084 1084 100% 0.0 99%
CY083580.1 Influenza A virus (A/Lima/WRAIR8689F/2009(H1N1)) polymerase PB2 (PB2) gene, complete cds 1084 1084 100% 0.0 99%
CY083572.1 Influenza A virus (A/Lima/WRAIR8648F/2009(H1N1)) polymerase PB2 (PB2) gene, complete cds 1084 1084 100% 0.0 99%
CY083564.1 Influenza A virus (A/Lima/WRAIR8511F/2009(H1N1)) polymerase PB2 (PB2) gene, complete cds 1084 1084 100% 0.0 99%
CY083556.1 Influenza A virus (A/Budapest/WRAIR2411N/2009(H1N1)) polymerase PB2 (PB2) gene, complete cds 1084 1084 100% 0.0 99%
CY083516.1 Influenza A virus (A/Lima/WRAIR1695P/2009(H1N1)) polymerase PB2 (PB2) gene, complete cds 1084 1084 100% 0.0 99%
CY083508.1 Influenza A virus (A/Piura/WRAIR1694P/2009(H1N1)) polymerase PB2 (PB2) gene, complete cds 1084 1084 100% 0.0 99%
CY083500.1 Influenza A virus (A/Managua/WRAIR1693P/2009(H1N1)) polymerase PB2 (PB2) gene, complete cds 1084 1084 100% 0.0 99%
CY083484.1 Influenza A virus (A/Mexico City/WRAIR1691N/2009(H1N1)) polymerase PB2 (PB2) gene, complete cds 1084 1084 100% 0.0 99%
CY083460.1 Influenza A virus (A/Lima/WRAIR1688P/2009(H1N1)) polymerase PB2 (PB2) gene, complete cds 1084 1084 100% 0.0 99%
CY083428.1 Influenza A virus (A/San Diego/WRAIR1668P/2009(H1N1)) polymerase PB2 (PB2) gene, complete cds 1084 1084 100% 0.0 99%
CY083420.1 Influenza A virus (A/San Diego/WRAIR1667P/2009(H1N1)) polymerase PB2 (PB2) gene, complete cds 1084 1084 100% 0.0 99%
CY083412.1 Influenza A virus (A/San Diego/WRAIR1666P/2009(H1N1)) polymerase PB2 (PB2) gene, complete cds 1084 1084 100% 0.0 99%
CY083404.1 Influenza A virus (A/San Diego/WRAIR1665P/2009(H1N1)) polymerase PB2 (PB2) gene, complete cds 1084 1084 100% 0.0 99%
CY083388.1 Influenza A virus (A/San Diego/WRAIR1663P/2009(H1N1)) polymerase PB2 (PB2) gene, complete cds 1084 1084 100% 0.0 99%
CY083372.1 Influenza A virus (A/Pendleton/WRAIR1661P/2009(H1N1)) polymerase PB2 (PB2) gene, complete cds 1084 1084 100% 0.0 99%
CY083364.1 Influenza A virus (A/South Carolina/WRAIR1660P/2009(H1N1)) polymerase PB2 (PB2) gene, complete cds 1084 1084 100% 0.0 99%
CY083356.1 Influenza A virus (A/San Diego/WRAIR1658P/2009(H1N1)) polymerase PB2 (PB2) gene, complete cds 1084 1084 100% 0.0 99%
CY083636.1 Influenza A virus (A/San Diego/WRAIR1657P/2009(H1N1)) polymerase PB2 (PB2) gene, complete cds 1084 1084 100% 0.0 99%
CY083341.1 Influenza A virus (A/San Diego/WRAIR1656P/2009(H1N1)) polymerase PB2 (PB2) gene, complete cds 1084 1084 100% 0.0 99%
CY083325.1 Influenza A virus (A/Cape May/WRAIR1653P/2009(H1N1)) polymerase PB2 (PB2) gene, complete cds 1084 1084 100% 0.0 99%
CY083317.1 Influenza A virus (A/Great Lakes/WRAIR1652P/2009(H1N1)) polymerase PB2 (PB2) gene, complete cds 1084 1084 100% 0.0 99%
CY083309.1 Influenza A virus (A/San Diego/WRAIR1649P/2009(H1N1)) polymerase PB2 (PB2) gene, complete cds 1084 1084 100% 0.0 99%
CY083293.1 Influenza A virus (A/San Diego/WRAIR1647P/2009(H1N1)) polymerase PB2 (PB2) gene, complete cds 1084 1084 100% 0.0 99%
CY083285.1 Influenza A virus (A/San Diego/WRAIR1646P/2009(H1N1)) polymerase PB2 (PB2) gene, complete cds 1084 1084 100% 0.0 99%
CY083261.1 Influenza A virus (A/San Diego/WRAIR1643P/2009(H1N1)) polymerase PB2 (PB2) gene, complete cds 1084 1084 100% 0.0 99%
CY083237.1 Influenza A virus (A/Virginia/WRAIR1511P/2009(H1N1)) polymerase PB2 (PB2) gene, complete cds 1084 1084 100% 0.0 99%
CY083221.1 Influenza A virus (A/California/WRAIR1507P/2009(H1N1)) polymerase PB2 (PB2) gene, complete cds 1084 1084 100% 0.0 99%
CY083213.1 Influenza A virus (A/New Jersey/WRAIR1506P/2009(H1N1)) polymerase PB2 (PB2) gene, complete cds 1084 1084 100% 0.0 99%
CY083205.1 Influenza A virus (A/New Jersey/WRAIR1504P/2009(H1N1)) polymerase PB2 (PB2) gene, complete cds 1084 1084 100% 0.0 99%
CY083189.1 Influenza A virus (A/California/WRAIR1502P/2009(H1N1)) polymerase PB2 (PB2) gene, complete cds 1084 1084 100% 0.0 99%
CY083181.1 Influenza A virus (A/South Carolina/WRAIR1501P/2009(H1N1)) polymerase PB2 (PB2) gene, complete cds 1084 1084 100% 0.0 99%
CY083173.1 Influenza A virus (A/South Carolina/WRAIR1500P/2009(H1N1)) polymerase PB2 (PB2) gene, complete cds 1084 1084 100% 0.0 99%
CY083165.1 Influenza A virus (A/New Jersey/WRAIR1499P/2009(H1N1)) polymerase PB2 (PB2) gene, complete cds 1084 1084 100% 0.0 99%
CY083125.1 Influenza A virus (A/Lima/WRAIR0672F/2009(H1N1)) polymerase PB2 (PB2) gene, complete cds 1084 1084 100% 0.0 99%
CY083101.1 Influenza A virus (A/Piura/WRAIR0603F/2009(H1N1)) polymerase PB2 (PB2) gene, complete cds 1084 1084 100% 0.0 99%
CY083085.1 Influenza A virus (A/Bogota/WRAIR0442T/2009(H1N1)) polymerase PB2 (PB2) gene, complete cds 1084 1084 100% 0.0 99%
CY083069.1 Influenza A virus (A/Bogota/WRAIR0435T/2009(H1N1)) polymerase PB2 (PB2) gene, complete cds 1084 1084 100% 0.0 99%
CY083061.1 Influenza A virus (A/Bogota/WRAIR0435N/2009(H1N1)) polymerase PB2 (PB2) gene, complete cds 1084 1084 100% 0.0 99%
CY082991.1 Influenza A virus (A/Cambodia/NHRCC00009/2009(H1N1)) polymerase PB2 (PB2) gene, complete cds 1084 1084 100% 0.0 99%
CY081557.1 Influenza A virus (A/Cambodia/NHRCC00010/2009(H1N1)) polymerase PB2 (PB2) gene, complete cds 1084 1084 100% 0.0 99%
CY081549.1 Influenza A virus (A/Cambodia/NHRCC00008/2009(H1N1)) polymerase PB2 (PB2) gene, complete cds 1084 1084 100% 0.0 99%
CY081541.1 Influenza A virus (A/Cambodia/NHRCC00007/2009(H1N1)) polymerase PB2 (PB2) gene, complete cds 1084 1084 100% 0.0 99%
CY081533.1 Influenza A virus (A/Cambodia/NHRCC00006/2009(H1N1)) polymerase PB2 (PB2) gene, complete cds 1084 1084 100% 0.0 99%
CY081525.1 Influenza A virus (A/Cambodia/NHRCC00005/2009(H1N1)) polymerase PB2 (PB2) gene, complete cds 1084 1084 100% 0.0 99%
CY081517.1 Influenza A virus (A/Cambodia/NHRCC00004/2009(H1N1)) polymerase PB2 (PB2) gene, complete cds 1084 1084 100% 0.0 99%
CY081509.1 Influenza A virus (A/Cambodia/NHRCC00003/2009(H1N1)) polymerase PB2 (PB2) gene, complete cds 1084 1084 100% 0.0 99%
CY081501.1 Influenza A virus (A/Cambodia/NHRCC00002/2009(H1N1)) polymerase PB2 (PB2) gene, complete cds 1084 1084 100% 0.0 99%
CY081493.1 Influenza A virus (A/Cambodia/NHRCC00001/2009(H1N1)) polymerase PB2 (PB2) gene, complete cds 1084 1084 100% 0.0 99%
CY081056.1 Influenza A virus (A/New York/3720/2009(mixed)) polymerase PB2 (PB2) gene, partial cds 1084 1084 100% 0.0 99%
CY080437.1 Influenza A virus (A/swine/QLD/09-02865-07/2009(H1N1)) segment 1 sequence 1084 1084 100% 0.0 99%
CY080429.1 Influenza A virus (A/swine/VIC/09-02797-62/2009(H1N1)) segment 1 sequence 1084 1084 100% 0.0 99%
CY080421.1 Influenza A virus (A/swine/VIC/09-02767-01/2009(H1N1)) segment 1 sequence 1084 1084 100% 0.0 99%
HQ606469.1 Influenza A virus (A/Shiraz/14/2010(H1N1)) segment 1 polymerase PB2 (PB2) gene, partial cds 1084 1084 100% 0.0 99%
CY076792.1 Influenza A virus (A/Ontario/156785/2009(H1N1)) segment 1 sequence 1084 1084 100% 0.0 99%
CY076784.1 Influenza A virus (A/Ontario/152846/2009(H1N1)) segment 1 sequence 1084 1084 100% 0.0 99%
CY084453.1 Influenza A virus (A/New York/6902/2009(H1N1)) polymerase PB2 (PB2) gene, complete cds 1076 1076 100% 0.0 99%

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Tue Mar 08, 2011 1:12 pm 
Online

Joined: Wed Aug 19, 2009 10:42 am
Posts: 27559
Location: Pittsburgh, PA USA
Top 100 PB1 matches

CY087030.1 Influenza A virus (A/New York/4557/2009(H1N1)) polymerase PB1 (PB1) gene, partial cds; and PB1-F2 gene, complete sequence 1011 1011 100% 0.0 100%
CY087014.2 Influenza A virus (A/New York/3565/2009(H1N1)) polymerase PB1 (PB1) gene, complete cds; and PB1-F2 gene, complete sequence 1011 1011 100% 0.0 100%
CY086999.1 Influenza A virus (A/New York/3251/2009(H1N1)) polymerase PB1 (PB1) gene, complete cds; and PB1-F2 gene, complete sequence 1011 1011 100% 0.0 100%
CY086991.1 Influenza A virus (A/New York/3250/2009(H1N1)) polymerase PB1 (PB1) gene, partial cds; and PB1-F2 gene, complete sequence 1011 1011 100% 0.0 100%
CY086983.1 Influenza A virus (A/New York/3217/2009(H1N1)) polymerase PB1 (PB1) gene, complete cds; and PB1-F2 gene, complete sequence 1011 1011 100% 0.0 100%
CY086975.1 Influenza A virus (A/New York/3198/2009(H1N1)) polymerase PB1 (PB1) gene, complete cds; and PB1-F2 gene, complete sequence 1011 1011 100% 0.0 100%
CY086967.1 Influenza A virus (A/New York/3197/2009(N1)) polymerase PB1 (PB1) gene, partial cds; and PB1-F2 gene, complete sequence 1011 1011 100% 0.0 100%
CY040723.2 Influenza A virus (A/New York/3238/2009(H1N1)) polymerase PB1 (PB1) gene, complete cds; and PB1-F2 gene, complete sequence 1011 1011 100% 0.0 100%
JF346701.1 Influenza A virus (A/swine/Korea/4941/2010(H1N2)) segment 2 polymerase PB1 (PB1) gene, partial cds 1011 1011 100% 0.0 100%
JF346696.1 Influenza A virus (A/swine/Korea/4382/2009(H1N2)) segment 2 polymerase PB1 (PB1) gene, partial cds 1011 1011 100% 0.0 100%
JF290389.1 Influenza A virus (A/swine/England/1382/2010(H1N2)) segment 2 polymerase PB1 (PB1) gene, complete cds; and nonfunctional PB1-F2 protein (PB1-F2) gene, complete sequence 1011 1011 100% 0.0 100%
CY084460.1 Influenza A virus (A/New York/6418/2009(H1N1)) polymerase PB1 (PB1) gene, complete cds; and PB1-F2 gene, complete sequence 1011 1011 100% 0.0 100%
CY084444.1 Influenza A virus (A/New York/6064/2009(H1N1)) polymerase PB1 (PB1) gene, complete cds; and PB1-F2 gene, complete sequence 1011 1011 100% 0.0 100%
CY083948.1 Influenza A virus (A/San Diego/INS194/2009(H1N1)) polymerase PB1 (PB1) gene, complete cds; and PB1-F2 gene, complete sequence 1011 1011 100% 0.0 100%
CY083908.1 Influenza A virus (A/Athens/INS86/2009(H1N1)) polymerase PB1 (PB1) gene, complete cds; and PB1-F2 gene, complete sequence 1011 1011 100% 0.0 100%
CY083900.1 Influenza A virus (A/San Diego/INS73/2009(H1N1)) polymerase PB1 (PB1) gene, complete cds; and PB1-F2 gene, complete sequence 1011 1011 100% 0.0 100%
CY083892.1 Influenza A virus (A/San Diego/INS72/2009(H1N1)) polymerase PB1 (PB1) gene, complete cds; and PB1-F2 gene, complete sequence 1011 1011 100% 0.0 100%
CY083868.1 Influenza A virus (A/District of Columbia/INS47/2009(H1N1)) polymerase PB1 (PB1) gene, complete cds; and PB1-F2 gene, complete sequence 1011 1011 100% 0.0 100%
CY083860.1 Influenza A virus (A/Pensacola/INS39/2009(H1N1)) polymerase PB1 (PB1) gene, complete cds; and PB1-F2 gene, complete sequence 1011 1011 100% 0.0 100%
CY083852.1 Influenza A virus (A/District of Columbia/INS23/2009(H1N1)) polymerase PB1 (PB1) gene, complete cds; and PB1-F2 gene, complete sequence 1011 1011 100% 0.0 100%
CY083844.1 Influenza A virus (A/San Diego/INS14/2009(H1N1)) polymerase PB1 (PB1) gene, complete cds; and PB1-F2 gene, complete sequence 1011 1011 100% 0.0 100%
CY083836.1 Influenza A virus (A/San Diego/INS07/2009(H1N1)) polymerase PB1 (PB1) gene, complete cds; and PB1-F2 gene, complete sequence 1011 1011 100% 0.0 100%
CY083823.1 Influenza A virus (A/Los Angeles/INS423/2010(H1N1)) polymerase PB1 (PB1) gene, complete cds; and PB1-F2 gene, complete sequence 1011 1011 100% 0.0 100%
CY083751.1 Influenza A virus (A/Barcelona/INS189/2009(H1N1)) polymerase PB1 (PB1) gene, complete cds; and PB1-F2 gene, complete sequence 1011 1011 100% 0.0 100%
CY083743.1 Influenza A virus (A/Madrid/INS130/2009(H1N1)) polymerase PB1 (PB1) gene, complete cds; and PB1-F2 gene, complete sequence 1011 1011 100% 0.0 100%
CY083719.1 Influenza A virus (A/Madrid/INS112/2009(H1N1)) polymerase PB1 (PB1) gene, complete cds; and PB1-F2 gene, complete sequence 1011 1011 100% 0.0 100%
CY083704.1 Influenza A virus (A/Warsaw/INS99/2009(mixed)) polymerase PB1 (PB1) gene, complete cds; and PB1-F2 gene, complete sequence 1011 1011 100% 0.0 100%
CY083667.1 Influenza A virus (A/San Diego/INS41/2009(H1N1)) polymerase PB1 (PB1) gene, complete cds; and PB1-F2 gene, complete sequence 1011 1011 100% 0.0 100%
CY083653.1 Influenza A virus (A/District of Columbia/INS22/2009(H1N1)) polymerase PB1 (PB1) gene, complete cds; and PB1-F2 gene, complete sequence 1011 1011 100% 0.0 100%
CY083645.1 Influenza A virus (A/San Diego/INS13/2009(H1N1)) polymerase PB1 (PB1) gene, complete cds; and PB1-F2 gene, complete sequence 1011 1011 100% 0.0 100%
CY083613.1 Influenza A virus (A/Lima/WRAIR9202F/2009(H1N1)) polymerase PB1 (PB1) gene, complete cds; and PB1-F2 gene, complete sequence 1011 1011 100% 0.0 100%
CY083589.1 Influenza A virus (A/Lima/WRAIR8893F/2009(H1N1)) polymerase PB1 (PB1) gene, complete cds; and PB1-F2 gene, complete sequence 1011 1011 100% 0.0 100%
CY083557.1 Influenza A virus (A/Budapest/WRAIR2411N/2009(H1N1)) polymerase PB1 (PB1) gene, complete cds; and PB1-F2 gene, complete sequence 1011 1011 100% 0.0 100%
CY083549.1 Influenza A virus (A/Budapest/WRAIR2393T/2009(H1N1)) polymerase PB1 (PB1) gene, complete cds; and PB1-F2 gene, complete sequence 1011 1011 100% 0.0 100%
CY083533.1 Influenza A virus (A/Mexico City/WRAIR1752N/2010(H1N1)) polymerase PB1 (PB1) gene, complete cds; and PB1-F2 gene, complete sequence 1011 1011 100% 0.0 100%
CY083525.1 Influenza A virus (A/Lima/WRAIR1696P/2009(H1N1)) polymerase PB1 (PB1) gene, complete cds; and PB1-F2 gene, complete sequence 1011 1011 100% 0.0 100%
CY083517.1 Influenza A virus (A/Lima/WRAIR1695P/2009(H1N1)) polymerase PB1 (PB1) gene, complete cds; and PB1-F2 gene, complete sequence 1011 1011 100% 0.0 100%
CY083501.1 Influenza A virus (A/Managua/WRAIR1693P/2009(H1N1)) polymerase PB1 (PB1) gene, complete cds; and PB1-F2 gene, complete sequence 1011 1011 100% 0.0 100%
CY083493.1 Influenza A virus (A/Chicago/WRAIR1691P/2009(H1N1)) polymerase PB1 (PB1) gene, complete cds; and PB1-F2 gene, complete sequence 1011 1011 100% 0.0 100%
CY083485.1 Influenza A virus (A/Mexico City/WRAIR1691N/2009(H1N1)) polymerase PB1 (PB1) gene, complete cds; and PB1-F2 gene, complete sequence 1011 1011 100% 0.0 100%
CY083461.1 Influenza A virus (A/Lima/WRAIR1688P/2009(H1N1)) polymerase PB1 (PB1) gene, complete cds; and PB1-F2 gene, complete sequence 1011 1011 100% 0.0 100%
CY083445.1 Influenza A virus (A/Mexico City/WRAIR1679N/2009(H1N1)) polymerase PB1 (PB1) gene, complete cds; and PB1-F2 gene, complete sequence 1011 1011 100% 0.0 100%
CY083437.1 Influenza A virus (A/Ft.Benning/WRAIR1669P/2009(H1N1)) polymerase PB1 (PB1) gene, complete cds; and PB1-F2 gene, complete sequence 1011 1011 100% 0.0 100%
CY083429.1 Influenza A virus (A/San Diego/WRAIR1668P/2009(H1N1)) polymerase PB1 (PB1) gene, complete cds; and PB1-F2 gene, complete sequence 1011 1011 100% 0.0 100%
CY083421.1 Influenza A virus (A/San Diego/WRAIR1667P/2009(H1N1)) polymerase PB1 (PB1) gene, complete cds; and PB1-F2 gene, complete sequence 1011 1011 100% 0.0 100%
CY083405.1 Influenza A virus (A/San Diego/WRAIR1665P/2009(H1N1)) polymerase PB1 (PB1) gene, complete cds; and PB1-F2 gene, complete sequence 1011 1011 100% 0.0 100%
CY083397.1 Influenza A virus (A/Great Lakes/WRAIR1664P/2009(H1N1)) polymerase PB1 (PB1) gene, complete cds; and PB1-F2 gene, complete sequence 1011 1011 100% 0.0 100%
CY083389.1 Influenza A virus (A/San Diego/WRAIR1663P/2009(H1N1)) polymerase PB1 (PB1) gene, complete cds; and PB1-F2 gene, complete sequence 1011 1011 100% 0.0 100%
CY083381.1 Influenza A virus (A/San Diego/WRAIR1662P/2009(H1N1)) polymerase PB1 (PB1) gene, complete cds; and PB1-F2 gene, complete sequence 1011 1011 100% 0.0 100%
CY083373.1 Influenza A virus (A/Pendleton/WRAIR1661P/2009(H1N1)) polymerase PB1 (PB1) gene, complete cds; and PB1-F2 gene, complete sequence 1011 1011 100% 0.0 100%
CY083365.1 Influenza A virus (A/South Carolina/WRAIR1660P/2009(H1N1)) polymerase PB1 (PB1) gene, complete cds; and PB1-F2 gene, complete sequence 1011 1011 100% 0.0 100%
CY083357.1 Influenza A virus (A/San Diego/WRAIR1658P/2009(H1N1)) polymerase PB1 (PB1) gene, complete cds; and PB1-F2 gene, complete sequence 1011 1011 100% 0.0 100%
CY083342.1 Influenza A virus (A/San Diego/WRAIR1656P/2009(H1N1)) polymerase PB1 (PB1) gene, complete cds; and PB1-F2 gene, complete sequence 1011 1011 100% 0.0 100%
CY083334.1 Influenza A virus (A/San Diego/WRAIR1654P/2009(H1N1)) polymerase PB1 (PB1) gene, complete cds; and PB1-F2 gene, complete sequence 1011 1011 100% 0.0 100%
CY083318.1 Influenza A virus (A/Great Lakes/WRAIR1652P/2009(H1N1)) polymerase PB1 (PB1) gene, complete cds; and PB1-F2 gene, complete sequence 1011 1011 100% 0.0 100%
CY083302.1 Influenza A virus (A/San Diego/WRAIR1648P/2009(H1N1)) polymerase PB1 (PB1) gene, complete cds; and PB1-F2 gene, complete sequence 1011 1011 100% 0.0 100%
CY083286.1 Influenza A virus (A/San Diego/WRAIR1646P/2009(H1N1)) polymerase PB1 (PB1) gene, complete cds; and PB1-F2 gene, complete sequence 1011 1011 100% 0.0 100%
CY083278.1 Influenza A virus (A/San Diego/WRAIR1645P/2009(H1N1)) polymerase PB1 (PB1) gene, complete cds; and PB1-F2 gene, complete sequence 1011 1011 100% 0.0 100%
CY083270.1 Influenza A virus (A/San Diego/WRAIR1644P/2009(H1N1)) polymerase PB1 (PB1) gene, complete cds; and PB1-F2 gene, complete sequence 1011 1011 100% 0.0 100%
CY083262.1 Influenza A virus (A/San Diego/WRAIR1643P/2009(H1N1)) polymerase PB1 (PB1) gene, complete cds; and PB1-F2 gene, complete sequence 1011 1011 100% 0.0 100%
CY083254.1 Influenza A virus (A/San Diego/WRAIR1642P/2009(H1N1)) polymerase PB1 (PB1) gene, complete cds; and PB1-F2 gene, complete sequence 1011 1011 100% 0.0 100%
CY083238.1 Influenza A virus (A/Virginia/WRAIR1511P/2009(H1N1)) polymerase PB1 (PB1) gene, complete cds; and PB1-F2 gene, complete sequence 1011 1011 100% 0.0 100%
CY083222.1 Influenza A virus (A/California/WRAIR1507P/2009(H1N1)) polymerase PB1 (PB1) gene, complete cds; and PB1-F2 gene, complete sequence 1011 1011 100% 0.0 100%
CY083214.1 Influenza A virus (A/New Jersey/WRAIR1506P/2009(H1N1)) polymerase PB1 (PB1) gene, complete cds; and PB1-F2 gene, complete sequence 1011 1011 100% 0.0 100%
CY083198.1 Influenza A virus (A/South Carolina/WRAIR1503P/2009(H1N1)) polymerase PB1 (PB1) gene, complete cds; and PB1-F2 gene, complete sequence 1011 1011 100% 0.0 100%
CY083190.1 Influenza A virus (A/California/WRAIR1502P/2009(H1N1)) polymerase PB1 (PB1) gene, complete cds; and PB1-F2 gene, complete sequence 1011 1011 100% 0.0 100%
CY083182.1 Influenza A virus (A/South Carolina/WRAIR1501P/2009(H1N1)) polymerase PB1 (PB1) gene, complete cds; and PB1-F2 gene, complete sequence 1011 1011 100% 0.0 100%
CY083174.1 Influenza A virus (A/South Carolina/WRAIR1500P/2009(H1N1)) polymerase PB1 (PB1) gene, complete cds; and PB1-F2 gene, complete sequence 1011 1011 100% 0.0 100%
CY083166.1 Influenza A virus (A/New Jersey/WRAIR1499P/2009(H1N1)) polymerase PB1 (PB1) gene, complete cds; and PB1-F2 gene, complete sequence 1011 1011 100% 0.0 100%
CY083126.1 Influenza A virus (A/Lima/WRAIR0672F/2009(H1N1)) polymerase PB1 (PB1) gene, complete cds; and PB1-F2 gene, complete sequence 1011 1011 100% 0.0 100%
CY083102.1 Influenza A virus (A/Piura/WRAIR0603F/2009(H1N1)) polymerase PB1 (PB1) gene, complete cds; and PB1-F2 gene, complete sequence 1011 1011 100% 0.0 100%
CY083094.1 Influenza A virus (A/Lima/WRAIR0519F/2009(H1N1)) polymerase PB1 (PB1) gene, complete cds; and PB1-F2 gene, complete sequence 1011 1011 100% 0.0 100%
CY083086.1 Influenza A virus (A/Bogota/WRAIR0442T/2009(H1N1)) polymerase PB1 (PB1) gene, complete cds; and PB1-F2 gene, complete sequence 1011 1011 100% 0.0 100%
CY083054.1 Influenza A virus (A/Colorado/WRAIR0353S/2009(H1N1)) polymerase PB1 (PB1) gene, complete cds; and PB1-F2 gene, complete sequence 1011 1011 100% 0.0 100%
CY083046.1 Influenza A virus (A/Lima/WRAIR0285F/2009(H1N1)) polymerase PB1 (PB1) gene, complete cds; and PB1-F2 gene, complete sequence 1011 1011 100% 0.0 100%
CY080600.1 Influenza A virus (A/Boston/3/2009(H1N1)) polymerase PB1 (PB1) gene, complete cds; and PB1-F2 gene, complete sequence 1011 1011 100% 0.0 100%
CY080438.1 Influenza A virus (A/swine/QLD/09-02865-07/2009(H1N1)) segment 2 sequence 1011 1011 100% 0.0 100%
CY080430.1 Influenza A virus (A/swine/VIC/09-02797-62/2009(H1N1)) segment 2 sequence 1011 1011 100% 0.0 100%
CY080422.1 Influenza A virus (A/swine/VIC/09-02767-01/2009(H1N1)) segment 2 sequence 1011 1011 100% 0.0 100%
HQ661370.1 Influenza A virus (A/Russia/01-MA/2009(H1N1)) segment 2 polymerase PB1 (PB1) gene, complete cds 1011 1011 100% 0.0 100%
CY067660.1 Influenza A virus (A/swine/Italy/116114/2010(H1N2)) segment 2 sequence 1011 1011 100% 0.0 100%
HQ606470.1 Influenza A virus (A/Shiraz/14/2010(H1N1)) segment 2 polymerase PB1 (PB1) gene, partial cds; and nonfunctional PB1-F2 protein (PB1-F2) gene, complete sequence 1011 1011 100% 0.0 100%
CY076793.1 Influenza A virus (A/Ontario/156785/2009(H1N1)) segment 2 sequence 1011 1011 100% 0.0 100%
CY076785.1 Influenza A virus (A/Ontario/152846/2009(H1N1)) segment 2 sequence 1011 1011 100% 0.0 100%
CY076777.1 Influenza A virus (A/Ontario/152439/2009(H1N1)) segment 2 sequence 1011 1011 100% 0.0 100%
CY076769.1 Influenza A virus (A/Ontario/147723/2009(H1N1)) segment 2 sequence 1011 1011 100% 0.0 100%
CY076761.1 Influenza A virus (A/Ontario/147265/2009(H1N1)) segment 2 sequence 1011 1011 100% 0.0 100%
CY073790.1 Influenza A virus (A/San Francisco/01/2009(H1N1)) segment 2 sequence 1011 1011 100% 0.0 100%
CY075658.1 Influenza A virus (A/Boston/617/2009(H1N1)) segment 2, complete sequence 1011 1011 100% 0.0 100%
CY075642.1 Influenza A virus (A/Boston/703/2009(H1N1)) segment 2, complete sequence 1011 1011 100% 0.0 100%
CY075626.1 Influenza A virus (A/Boston/698/2009(H1N1)) segment 2, complete sequence 1011 1011 100% 0.0 100%
CY075618.1 Influenza A virus (A/Boston/682/2009(H1N1)) segment 2, complete sequence 1011 1011 100% 0.0 100%
CY075602.1 Influenza A virus (A/Boston/672/2009(H1N1)) segment 2, complete sequence 1011 1011 100% 0.0 100%
CY075586.1 Influenza A virus (A/Boston/663/2009(H1N1)) segment 2, complete sequence 1011 1011 100% 0.0 100%
CY075570.1 Influenza A virus (A/Boston/655/2009(H1N1)) segment 2, complete sequence 1011 1011 100% 0.0 100%
CY075562.1 Influenza A virus (A/Boston/653/2009(H1N1)) segment 2, complete sequence 1011 1011 100% 0.0 100%
CY075554.1 Influenza A virus (A/Boston/648/2009(H1N1)) segment 2, complete sequence 1011 1011 100% 0.0 100%
CY075546.1 Influenza A virus (A/Boston/634/2009(H1N1)) segment 2, complete sequence 1011 1011 100% 0.0 100%
CY075530.1 Influenza A virus (A/Boston/606/2009(H1N1)) segment 2, complete sequence 1011 1011 100% 0.0 100%
CY075522.1 Influenza A virus (A/Boston/602/2009(H1N1)) segment 2, complete sequence 1011 1011 100% 0.0 100%

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Tue Mar 08, 2011 1:13 pm 
Online

Joined: Wed Aug 19, 2009 10:42 am
Posts: 27559
Location: Pittsburgh, PA USA
Top 100 PA matches

JF346710.1 Influenza A virus (A/swine/Korea/4941/2010(H1N2)) segment 3 polymerase PA (PA) gene, partial cds 630 630 100% 1e-177 100%
HM189617.1 Influenza A virus (A/swine/Korea/SCJ08/2009(H1N1)) segment 3 polymerase PA (PA) gene, complete cds 630 630 100% 1e-177 100%
HM189616.1 Influenza A virus (A/swine/Korea/SCJ07/2009(H1N1)) segment 3 polymerase PA (PA) gene, complete cds 630 630 100% 1e-177 100%
HM189614.1 Influenza A virus (A/swine/Korea/SCJ05/2009(H1N1)) segment 3 polymerase PA (PA) gene, complete cds 630 630 100% 1e-177 100%
HM189613.1 Influenza A virus (A/swine/Korea/SCJ04/2009(H1N1)) segment 3 polymerase PA (PA) gene, complete cds 630 630 100% 1e-177 100%
HM189612.1 Influenza A virus (A/swine/Korea/SCJ03/2009(H1N1)) segment 3 polymerase PA (PA) gene, complete cds 630 630 100% 1e-177 100%
HM189611.1 Influenza A virus (A/swine/Korea/SCJ02/2009(H1N1)) segment 3 polymerase PA (PA) gene, complete cds 630 630 100% 1e-177 100%
HM189610.1 Influenza A virus (A/swine/Korea/SCJ01/2009(H1N1)) segment 3 polymerase PA (PA) gene, complete cds 630 630 100% 1e-177 100%
CY057259.1 Influenza A virus (A/New York/5186/2009(H1N1)) segment 3, complete sequence 630 630 100% 1e-177 100%
CY051692.1 Influenza A virus (A/New York/4761/2009(H1N1)) segment 3, complete sequence 630 630 100% 1e-177 100%
CY051660.1 Influenza A virus (A/New York/4728/2009(H1N1)) segment 3, complete sequence 630 630 100% 1e-177 100%
CY061208.1 Influenza A virus (A/Texas/JMS415/2009(H1N1)) segment 3, complete sequence 628 628 99% 5e-177 100%
CY087029.1 Influenza A virus (A/New York/4557/2009(H1N1)) polymerase PA (PA) gene, complete cds 622 622 100% 3e-175 99%
CY087038.1 Influenza A virus (A/New York/4631/2009(H1N1)) polymerase PA (PA) gene, complete cds 622 622 100% 3e-175 99%
CY087013.1 Influenza A virus (A/New York/3565/2009(H1N1)) polymerase PA (PA) gene, partial cds 622 622 100% 3e-175 99%
CY087005.1 Influenza A virus (A/New York/3256/2009(N1)) polymerase PA (PA) gene, complete cds 622 622 100% 3e-175 99%
CY086998.1 Influenza A virus (A/New York/3251/2009(H1N1)) polymerase PA (PA) gene, complete cds 622 622 100% 3e-175 99%
CY086990.1 Influenza A virus (A/New York/3250/2009(H1N1)) polymerase PA (PA) gene, partial cds 622 622 100% 3e-175 99%
CY086982.1 Influenza A virus (A/New York/3217/2009(H1N1)) polymerase PA (PA) gene, complete cds 622 622 100% 3e-175 99%
CY086974.1 Influenza A virus (A/New York/3198/2009(H1N1)) polymerase PA (PA) gene, complete cds 622 622 100% 3e-175 99%
CY086947.1 Influenza A virus (A/swine/Thailand/CU-M8_2/2009(H1N1)) polymerase PA (PA) gene, complete cds 622 622 100% 3e-175 99%
CY086935.1 Influenza A virus (A/swine/North Carolina/239108/2010(H1N2)) polymerase PA (PA) gene, complete cds 622 622 100% 3e-175 99%
CY086927.1 Influenza A virus (A/swine/Minnesota/239106/2010(H1N2)) polymerase PA (PA) gene, complete cds 622 622 100% 3e-175 99%
CY086919.1 Influenza A virus (A/swine/Minnesota/239105/2009(H3N2)) polymerase PA (PA) gene, complete cds 622 622 100% 3e-175 99%
CY040722.2 Influenza A virus (A/New York/3238/2009(H1N1)) polymerase PA (PA) gene, complete cds 622 622 100% 3e-175 99%
JF346709.1 Influenza A virus (A/swine/Korea/4940/2010(H1N2)) segment 3 polymerase PA (PA) gene, partial cds 622 622 100% 3e-175 99%
JF290390.1 Influenza A virus (A/swine/England/1382/2010(H1N2)) segment 3 polymerase PA (PA) gene, complete cds 622 622 100% 3e-175 99%
CY084467.1 Influenza A virus (A/New York/6537/2009(H1N1)) polymerase PA (PA) gene, complete cds 622 622 100% 3e-175 99%
CY084459.1 Influenza A virus (A/New York/6418/2009(H1N1)) polymerase PA (PA) gene, complete cds 622 622 100% 3e-175 99%
CY084451.1 Influenza A virus (A/New York/6902/2009(H1N1)) 622 622 100% 3e-175 99%
CY084443.1 Influenza A virus (A/New York/6064/2009(H1N1)) polymerase PA (PA) gene, complete cds 622 622 100% 3e-175 99%
CY083947.1 Influenza A virus (A/San Diego/INS194/2009(H1N1)) polymerase PA (PA) gene, complete cds 622 622 100% 3e-175 99%
CY083939.1 Influenza A virus (A/Warsaw/INS149/2009(H1N1)) polymerase PA (PA) gene, complete cds 622 622 100% 3e-175 99%
CY083931.1 Influenza A virus (A/Warsaw/INS148/2009(H1N1)) polymerase PA (PA) gene, complete cds 622 622 100% 3e-175 99%
CY083923.1 Influenza A virus (A/Warsaw/INS147/2009(H1N1)) polymerase PA (PA) gene, complete cds 622 622 100% 3e-175 99%
CY083915.1 Influenza A virus (A/Aalborg/INS132/2009(H1N1)) polymerase PA (PA) gene, complete cds 622 622 100% 3e-175 99%
CY083891.1 Influenza A virus (A/San Diego/INS72/2009(H1N1)) polymerase PA (PA) gene, complete cds 622 622 100% 3e-175 99%
CY083883.1 Influenza A virus (A/San Diego/INS50/2009(H1N1)) polymerase PA (PA) gene, complete cds 622 622 100% 3e-175 99%
CY083875.1 Influenza A virus (A/San Diego/INS49/2009(H1N1)) polymerase PA (PA) gene, complete cds 622 622 100% 3e-175 99%
CY083867.1 Influenza A virus (A/District of Columbia/INS47/2009(H1N1)) polymerase PA (PA) gene, complete cds 622 622 100% 3e-175 99%
CY083859.1 Influenza A virus (A/Pensacola/INS39/2009(H1N1)) polymerase PA (PA) gene, complete cds 622 622 100% 3e-175 99%
CY083843.1 Influenza A virus (A/San Diego/INS14/2009(H1N1)) polymerase PA (PA) gene, complete cds 622 622 100% 3e-175 99%
CY083835.1 Influenza A virus (A/San Diego/INS07/2009(H1N1)) polymerase PA (PA) gene, complete cds 622 622 100% 3e-175 99%
CY083802.1 Influenza A virus (A/Berlin/INS362/2009(H1N1)) polymerase PA (PA) gene, complete cds 622 622 100% 3e-175 99%
CY083758.1 Influenza A virus (A/Brussels/INS205/2009(H1N1)) polymerase PA (PA) gene, complete cds 622 622 100% 3e-175 99%
CY083734.1 Influenza A virus (A/Bochum/INS120/2009(H1N1)) polymerase PA (PA) gene, complete cds 622 622 100% 3e-175 99%
CY083718.1 Influenza A virus (A/Madrid/INS112/2009(H1N1)) polymerase PA (PA) gene, complete cds 622 622 100% 3e-175 99%
CY083703.1 Influenza A virus (A/Warsaw/INS99/2009(mixed)) polymerase PA (PA) gene, complete cds 622 622 100% 3e-175 99%
CY083695.1 Influenza A virus (A/Terrassa/INS94/2009(H1N1)) polymerase PA (PA) gene, complete cds 622 622 100% 3e-175 99%
CY083674.1 Influenza A virus (A/San Diego/INS62/2009(H1N1)) polymerase PA (PA) gene, complete cds 622 622 100% 3e-175 99%
CY083652.1 Influenza A virus (A/District of Columbia/INS22/2009(H1N1)) polymerase PA (PA) gene, complete cds 622 622 100% 3e-175 99%
CY083644.1 Influenza A virus (A/San Diego/INS13/2009(H1N1)) polymerase PA (PA) gene, complete cds 622 622 100% 3e-175 99%
CY083630.1 Influenza A virus (A/Arequipa/WRAIR9939F/2009(H1N1)) polymerase PA (PA) gene, complete cds 622 622 100% 3e-175 99%
CY083622.1 Influenza A virus (A/Trujillo/WRAIR9309F/2009(H1N1)) polymerase PA (PA) gene, complete cds 622 622 100% 3e-175 99%
CY083614.1 Influenza A virus (A/Lima/WRAIR9202F/2009(H1N1)) polymerase PA (PA) gene, complete cds 622 622 100% 3e-175 99%
CY083598.1 Influenza A virus (A/Managua/WRAIR8964F/2009(H1N1)) polymerase PA (PA) gene, complete cds 622 622 100% 3e-175 99%
CY083590.1 Influenza A virus (A/Lima/WRAIR8893F/2009(H1N1)) polymerase PA (PA) gene, complete cds 622 622 100% 3e-175 99%
CY083582.1 Influenza A virus (A/Lima/WRAIR8689F/2009(H1N1)) polymerase PA (PA) gene, complete cds 622 622 100% 3e-175 99%
CY083574.1 Influenza A virus (A/Lima/WRAIR8648F/2009(H1N1)) polymerase PA (PA) gene, complete cds 622 622 100% 3e-175 99%
CY083566.1 Influenza A virus (A/Lima/WRAIR8511F/2009(H1N1)) polymerase PA (PA) gene, complete cds 622 622 100% 3e-175 99%
CY083558.1 Influenza A virus (A/Budapest/WRAIR2411N/2009(H1N1)) polymerase PA (PA) gene, complete cds 622 622 100% 3e-175 99%
CY083542.1 Influenza A virus (A/Budapest/WRAIR2393N/2009(H1N1)) polymerase PA (PA) gene, complete cds 622 622 100% 3e-175 99%
CY083534.1 Influenza A virus (A/Mexico City/WRAIR1752N/2010(H1N1)) polymerase PA (PA) gene, complete cds 622 622 100% 3e-175 99%
CY083526.1 Influenza A virus (A/Lima/WRAIR1696P/2009(H1N1)) polymerase PA (PA) gene, complete cds 622 622 100% 3e-175 99%
CY083518.1 Influenza A virus (A/Lima/WRAIR1695P/2009(H1N1)) polymerase PA (PA) gene, complete cds 622 622 100% 3e-175 99%
CY083510.1 Influenza A virus (A/Piura/WRAIR1694P/2009(H1N1)) polymerase PA (PA) gene, complete cds 622 622 100% 3e-175 99%
CY083494.1 Influenza A virus (A/Chicago/WRAIR1691P/2009(H1N1)) polymerase PA (PA) gene, complete cds 622 622 100% 3e-175 99%
CY083486.1 Influenza A virus (A/Mexico City/WRAIR1691N/2009(H1N1)) polymerase PA (PA) gene, complete cds 622 622 100% 3e-175 99%
CY083478.1 Influenza A virus (A/Chicago/WRAIR1690P/2009(H1N1)) polymerase PA (PA) gene, complete cds 622 622 100% 3e-175 99%
CY083470.1 Influenza A virus (A/Managua/WRAIR1689P/2009(H1N1)) polymerase PA (PA) gene, complete cds 622 622 100% 3e-175 99%
CY083462.1 Influenza A virus (A/Lima/WRAIR1688P/2009(H1N1)) polymerase PA (PA) gene, complete cds 622 622 100% 3e-175 99%
CY083454.1 Influenza A virus (A/Lima/WRAIR1687P/2009(H1N1)) polymerase PA (PA) gene, complete cds 622 622 100% 3e-175 99%
CY083446.1 Influenza A virus (A/Mexico City/WRAIR1679N/2009(H1N1)) polymerase PA (PA) gene, complete cds 622 622 100% 3e-175 99%
CY083422.1 Influenza A virus (A/San Diego/WRAIR1667P/2009(H1N1)) polymerase PA (PA) gene, complete cds 622 622 100% 3e-175 99%
CY083414.1 Influenza A virus (A/San Diego/WRAIR1666P/2009(H1N1)) polymerase PA (PA) gene, complete cds 622 622 100% 3e-175 99%
CY083406.1 Influenza A virus (A/San Diego/WRAIR1665P/2009(H1N1)) polymerase PA (PA) gene, complete cds 622 622 100% 3e-175 99%
CY083374.1 Influenza A virus (A/Pendleton/WRAIR1661P/2009(H1N1)) polymerase PA (PA) gene, complete cds 622 622 100% 3e-175 99%
CY083366.1 Influenza A virus (A/South Carolina/WRAIR1660P/2009(H1N1)) polymerase PA (PA) gene, complete cds 622 622 100% 3e-175 99%
CY083358.1 Influenza A virus (A/San Diego/WRAIR1658P/2009(H1N1)) polymerase PA (PA) gene, complete cds 622 622 100% 3e-175 99%
CY083350.1 Influenza A virus (A/San Diego/WRAIR1657P/2009(H1N1)) polymerase PA (PA) gene, complete cds 622 622 100% 3e-175 99%
CY083335.1 Influenza A virus (A/San Diego/WRAIR1654P/2009(H1N1)) polymerase PA (PA) gene, complete cds 622 622 100% 3e-175 99%
CY083327.1 Influenza A virus (A/Cape May/WRAIR1653P/2009(H1N1)) polymerase PA (PA) gene, complete cds 622 622 100% 3e-175 99%
CY083311.1 Influenza A virus (A/San Diego/WRAIR1649P/2009(H1N1)) polymerase PA (PA) gene, complete cds 622 622 100% 3e-175 99%
CY083303.1 Influenza A virus (A/San Diego/WRAIR1648P/2009(H1N1)) polymerase PA (PA) gene, complete cds 622 622 100% 3e-175 99%
CY083295.1 Influenza A virus (A/San Diego/WRAIR1647P/2009(H1N1)) polymerase PA (PA) gene, complete cds 622 622 100% 3e-175 99%
CY083287.1 Influenza A virus (A/San Diego/WRAIR1646P/2009(H1N1)) polymerase PA (PA) gene, complete cds 622 622 100% 3e-175 99%
CY083279.1 Influenza A virus (A/San Diego/WRAIR1645P/2009(H1N1)) polymerase PA (PA) gene, complete cds 622 622 100% 3e-175 99%
CY083271.1 Influenza A virus (A/San Diego/WRAIR1644P/2009(H1N1)) polymerase PA (PA) gene, complete cds 622 622 100% 3e-175 99%
CY083263.1 Influenza A virus (A/San Diego/WRAIR1643P/2009(H1N1)) polymerase PA (PA) gene, complete cds 622 622 100% 3e-175 99%
CY083255.1 Influenza A virus (A/San Diego/WRAIR1642P/2009(H1N1)) polymerase PA (PA) gene, complete cds 622 622 100% 3e-175 99%
CY083239.1 Influenza A virus (A/Virginia/WRAIR1511P/2009(H1N1)) polymerase PA (PA) gene, complete cds 622 622 100% 3e-175 99%
CY083231.1 Influenza A virus (A/Guam/WRAIR1510P/2009(H1N1)) polymerase PA (PA) gene, complete cds 622 622 100% 3e-175 99%
CY083223.1 Influenza A virus (A/California/WRAIR1507P/2009(H1N1)) polymerase PA (PA) gene, complete cds 622 622 100% 3e-175 99%
CY083215.1 Influenza A virus (A/New Jersey/WRAIR1506P/2009(H1N1)) polymerase PA (PA) gene, complete cds 622 622 100% 3e-175 99%
CY083207.1 Influenza A virus (A/New Jersey/WRAIR1504P/2009(H1N1)) polymerase PA (PA) gene, complete cds 622 622 100% 3e-175 99%
CY083199.1 Influenza A virus (A/South Carolina/WRAIR1503P/2009(H1N1)) polymerase PA (PA) gene, complete cds 622 622 100% 3e-175 99%
CY083191.1 Influenza A virus (A/California/WRAIR1502P/2009(H1N1)) polymerase PA (PA) gene, complete cds 622 622 100% 3e-175 99%
CY083183.1 Influenza A virus (A/South Carolina/WRAIR1501P/2009(H1N1)) polymerase PA (PA) gene, complete cds 622 622 100% 3e-175 99%
CY083175.1 Influenza A virus (A/South Carolina/WRAIR1500P/2009(H1N1)) polymerase PA (PA) gene, complete cds 622 622 100% 3e-175 99%
CY083167.1 Influenza A virus (A/New Jersey/WRAIR1499P/2009(H1N1)) polymerase PA (PA) gene, complete cds 622 622 100% 3e-175 99%

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Tue Mar 08, 2011 1:16 pm 
Online

Joined: Wed Aug 19, 2009 10:42 am
Posts: 27559
Location: Pittsburgh, PA USA
Top 100 NP matches

JF346684.1 Influenza A virus (A/swine/Korea/5008/2010(H1N2)) segment 5 nucleocapsid protein (NP) gene, partial cds 862 862 100% 0.0 100%
JF346683.1 Influenza A virus (A/swine/Korea/4941/2010(H1N2)) segment 5 nucleocapsid protein (NP) gene, partial cds 862 862 100% 0.0 100%
JF346679.1 Influenza A virus (A/swine/Korea/4383/2009(H1N2)) segment 5 nucleocapsid protein (NP) gene, partial cds 862 862 100% 0.0 100%
JF346676.1 Influenza A virus (A/swine/Korea/4372/2009(H1N2)) segment 5 nucleocapsid protein (NP) gene, partial cds 862 862 100% 0.0 100%
EU798848.1 Influenza A virus (A/swine/Korea/CY08/2007(H1N2)) segment 5 nucleocapsid protein (NP) gene, complete cds 831 831 100% 0.0 99%
EU798847.1 Influenza A virus (A/swine/Korea/PZ14/2006(H1N2)) segment 5 nucleocapsid protein (NP) gene, complete cds 831 831 100% 0.0 99%
EU798846.1 Influenza A virus (A/swine/Korea/PZ7/2006(H1N2)) segment 5 nucleocapsid protein (NP) gene, complete cds 831 831 100% 0.0 99%
EU798845.1 Influenza A virus (A/swine/Korea/PZ4/2006(H1N2)) segment 5 nucleocapsid protein (NP) gene, complete cds 831 831 100% 0.0 99%
EU798842.1 Influenza A virus (A/swine/Korea/JL02/2005(H1N2)) segment 5 nucleocapsid protein (NP) gene, complete cds 831 831 100% 0.0 99%
EU798844.1 Influenza A virus (A/swine/Korea/Asan04/2006(H1N2)) segment 5 nucleocapsid protein (NP) gene, complete cds 807 807 100% 0.0 98%
EU798843.1 Influenza A virus (A/swine/Korea/JL04/2005(H1N2)) segment 5 nucleocapsid protein (NP) gene, complete cds 807 807 100% 0.0 98%
EU798841.1 Influenza A virus (A/swine/Korea/JL01/2005(H1N2)) segment 5 nucleocapsid protein (NP) gene, complete cds 807 807 100% 0.0 98%
EU798840.1 Influenza A virus (A/swine/Korea/Hongsong2/2004(H1N2)) segment 5 nucleocapsid protein (NP) gene, complete cds 807 807 100% 0.0 98%
GU135884.1 Influenza A virus (A/swine/Iowa/H02PW7/2002(H1N1)) segment 5 nucleoprotein (NP) gene, complete cds 799 799 100% 0.0 98%
GU135911.1 Influenza A virus (A/swine/Iowa/H03G1/2003(H1N1)) segment 5 nucleoprotein (NP) gene, complete cds 799 799 100% 0.0 98%
GU135934.1 Influenza A virus (A/swine/Iowa/H03HS5/2003(H1N1)) segment 5 nucleoprotein (NP) gene, complete cds 799 799 100% 0.0 98%
GU135966.1 Influenza A virus (A/swine/Iowa/H03US3/2003(H1N1)) segment 5 nucleoprotein (NP) gene, complete cds 799 799 100% 0.0 98%
HM125975.1 Influenza A virus (A/swine/MN/48683/2002(H1N1)) segment 5 nucleocapsid protein (NP) gene, complete cds 799 799 100% 0.0 98%
EU798839.1 Influenza A virus (A/swine/Korea/CAS08/2005(H1N1)) segment 5 nucleocapsid protein (NP) gene, complete cds 799 799 100% 0.0 98%
EU798838.1 Influenza A virus (A/swine/Korea/CAN01/2004(H1N1)) segment 5 nucleocapsid protein (NP) gene, complete cds 799 799 100% 0.0 98%
GU135958.1 Influenza A virus (A/swine/Iowa/H03LS4/2003(H1N1)) segment 5 nucleoprotein (NP) gene, complete cds 791 791 100% 0.0 97%
EU743213.1 Influenza A virus (A/turkey/MN/366767/2005(H3N2)) segment 5 nucleocapsid protein (NP) gene, complete cds 791 791 100% 0.0 97%
DQ889686.1 Influenza A virus (A/Iowa/CEID23/2005(H1N1)) nucleoprotein (NP) gene, complete cds 791 791 100% 0.0 97%
DQ150434.1 Influenza A virus (A/swine/IN/PU542/04 (H3N1)) nucleoprotein (NP) gene, complete cds 785 785 100% 0.0 97%
GU135868.1 Influenza A virus (A/swine/Iowa/H02NJ56371/2002(H1N1)) segment 5 nucleoprotein (NP) gene, complete cds 783 783 99% 0.0 97%
GU135876.1 Influenza A virus (A/swine/Iowa/H02NJ56391/2002(H1N1)) segment 5 nucleoprotein (NP) gene, complete cds 783 783 99% 0.0 97%
GU135974.1 Influenza A virus (A/swine/Iowa/H03UWF2/2003(H1N1)) segment 5 nucleoprotein (NP) gene, complete cds 783 783 100% 0.0 97%
GQ452238.1 Influenza A virus (A/swine/Iowa/H04YS2/2004(H1N1)) segment 5 nucleocapsid protein (NP) gene, complete cds 783 783 100% 0.0 97%
EU697205.1 Influenza A virus (A/turkey/Minnesota/366767/2005(H3N2)) nucleocapsid protein (NP) gene, complete cds 783 783 100% 0.0 97%
EU735821.1 Influenza A virus (A/turkey/OH/313053/2004(H3N2)) nucleocapsid protein (NP) gene, complete cds 783 783 100% 0.0 97%
EF551054.1 Influenza A virus (A/swine/North Carolina/2003(H3N2)) segment 5 nucleoprotein (NP) gene, complete cds 783 783 100% 0.0 97%
EF551046.1 Influenza A virus (A/turkey/Illinois/2004(H3N2)) segment 5 nucleoprotein (NP) gene, partial cds 783 783 100% 0.0 97%
DQ469999.1 Influenza A virus (A/turkey/Ontario/31232/2005(H3N2)) nucleoprotein (NP) gene, complete cds 783 783 100% 0.0 97%
DQ469991.1 Influenza A virus (A/swine/Ontario/33853/2005(H3N2)) nucleoprotein (NP) gene, complete cds 783 783 100% 0.0 97%
DQ469983.1 Influenza A virus (A/swine/Manitoba/12707/2005(H3N2)) nucleoprotein (NP) gene, complete cds 783 783 100% 0.0 97%
DQ469975.1 Influenza A virus (A/swine/British Columbia/28103/2005(H3N2)) nucleoprotein (NP) gene, complete cds 783 783 100% 0.0 97%
DQ469967.1 Influenza A virus (A/swine/Alberta/14722/2005(H3N2)) nucleoprotein (NP) gene, complete cds 783 783 100% 0.0 97%
DQ469959.1 Influenza A virus (A/Ontario/RV1273/2005(H3N2)) nucleoprotein (NP) gene, complete cds 783 783 100% 0.0 97%
DQ150426.1 Influenza A virus (A/swine/MI/PU243/04 (H3N1)) nucleoprotein (NP) gene, complete cds 783 783 100% 0.0 97%
AF455699.1 Influenza A virus (A/Swine/Ohio/891/01(H1N2)) nucleoprotein (NP) gene, complete cds 783 783 100% 0.0 97%
DQ335774.1 Influenza A virus (A/turkey/Ohio/313053/04(H3N2)) nucleoprotein (NP) gene, complete cds 783 783 100% 0.0 97%
AF342819.1 Influenza A virus (A/Wisconsin/10/98 (H1N1)) nucleoprotein gene, complete cds 783 783 100% 0.0 97%
GU135892.1 Influenza A virus (A/swine/Iowa/H03BF5/2003(H3N2)) segment 5 nucleoprotein (NP) gene, complete cds 775 775 100% 0.0 97%
GU135926.1 Influenza A virus (A/swine/Iowa/H03HO7/2003(H3N2)) segment 5 nucleoprotein (NP) gene, complete cds 775 775 100% 0.0 97%
HM461787.1 Influenza A virus (A/swine/Kentucky/02086/2008(H1N1)) segment 5 nucleocapsid protein (NP) gene, partial cds 775 775 100% 0.0 97%
CY041880.1 Influenza A virus (A/mallard/South Dakota/Sg-00128/2007(H3N2)) segment 5 sequence 775 775 100% 0.0 97%
CY041872.1 Influenza A virus (A/mallard/South Dakota/Sg-00127/2007(H3N2)) segment 5 sequence 775 775 100% 0.0 97%
CY041864.1 Influenza A virus (A/northern pintail/South Dakota/Sg-00126/2007(H3N2)) segment 5 sequence 775 775 100% 0.0 97%
CY041856.1 Influenza A virus (A/mallard/South Dakota/Sg-00125/2007(H3N2)) segment 5 sequence 775 775 100% 0.0 97%
EU826545.2 Influenza A virus (A/swine/Quebec/4001/2005(H3N2)) segment 5 nucleocapsid protein (NP) gene, complete cds 775 775 100% 0.0 97%
EU258936.1 Influenza A virus (A/swine/Missouri/2124514/2006(H2N3)) segment 5, complete sequence 775 775 100% 0.0 97%
AY129159.1 Influenza A virus (A/Swine/Korea/CY02/02(H1N2)) nucleoprotein (NP) mRNA, complete cds 775 775 100% 0.0 97%
GU135950.1 Influenza A virus (A/swine/Iowa/H03LJ10/2003(H1N1)) segment 5 nucleoprotein (NP) gene, complete cds 767 767 100% 0.0 97%
HM461763.1 Influenza A virus (A/swine/Minnesota/02053/2008(H1N1)) segment 5 nucleocapsid protein (NP) gene, partial cds 767 767 100% 0.0 97%
HM461803.1 Influenza A virus (A/swine/Minnesota/02011/2008(H1N2)) segment 5 nucleocapsid protein (NP) gene, partial cds 767 767 100% 0.0 97%
HM461811.1 Influenza A virus (A/swine/Missouri/02060/2008(H1N1)) segment 5 nucleocapsid protein (NP) gene, complete cds 767 767 100% 0.0 97%
CY045712.1 Influenza A virus (A/swine/Oklahoma/042169/2008(H1N2)) segment 5 sequence 767 767 100% 0.0 97%
CY045560.1 Influenza A virus (A/swine/Kansas/015252/2009(H3N2)) segment 5 sequence 767 767 100% 0.0 97%
CY045552.1 Influenza A virus (A/swine/Oklahoma/001142/2009(H3N2)) segment 5 sequence 767 767 100% 0.0 97%
CY041904.1 Influenza A virus (A/swine/Minnesota/SG-00239/2007(H1N2)) segment 5 sequence 767 767 100% 0.0 97%
EU826554.2 Influenza A virus (A/mink/Nova Scotia/1055488/2007(H3N2)) segment 5 nucleocapsid protein (NP) gene, complete cds 767 767 100% 0.0 97%
AF455706.1 Influenza A virus (A/Swine/Illinois/100084/01 (H1N2)) nucleoprotein (NP) gene, complete cds 767 767 100% 0.0 97%
AF455704.1 Influenza A virus (A/Swine/Indiana/P12439/00 (H1N2)) nucleoprotein (NP) gene, complete cds 767 767 100% 0.0 97%
AF153253.1 Influenza A virus (A/Swine/Texas/4199-2/98 (H3N2)) segment 5 nucleoprotein gene, partial cds 767 767 100% 0.0 97%
HM461771.1 Influenza A virus (A/swine/Iowa/02039/2008(H1N2)) segment 5 nucleocapsid protein (NP) gene, partial cds 759 759 100% 0.0 97%
HM461795.1 Influenza A virus (A/swine/Minnesota/02093/2008(H1N1)) segment 5 nucleocapsid protein (NP) gene, partial cds 759 759 100% 0.0 97%
HM461835.1 Influenza A virus (A/swine/Nebraska/02013/2008(H1N1)) segment 5 nucleocapsid protein (NP) gene, partial cds 759 759 100% 0.0 97%
CY045704.1 Influenza A virus (A/swine/Oklahoma/020736-1/2008(H1N2)) segment 5 sequence 759 759 100% 0.0 97%
CY045696.1 Influenza A virus (A/swine/Oklahoma/020736-2/2008(H1N2)) segment 5 sequence 759 759 100% 0.0 97%
CY045688.1 Influenza A virus (A/swine/Oklahoma/020734-3/2008(H1N2)) segment 5 sequence 759 759 100% 0.0 97%
CY045680.1 Influenza A virus (A/swine/Oklahoma/020734-2/2008(H1N2)) segment 5 sequence 759 759 100% 0.0 97%
CY045672.1 Influenza A virus (A/swine/Oklahoma/016179-9/2008(H1N2)) segment 5 sequence 759 759 100% 0.0 97%
CY045664.1 Influenza A virus (A/swine/Oklahoma/016179-8/2008(H1N2)) segment 5 sequence 759 759 100% 0.0 97%
CY045656.1 Influenza A virus (A/swine/Oklahoma/011521-4/2008(H1N2)) segment 5 sequence 759 759 100% 0.0 97%
CY045648.1 Influenza A virus (A/swine/Oklahoma/011521-5/2008(H1N2)) segment 5 sequence 759 759 100% 0.0 97%
CY045640.1 Influenza A virus (A/swine/Oklahoma/011289-8/2008(H1N2)) segment 5 sequence 759 759 100% 0.0 97%
CY045624.1 Influenza A virus (A/swine/Oklahoma/011289-9/2008(H1N2)) segment 5 sequence 759 759 100% 0.0 97%
CY045616.1 Influenza A virus (A/swine/Oklahoma/010710-8/2008(H1N2)) segment 5 sequence 759 759 100% 0.0 97%
CY045608.1 Influenza A virus (A/swine/Oklahoma/010710-9/2008(H1N2)) segment 5 sequence 759 759 100% 0.0 97%
CY045600.1 Influenza A virus (A/swine/Oklahoma/010226-17/2008(H1N2)) segment 5 sequence 759 759 100% 0.0 97%
CY045592.1 Influenza A virus (A/swine/Oklahoma/010226-16/2008(H1N2)) segment 5 sequence 759 759 100% 0.0 97%
CY045544.1 Influenza A virus (A/swine/Oklahoma/053259/2008(H1N2)) segment 5 sequence 759 759 100% 0.0 97%
CY045536.1 Influenza A virus (A/swine/Texas/050625/2008(H1N2)) segment 5 sequence 759 759 100% 0.0 97%
CY045528.1 Influenza A virus (A/swine/Texas/050593/2008(H1N2)) segment 5 sequence 759 759 100% 0.0 97%
CY045520.1 Influenza A virus (A/swine/Oklahoma/032726/2008(H1N2)) segment 5 sequence 759 759 100% 0.0 97%
FJ461599.1 Influenza A virus (A/swine/Korea/C13/2008(H5N2)) segment 5 nucleocapsid protein (NP) gene, complete cds 759 759 100% 0.0 97%
EU798856.1 Influenza A virus (A/swine/Korea/CY09/2007(H3N2)) segment 5 nucleocapsid protein (NP) gene, complete cds 759 759 100% 0.0 97%
EU798854.1 Influenza A virus (A/swine/Korea/CY05/2007(H3N2)) segment 5 nucleocapsid protein (NP) gene, complete cds 759 759 100% 0.0 97%
EU798853.1 Influenza A virus (A/swine/Korea/CY04/2007(H3N2)) segment 5 nucleocapsid protein (NP) gene, complete cds 759 759 100% 0.0 97%
EU735829.1 Influenza A virus (A/turkey/NC/353568/2005(H3N2)) nucleocapsid protein (NP) gene, complete cds 759 759 100% 0.0 97%
EU258946.1 Influenza A virus (A/swine/Missouri/4296424/2006(H2N3)) segment 5, complete sequence 759 759 100% 0.0 97%
DQ666947.1 Influenza A virus (A/swine/Korea/S15/2006(H1N2)) segment 5 nucleoprotein gene, complete cds 759 759 100% 0.0 97%
DQ666936.1 Influenza A virus (A/swine/Korea/S11/2005(H1N2)) segment 5 nucleoprotein gene, complete cds 759 759 100% 0.0 97%
DQ666928.1 Influenza A virus (A/swine/Korea/S5/2005(H1N2)) segment 5 nucleoprotein gene, complete cds 759 759 100% 0.0 97%
DQ923513.1 Influenza A virus (A/swine/Korea/CN22/2006(H3N1)) nucleoprotein (NP) gene, complete cds 759 759 100% 0.0 97%
DQ923512.1 Influenza A virus (A/swine/Korea/PZ72-1/2006(H3N1)) nucleoprotein (NP) gene, complete cds 759 759 100% 0.0 97%
AY038019.1 Influenza A virus (A/Turkey/MO/24093/99(H1N2)) nucleoprotein (NP) gene, partial cds 759 759 100% 0.0 97%
AF455705.1 Influenza A virus (A/Swine/Illinois/100085A/01 (H1N2)) nucleoprotein (NP) gene, complete cds 759 759 100% 0.0 97%
CY045568.1 Influenza A virus (A/swine/Oklahoma/008722/2007(H3N2)) segment 5 sequence 755 755 100% 0.0 96%
EU697210.1 Influenza A virus (A/turkey/North Carolina/353568/2005(H3N2)) nucleocapsid protein (NP) gene, complete cds 755 755 100% 0.0 96%

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Tue Mar 08, 2011 1:17 pm 
Online

Joined: Wed Aug 19, 2009 10:42 am
Posts: 27559
Location: Pittsburgh, PA USA
Top 100 MP matches

CY087025.1 Influenza A virus (A/New York/4557/2009(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 315 315 100% 5e-83 100%
CY087017.1 Influenza A virus (A/New York/4764/2009(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 315 315 100% 5e-83 100%
CY087009.1 Influenza A virus (A/New York/3565/2009(H1N1)) matrix protein 1 (M1) and matrix protein 2 (M2) genes, partial cds 315 315 100% 5e-83 100%
CY087001.1 Influenza A virus (A/New York/3256/2009(N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 315 315 100% 5e-83 100%
CY086994.1 Influenza A virus (A/New York/3251/2009(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 315 315 100% 5e-83 100%
CY086978.1 Influenza A virus (A/New York/3217/2009(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 315 315 100% 5e-83 100%
CY086970.1 Influenza A virus (A/New York/3198/2009(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 315 315 100% 5e-83 100%
CY086941.1 Influenza A virus (A/swine/Minnesota/340304/2010(H1N2)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 315 315 100% 5e-83 100%
CY086939.1 Influenza A virus (A/swine/North Carolina/239108/2010(H1N2)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 315 315 100% 5e-83 100%
CY086931.1 Influenza A virus (A/swine/Minnesota/239106/2010(H1N2)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 315 315 100% 5e-83 100%
CY086923.1 Influenza A virus (A/swine/Minnesota/239105/2009(H3N2)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 315 315 100% 5e-83 100%
CY086915.1 Influenza A virus (A/swine/Minnesota/226128/2010(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 315 315 100% 5e-83 100%
CY086907.1 Influenza A virus (A/swine/North Carolina/226126/2010(H1N2)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 315 315 100% 5e-83 100%
CY086899.1 Influenza A virus (A/swine/North Carolina/226125/2010(H1N2)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 315 315 100% 5e-83 100%
CY086891.1 Influenza A virus (A/swine/North Carolina/226124/2010(H1N2)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 315 315 100% 5e-83 100%
CY086883.1 Influenza A virus (A/swine/Indiana/240218/2010(H1N2)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 315 315 100% 5e-83 100%
CY040718.2 Influenza A virus (A/New York/3238/2009(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 315 315 100% 5e-83 100%
JF346693.1 Influenza A virus (A/swine/Korea/5008/2010(H1N2)) segment 7 matrix protein 1 (M1) gene, partial cds 315 315 100% 5e-83 100%
JF346692.1 Influenza A virus (A/swine/Korea/4941/2010(H1N2)) segment 7 matrix protein 1 (M1) gene, partial cds 315 315 100% 5e-83 100%
JF346691.1 Influenza A virus (A/swine/Korea/4940/2010(H1N2)) segment 7 matrix protein 1 (M1) gene, partial cds 315 315 100% 5e-83 100%
JF346687.1 Influenza A virus (A/swine/Korea/4382/2009(H1N2)) segment 7 matrix protein 1 (M1) gene, partial cds 315 315 100% 5e-83 100%
CY084463.1 Influenza A virus (A/New York/6537/2009(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 315 315 100% 5e-83 100%
CY084455.1 Influenza A virus (A/New York/6418/2009(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 315 315 100% 5e-83 100%
CY084447.1 Influenza A virus (A/New York/6902/2009(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 315 315 100% 5e-83 100%
CY084439.1 Influenza A virus (A/New York/6064/2009(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 315 315 100% 5e-83 100%
CY083943.1 Influenza A virus (A/San Diego/INS194/2009(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 315 315 100% 5e-83 100%
CY083927.1 Influenza A virus (A/Warsaw/INS148/2009(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 315 315 100% 5e-83 100%
CY083911.1 Influenza A virus (A/Aalborg/INS132/2009(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 315 315 100% 5e-83 100%
CY083895.1 Influenza A virus (A/San Diego/INS73/2009(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 315 315 100% 5e-83 100%
CY083887.1 Influenza A virus (A/San Diego/INS72/2009(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 315 315 100% 5e-83 100%
CY083879.1 Influenza A virus (A/San Diego/INS50/2009(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 315 315 100% 5e-83 100%
CY083871.1 Influenza A virus (A/San Diego/INS49/2009(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 315 315 100% 5e-83 100%
CY083863.1 Influenza A virus (A/District of Columbia/INS47/2009(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 315 315 100% 5e-83 100%
CY083855.1 Influenza A virus (A/Pensacola/INS39/2009(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 315 315 100% 5e-83 100%
CY083847.1 Influenza A virus (A/District of Columbia/INS23/2009(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 315 315 100% 5e-83 100%
CY083839.1 Influenza A virus (A/San Diego/INS14/2009(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 315 315 100% 5e-83 100%
CY083831.1 Influenza A virus (A/San Diego/INS07/2009(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 315 315 100% 5e-83 100%
CY083826.1 Influenza A virus (A/Wroclaw/INS435/2009(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 315 315 100% 5e-83 100%
CY083818.1 Influenza A virus (A/Los Angeles/INS423/2010(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 315 315 100% 5e-83 100%
CY083813.1 Influenza A virus (A/Athens/INS387/2010) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 315 315 100% 5e-83 100%
CY083806.1 Influenza A virus (A/Madrid/INS377/2009(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 315 315 100% 5e-83 100%
CY083798.1 Influenza A virus (A/Berlin/INS362/2009(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 315 315 100% 5e-83 100%
CY083795.1 Influenza A virus (A/Athens/INS328/2009) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 315 315 100% 5e-83 100%
CY083785.1 Influenza A virus (A/Madrid/INS297/2009(N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 315 315 100% 5e-83 100%
CY083769.1 Influenza A virus (A/Athens/INS256/2009(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 315 315 100% 5e-83 100%
CY083762.1 Influenza A virus (A/Aarhus/INS239/2009(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 315 315 100% 5e-83 100%
CY083754.1 Influenza A virus (A/Brussels/INS205/2009(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 315 315 100% 5e-83 100%
CY083746.1 Influenza A virus (A/Barcelona/INS189/2009(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 315 315 100% 5e-83 100%
CY083738.1 Influenza A virus (A/Madrid/INS130/2009(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 315 315 100% 5e-83 100%
CY083730.1 Influenza A virus (A/Bochum/INS120/2009(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 315 315 100% 5e-83 100%
CY083722.1 Influenza A virus (A/District of Columbia/INS115/2009(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 315 315 100% 5e-83 100%
CY083714.1 Influenza A virus (A/Madrid/INS112/2009(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 315 315 100% 5e-83 100%
CY083699.1 Influenza A virus (A/Warsaw/INS99/2009(mixed)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 315 315 100% 5e-83 100%
CY083691.1 Influenza A virus (A/Terrassa/INS94/2009(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 315 315 100% 5e-83 100%
CY083678.1 Influenza A virus (A/Madrid/INS77/2009(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 315 315 100% 5e-83 100%
CY083662.1 Influenza A virus (A/San Diego/INS41/2009(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 315 315 100% 5e-83 100%
CY083656.1 Influenza A virus (A/San Diego/INS36/2009(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 315 315 100% 5e-83 100%
CY083648.1 Influenza A virus (A/District of Columbia/INS22/2009(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 315 315 100% 5e-83 100%
CY083640.1 Influenza A virus (A/San Diego/INS13/2009(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 315 315 100% 5e-83 100%
CY083626.1 Influenza A virus (A/Trujillo/WRAIR9309F/2009(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 315 315 100% 5e-83 100%
CY083618.1 Influenza A virus (A/Lima/WRAIR9202F/2009(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 315 315 100% 5e-83 100%
CY083610.1 Influenza A virus (A/Managua/WRAIR8997F/2009(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 315 315 100% 5e-83 100%
CY083602.1 Influenza A virus (A/Managua/WRAIR8964F/2009(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 315 315 100% 5e-83 100%
CY083594.1 Influenza A virus (A/Lima/WRAIR8893F/2009(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 315 315 100% 5e-83 100%
CY083586.1 Influenza A virus (A/Lima/WRAIR8689F/2009(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 315 315 100% 5e-83 100%
CY083578.1 Influenza A virus (A/Lima/WRAIR8648F/2009(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 315 315 100% 5e-83 100%
CY083570.1 Influenza A virus (A/Lima/WRAIR8511F/2009(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 315 315 100% 5e-83 100%
CY083562.1 Influenza A virus (A/Budapest/WRAIR2411N/2009(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 315 315 100% 5e-83 100%
CY083554.1 Influenza A virus (A/Budapest/WRAIR2393T/2009(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 315 315 100% 5e-83 100%
CY083546.1 Influenza A virus (A/Budapest/WRAIR2393N/2009(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 315 315 100% 5e-83 100%
CY083538.1 Influenza A virus (A/Mexico City/WRAIR1752N/2010(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 315 315 100% 5e-83 100%
CY083530.1 Influenza A virus (A/Lima/WRAIR1696P/2009(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 315 315 100% 5e-83 100%
CY083522.1 Influenza A virus (A/Lima/WRAIR1695P/2009(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 315 315 100% 5e-83 100%
CY083514.1 Influenza A virus (A/Piura/WRAIR1694P/2009(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 315 315 100% 5e-83 100%
CY083506.1 Influenza A virus (A/Managua/WRAIR1693P/2009(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 315 315 100% 5e-83 100%
CY083498.1 Influenza A virus (A/Chicago/WRAIR1691P/2009(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 315 315 100% 5e-83 100%
CY083490.1 Influenza A virus (A/Mexico City/WRAIR1691N/2009(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 315 315 100% 5e-83 100%
CY083482.1 Influenza A virus (A/Chicago/WRAIR1690P/2009(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 315 315 100% 5e-83 100%
CY083474.1 Influenza A virus (A/Managua/WRAIR1689P/2009(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 315 315 100% 5e-83 100%
CY083466.1 Influenza A virus (A/Lima/WRAIR1688P/2009(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 315 315 100% 5e-83 100%
CY083458.1 Influenza A virus (A/Lima/WRAIR1687P/2009(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 315 315 100% 5e-83 100%
CY083450.1 Influenza A virus (A/Mexico City/WRAIR1679N/2009(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 315 315 100% 5e-83 100%
CY083442.1 Influenza A virus (A/Ft.Benning/WRAIR1669P/2009(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 315 315 100% 5e-83 100%
CY083426.1 Influenza A virus (A/San Diego/WRAIR1667P/2009(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 315 315 100% 5e-83 100%
CY083418.1 Influenza A virus (A/San Diego/WRAIR1666P/2009(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 315 315 100% 5e-83 100%
CY083410.1 Influenza A virus (A/San Diego/WRAIR1665P/2009(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 315 315 100% 5e-83 100%
CY083402.1 Influenza A virus (A/Great Lakes/WRAIR1664P/2009(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 315 315 100% 5e-83 100%
CY083394.1 Influenza A virus (A/San Diego/WRAIR1663P/2009(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 315 315 100% 5e-83 100%
CY083386.1 Influenza A virus (A/San Diego/WRAIR1662P/2009(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 315 315 100% 5e-83 100%
CY083378.1 Influenza A virus (A/Pendleton/WRAIR1661P/2009(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 315 315 100% 5e-83 100%
CY083370.1 Influenza A virus (A/South Carolina/WRAIR1660P/2009(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 315 315 100% 5e-83 100%
CY083362.1 Influenza A virus (A/San Diego/WRAIR1658P/2009(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 315 315 100% 5e-83 100%
CY083354.1 Influenza A virus (A/San Diego/WRAIR1657P/2009(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 315 315 100% 5e-83 100%
CY083347.1 Influenza A virus (A/San Diego/WRAIR1656P/2009(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 315 315 100% 5e-83 100%
CY083339.1 Influenza A virus (A/San Diego/WRAIR1654P/2009(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 315 315 100% 5e-83 100%
CY083323.1 Influenza A virus (A/Great Lakes/WRAIR1652P/2009(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 315 315 100% 5e-83 100%
CY083315.1 Influenza A virus (A/San Diego/WRAIR1649P/2009(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 315 315 100% 5e-83 100%
CY083307.1 Influenza A virus (A/San Diego/WRAIR1648P/2009(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 315 315 100% 5e-83 100%
CY083299.1 Influenza A virus (A/San Diego/WRAIR1647P/2009(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 315 315 100% 5e-83 100%
CY083291.1 Influenza A virus (A/San Diego/WRAIR1646P/2009(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 315 315 100% 5e-83 100%

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Tue Mar 08, 2011 1:19 pm 
Online

Joined: Wed Aug 19, 2009 10:42 am
Posts: 27559
Location: Pittsburgh, PA USA
Top 100 NS matches

JF346747.1 Influenza A virus (A/swine/Korea/5008/2010(H1N2)) segment 8 nonstructural protein 1 (NS1) and nuclear export protein (NEP) genes, partial cds 1243 1243 100% 0.0 100%
JF346746.1 Influenza A virus (A/swine/Korea/4941/2010(H1N2)) segment 8 nonstructural protein 1 (NS1) and nuclear export protein (NEP) genes, partial cds 1243 1243 100% 0.0 100%
JF346745.1 Influenza A virus (A/swine/Korea/4940/2010(H1N2)) segment 8 nonstructural protein 1 (NS1) and nuclear export protein (NEP) genes, partial cds 1243 1243 100% 0.0 100%
JF346744.1 Influenza A virus (A/swine/Korea/4779/2010(H1N2)) segment 8 nonstructural protein 1 (NS1) and nuclear export protein (NEP) genes, partial cds 1243 1243 100% 0.0 100%
JF346742.1 Influenza A virus (A/swine/Korea/4383/2009(H1N2)) segment 8 nonstructural protein 1 (NS1) and nuclear export protein (NEP) genes, partial cds 1243 1243 100% 0.0 100%
CY087020.1 Influenza A virus (A/New York/4764/2009(H1N1)) nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1235 1235 100% 0.0 99%
CY087012.1 Influenza A virus (A/New York/3565/2009(H1N1)) nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1235 1235 100% 0.0 99%
CY086997.1 Influenza A virus (A/New York/3251/2009(H1N1)) nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1235 1235 100% 0.0 99%
CY086973.1 Influenza A virus (A/New York/3198/2009(H1N1)) nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1235 1235 100% 0.0 99%
CY086952.1 Influenza A virus (A/swine/Thailand/CU-M8_2/2009(H1N1)) nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1235 1235 100% 0.0 99%
CY040721.2 Influenza A virus (A/New York/3238/2009(H1N1)) nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1235 1235 100% 0.0 99%
JF327344.1 Influenza A virus (A/Finland/671/2009(H1N1)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1235 1235 100% 0.0 99%
CY084466.1 Influenza A virus (A/New York/6537/2009(H1N1)) nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1235 1235 100% 0.0 99%
CY083946.1 Influenza A virus (A/San Diego/INS194/2009(H1N1)) nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1235 1235 100% 0.0 99%
CY083930.1 Influenza A virus (A/Warsaw/INS148/2009(H1N1)) nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1235 1235 100% 0.0 99%
CY083874.1 Influenza A virus (A/San Diego/INS49/2009(H1N1)) nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1235 1235 100% 0.0 99%
CY083834.1 Influenza A virus (A/San Diego/INS07/2009(H1N1)) nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1235 1235 100% 0.0 99%
CY083829.1 Influenza A virus (A/Wroclaw/INS435/2009(H1N1)) nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1235 1235 100% 0.0 99%
CY083801.1 Influenza A virus (A/Berlin/INS362/2009(H1N1)) nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1235 1235 100% 0.0 99%
CY083757.1 Influenza A virus (A/Brussels/INS205/2009(H1N1)) nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1235 1235 100% 0.0 99%
CY083694.1 Influenza A virus (A/Terrassa/INS94/2009(H1N1)) nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1235 1235 100% 0.0 99%
CY083665.1 Influenza A virus (A/San Diego/INS41/2009(H1N1)) nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1235 1235 100% 0.0 99%
CY083635.1 Influenza A virus (A/Arequipa/WRAIR9939F/2009(H1N1)) nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1235 1235 100% 0.0 99%
CY083555.1 Influenza A virus (A/Budapest/WRAIR2393T/2009(H1N1)) nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1235 1235 100% 0.0 99%
CY083547.1 Influenza A virus (A/Budapest/WRAIR2393N/2009(H1N1)) nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1235 1235 100% 0.0 99%
CY083491.1 Influenza A virus (A/Mexico City/WRAIR1691N/2009(H1N1)) nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1235 1235 100% 0.0 99%
CY083451.1 Influenza A virus (A/Mexico City/WRAIR1679N/2009(H1N1)) nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1235 1235 100% 0.0 99%
CY083443.1 Influenza A virus (A/Ft.Benning/WRAIR1669P/2009(H1N1)) nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1235 1235 100% 0.0 99%
CY083435.1 Influenza A virus (A/San Diego/WRAIR1668P/2009(H1N1)) nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1235 1235 100% 0.0 99%
CY083411.1 Influenza A virus (A/San Diego/WRAIR1665P/2009(H1N1)) nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1235 1235 100% 0.0 99%
CY083395.1 Influenza A virus (A/San Diego/WRAIR1663P/2009(H1N1)) nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1235 1235 100% 0.0 99%
CY083387.1 Influenza A virus (A/San Diego/WRAIR1662P/2009(H1N1)) nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1235 1235 100% 0.0 99%
CY083379.1 Influenza A virus (A/Pendleton/WRAIR1661P/2009(H1N1)) nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1235 1235 100% 0.0 99%
CY083371.1 Influenza A virus (A/South Carolina/WRAIR1660P/2009(H1N1)) nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1235 1235 100% 0.0 99%
CY083348.1 Influenza A virus (A/San Diego/WRAIR1656P/2009(H1N1)) nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1235 1235 100% 0.0 99%
CY083284.1 Influenza A virus (A/San Diego/WRAIR1645P/2009(H1N1)) nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1235 1235 100% 0.0 99%
CY083260.1 Influenza A virus (A/San Diego/WRAIR1642P/2009(H1N1)) nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1235 1235 100% 0.0 99%
CY083204.1 Influenza A virus (A/South Carolina/WRAIR1503P/2009(H1N1)) nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1235 1235 100% 0.0 99%
CY083196.1 Influenza A virus (A/California/WRAIR1502P/2009(H1N1)) nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1235 1235 100% 0.0 99%
CY083188.1 Influenza A virus (A/South Carolina/WRAIR1501P/2009(H1N1)) nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1235 1235 100% 0.0 99%
CY083180.1 Influenza A virus (A/South Carolina/WRAIR1500P/2009(H1N1)) nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1235 1235 100% 0.0 99%
CY083148.1 Influenza A virus (A/Bishkek/WRAIR0883N/2009(H1N1)) nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1235 1235 100% 0.0 99%
CY083124.1 Influenza A virus (A/Quito/WRAIR0617T/2009(H1N1)) nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1235 1235 100% 0.0 99%
CY083060.1 Influenza A virus (A/Colorado/WRAIR0353S/2009(H1N1)) nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1235 1235 100% 0.0 99%
CY083052.1 Influenza A virus (A/Lima/WRAIR0285F/2009(H1N1)) nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1235 1235 100% 0.0 99%
CY081129.3 Influenza A virus (A/Thailand/CU-C1028/2010(H1N1)) nuclear export protein (NEP) gene, partial cds; and nonstructural protein 1 (NS1) gene, complete cds 1235 1235 100% 0.0 99%
CY081530.1 Influenza A virus (A/Cambodia/NHRCC00006/2009(H1N1)) nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1235 1235 100% 0.0 99%
CY081123.1 Influenza A virus (A/Thailand/CU-C1025/2010(H1N1)) nuclear export protein (NEP) gene, partial cds; and nonstructural protein 1 (NS1) gene, complete cds 1235 1235 100% 0.0 99%
CY081117.1 Influenza A virus (A/Thailand/CU-C1006/2010(H1N1)) nuclear export protein (NEP) gene, partial cds; and nonstructural protein 1 (NS1) gene, complete cds 1235 1235 100% 0.0 99%
CY081111.1 Influenza A virus (A/Thailand/CU-C1005/2010(H1N1)) nuclear export protein (NEP) gene, partial cds; and nonstructural protein 1 (NS1) gene, complete cds 1235 1235 100% 0.0 99%
CY050371.1 Influenza A virus (A/Korea/S1/2009(H1N1)) segment 8 sequence 1235 1235 100% 0.0 99%
HQ240370.1 Influenza A virus (A/Canada-AB/RV2735/2009(H1N1)) segment 8 nuclear export protein (NEP) gene, partial cds; and nonstructural protein 1 (NS1) gene, complete cds 1235 1235 100% 0.0 99%
HQ240243.1 Influenza A virus (A/Canada-MB/RV0062-10/2009(H1N1)) segment 8 nuclear export protein (NEP) gene, partial cds; and nonstructural protein 1 (NS1) gene, complete cds 1235 1235 100% 0.0 99%
HQ840321.1 Influenza A virus (A/swine/Minnesota/165A/2009(H1N1)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1235 1235 100% 0.0 99%
HQ840313.1 Influenza A virus (A/swine/Minnesota/136B/2009(H1N1)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1235 1235 100% 0.0 99%
HQ840308.1 Influenza A virus (A/swine/Minnesota/130A/2009(H1N1)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1235 1235 100% 0.0 99%
HQ840300.1 Influenza A virus (A/swine/Minnesota/130A/2009(H1N1)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1235 1235 100% 0.0 99%
HQ840294.1 Influenza A virus (A/swine/Minnesota/074A/2009(H1N1)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1235 1235 100% 0.0 99%
CY074044.1 Influenza A virus (A/Argentina/HNRG45/2009(H1N1)) segment 8 sequence 1235 1235 100% 0.0 99%
CY074034.1 Influenza A virus (A/Argentina/HNRG36/2009(H1N1)) segment 8 sequence 1235 1235 100% 0.0 99%
CY074029.1 Influenza A virus (A/Argentina/HNRG33/2009(H1N1)) segment 8 sequence 1235 1235 100% 0.0 99%
CY074024.1 Influenza A virus (A/Argentina/HNRG32/2009(H1N1)) segment 8 sequence 1235 1235 100% 0.0 99%
CY074014.1 Influenza A virus (A/Argentina/HNRG21/2009(H1N1)) segment 8 sequence 1235 1235 100% 0.0 99%
CY074004.1 Influenza A virus (A/Argentina/HNRG14/2009(H1N1)) segment 8 sequence 1235 1235 100% 0.0 99%
CY073999.1 Influenza A virus (A/Argentina/HNRG107/2009(H1N1)) segment 8 sequence 1235 1235 100% 0.0 99%
CY073978.1 Influenza A virus (A/Argentina/HNRG104/2009(H1N1)) segment 8 sequence 1235 1235 100% 0.0 99%
HQ011422.1 Influenza A virus (A/Guangdong/45/2009(H1N1)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1235 1235 100% 0.0 99%
CY069238.1 Influenza A virus (A/Munich/INS365/2009(H1N1)) segment 8, complete sequence 1235 1235 100% 0.0 99%
CY069198.1 Influenza A virus (A/Athens/INS358/2009(H1N1)) segment 8, complete sequence 1235 1235 100% 0.0 99%
CY069166.1 Influenza A virus (A/Athens/INS353/2009(H1N1)) segment 8, complete sequence 1235 1235 100% 0.0 99%
CY069142.1 Influenza A virus (A/Madrid/INS300/2009(H1N1)) segment 8, complete sequence 1235 1235 100% 0.0 99%
CY069134.1 Influenza A virus (A/Madrid/INS299/2009(H1N1)) segment 8, complete sequence 1235 1235 100% 0.0 99%
CY069126.1 Influenza A virus (A/Madrid/INS298/2009(H1N1)) segment 8, complete sequence 1235 1235 100% 0.0 99%
CY069102.1 Influenza A virus (A/Guam/NHRC0027/2009(H1N1)) segment 8, complete sequence 1235 1235 100% 0.0 99%
CY069070.1 Influenza A virus (A/Guam/NHRC0023/2009(H1N1)) segment 8, complete sequence 1235 1235 100% 0.0 99%
CY069062.1 Influenza A virus (A/Guam/NHRC0022/2009(H1N1)) segment 8, complete sequence 1235 1235 100% 0.0 99%
CY069046.1 Influenza A virus (A/Guam/NHRC0020/2009(H1N1)) segment 8, complete sequence 1235 1235 100% 0.0 99%
CY069030.1 Influenza A virus (A/Guam/NHRC0018/2009(H1N1)) segment 8, complete sequence 1235 1235 100% 0.0 99%
CY069006.1 Influenza A virus (A/Guam/NHRC0015/2009(H1N1)) segment 8, complete sequence 1235 1235 100% 0.0 99%
CY068990.1 Influenza A virus (A/Guam/NHRC0013/2009(H1N1)) segment 8, complete sequence 1235 1235 100% 0.0 99%
CY068942.1 Influenza A virus (A/Guam/NHRC0008/2009(H1N1)) segment 8, complete sequence 1235 1235 100% 0.0 99%
HM855251.1 Influenza A virus (A/Meru/456/2009(H1N1)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1235 1235 100% 0.0 99%
HM855245.1 Influenza A virus (A/Trans-nzoia/168/2009(H1N1)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1235 1235 100% 0.0 99%
HM855244.1 Influenza A virus (A/Eldoret/120/2009(H1N1)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1235 1235 100% 0.0 99%
HM855243.1 Influenza A virus (A/Keiyo/96/2009(H1N1)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1235 1235 100% 0.0 99%
HM855242.1 Influenza A virus (A/Garissa/78/2009(H1N1)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1235 1235 100% 0.0 99%
HM780486.1 Influenza A virus (A/Guangdong/0862/2009(H1N1)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1235 1235 100% 0.0 99%
CY067171.1 Influenza A virus (A/Bonn/INS280/2009(H1N1)) segment 8, complete sequence 1235 1235 100% 0.0 99%
CY067043.1 Influenza A virus (A/Aarhus/INS252/2009(H1N1)) segment 8, complete sequence 1235 1235 100% 0.0 99%
CY067027.1 Influenza A virus (A/Bochum/INS250/2009(H1N1)) segment 8, complete sequence 1235 1235 100% 0.0 99%
CY067019.1 Influenza A virus (A/Bochum/INS249/2009(H1N1)) segment 8, complete sequence 1235 1235 100% 0.0 99%
CY066987.1 Influenza A virus (A/Brussels/INS243/2009(H1N1)) segment 8, complete sequence 1235 1235 100% 0.0 99%
CY066963.1 Influenza A virus (A/Aarhus/INS240/2009(H1N1)) segment 8, complete sequence 1235 1235 100% 0.0 99%
CY066955.1 Influenza A virus (A/Aarhus/INS238/2009(H1N1)) segment 8, complete sequence 1235 1235 100% 0.0 99%
CY066931.1 Influenza A virus (A/Pensacola/INS235/2009(H1N1)) segment 8, complete sequence 1235 1235 100% 0.0 99%
CY066923.1 Influenza A virus (A/Pensacola/INS234/2009(H1N1)) segment 8, complete sequence 1235 1235 100% 0.0 99%
CY066915.1 Influenza A virus (A/Pensacola/INS233/2009(H1N1)) segment 8, complete sequence 1235 1235 100% 0.0 99%
CY066859.1 Influenza A virus (A/District of Columbia/INS226/2009(H1N1)) segment 8, complete sequence 1235 1235 100% 0.0 99%
CY066851.1 Influenza A virus (A/Madrid/INS225/2009(H1N1)) segment 8, complete sequence 1235 1235 100% 0.0 99%
HQ240242.1 Influenza A virus (A/Canada-NB/RV0005-10/2009(H1N1)) segment 8 nuclear export protein (NEP) gene, partial cds; and nonstructural protein 1 (NS1) gene, complete cds 1231 1231 100% 0.0 99%

_________________
www.twitter.com/hniman


Top
 Profile  
 
Display posts from previous:  Sort by  
Post new topic Reply to topic  [ 68 posts ]  Go to page 1, 2, 3, 4, 5 ... 7  Next

All times are UTC - 5 hours [ DST ]


Who is online

Users browsing this forum: gjs0708, niman and 22 guests


You cannot post new topics in this forum
You cannot reply to topics in this forum
You cannot edit your posts in this forum
You cannot delete your posts in this forum
You cannot post attachments in this forum

Search for:
Jump to:  
Powered by phpBB® Forum Software © phpBB Group