Rhiza Labs FluTracker Forum

The place to discuss the flu
It is currently Mon May 20, 2013 2:07 am

All times are UTC - 5 hours [ DST ]




Post new topic Reply to topic  [ 22 posts ]  Go to page 1, 2, 3  Next
Author Message
PostPosted: Mon Mar 07, 2011 5:03 pm 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 27289
Location: Pittsburgh, PA USA
St Jude as released three full sets of novel H1N2 from North Carolina collected in September 8, 2010. The isolates had a triple reassortant polymerase complex found in North American swine (human PB1 and avaian PA & PB2), but had pandemic H1N1 for the other three internal genes (NP, MP, NS). The H1 was from seasonal H1N1 circa 2003, while the N2 was seasonal H3N2 circa 1996.

Thus, the novel H1N2 was a North American H1N2 triple reassortant that had replaced swine NP, MP, and NS with pandemic NP, MP, and NS.

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Mon Mar 07, 2011 5:12 pm 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 27289
Location: Pittsburgh, PA USA
LOCUS CY086904 1743 bp cRNA linear VRL 02-MAR-2011
DEFINITION Influenza A virus (A/swine/North Carolina/226126/2010(H1N2))
hemagglutinin (HA) gene, complete cds.
ACCESSION CY086904
VERSION CY086904.1 GI:325111484
KEYWORDS .
SOURCE Influenza A virus (A/swine/North Carolina/226126/2010(H1N2))
ORGANISM Influenza A virus (A/swine/North Carolina/226126/2010(H1N2))
Viruses; ssRNA negative-strand viruses; Orthomyxoviridae;
Influenzavirus A.
REFERENCE 1 (bases 1 to 1743)
AUTHORS Ducatez,M.F., Webby,R.J., Hause,B., Evelyn,S.-R., Darnel,D.,
Corzo,C., Juleen,K., Simonson,R., Rubrum,A., Lowe,J. and Gramer,M.
TITLE unpublished
JOURNAL Unpublished
REFERENCE 2 (bases 1 to 1743)
AUTHORS Ducatez,M.F., Webby,R.J., Hause,B., Evelyn,S.-R., Darnel,D.,
Corzo,C., Juleen,K., Simonson,R., Rubrum,A., Lowe,J. and Gramer,M.
TITLE Direct Submission
JOURNAL Submitted (02-MAR-2011) Infectious Diseases, St. Jude Children's
Research Hospital, 262 Danny Thomas Place, Memphis, Tennessee
38105, USA
FEATURES Location/Qualifiers
source 1..1743
/organism="Influenza A virus (A/swine/North
Carolina/226126/2010(H1N2))"
/mol_type="viral cRNA"
/strain="A/swine/North Carolina/226126/2010"
/serotype="H1N2"
/host="swine"
/db_xref="taxon:991770"
/segment="4"
/country="USA: North Carolina"
/collection_date="08-Sep-2010"
misc_feature 1..1743
/db_xref="IRD:CEIRS-SJC001-226126.4"
gene 1..1698
/gene="HA"
CDS 1..1698
/gene="HA"
/function="receptor binding and fusion protein"
/codon_start=1
/product="hemagglutinin"
/protein_id="ADY80077.1"
/db_xref="GI:325111485"
/translation="MKVKLIVLLCTFTATYADTICVGYHANNSTDTVDTVLEKNVTVT
HSVNLLEDSHNGKLCLLKGIAPLQLGSCSVAGWILGNPECELLISKESWSYIVETPNP
ENGTCYPGYFTDYEELREQLSSVSSFKRFEIFPKESSWPNHTVTGVSSSCSHNGNSSF
YRNLLWLTVKNGLYPNLSKSYTNKKXKEVLVLWGVHHPSNIGDQRALYHTENAYVSVV
SSHYSRRFTPEIAKRPKVRNQEGRINYYWTLLEPGDTIIFEANGNLIAPRYAFELSKG
FGSGIITSNAPMGECNAKCQTPQGAINSNLPFQNVHPVTIGECPKYVRSAKLRMVTGL
RNTPSIQSRGLFGAIAGFIEGGWTGMVDGWYGYHHQNEQGSGYAADQQSTQNAINGIT
NKVNSVIEKMNTQFTAVGNEFNKLERRMENLNKKVDDGFLDIWTYNAELLVLLENERT
LDFHDSNVKNLYEKVRSQLKNNAKEIGNGCFEFYHKCNDECMESVKNGTYDYPKYSEE
SKLNREKIDGVKLESMGVYNILAIYSTVASSLVLLVSLGAISFWMCSNGSLQCRICI"
sig_peptide 1..51
/gene="HA"
mat_peptide 52..1029
/gene="HA"
/product="HA1"
mat_peptide 1030..1695
/gene="HA"
/product="HA2"
ORIGIN
1 atgaaagtaa aactaattgt tctgttatgt acatttacag ctacatatgc agacacaata
61 tgtgtaggct accatgccaa caactcaact gacactgttg acacagtact tgagaagaat
121 gtgacagtga cacactctgt caacctactt gaggacagcc acaatggaaa actatgtcta
181 ctaaaaggaa tagctccact acaattgggt agttgcagcg ttgccggatg gatcttagga
241 aacccagagt gcgaactgct gatttccaag gaatcatggt cctacattgt agaaacacca
301 aatcctgaga atggaacatg ttacccaggg tatttcacag actatgaaga actgagggag
361 caattgagtt cagtatcttc atttaagagg ttcgaaatat tccccaaaga gagctcatgg
421 cccaaccaca ccgtaaccgg agtgtcatca tcatgctccc ataacgggaa cagcagcttc
481 tacagaaatt tgctatggct gacggtgaag aacggtttgt acccaaacct gagcaagtcc
541 tatacaaaca aaaagnagaa agaagtcctc gtactatggg gtgttcatca cccatctaac
601 ataggggacc aaagggccct ctatcataca gaaaatgctt atgtctctgt agtgtcttca
661 cattatagca gaagattcac cccagaaata gccaagagac ccaaggtgag aaatcaggaa
721 ggaagaatca actactactg gactctgcta gaacccgggg atacaataat atttgaggca
781 aatggaaatc taatagcacc aaggtatgcc ttcgaactga gtaagggttt tggatcagga
841 atcatcacat caaatgcacc aatgggtgaa tgtaatgcaa agtgtcaaac acctcaggga
901 gctataaaca gcaatcttcc tttccagaat gtacacccag taacaatagg agagtgtcca
961 aagtatgtca ggagtgcaaa attaaggatg gttacaggac taaggaacac cccatccatc
1021 caatccagag gtttgtttgg agccattgcc ggtttcattg aaggaggatg gactggaatg
1081 gtagatggtt ggtatggtta tcatcatcag aatgagcaag gatctggata tgctgcagac
1141 caacaaagca cacaaaatgc cattaatggg attacaaaca aggtgaattc tgtaattgaa
1201 aaaatgaaca ctcaattcac agctgtgggc aatgaattca acaaattgga aagaagaatg
1261 gaaaacctaa ataaaaaggt tgatgatggg tttctagaca tttggacata taatgcagaa
1321 ttgttagttc tactggaaaa tgaaaggact ttggatttcc atgactccaa cgtgaagaat
1381 ctgtatgaga aagtaagaag ccaattaaaa aataatgcca aagaaatagg aaacgggtgt
1441 tttgaattct atcataagtg taacgatgaa tgcatggaga gtgtgaaaaa tggaacttat
1501 gactatccaa aatattccga agaatcaaag ttaaacaggg agaaaattga tggagtgaaa
1561 ttggaatcaa tgggagtcta taatatcctg gcgatctact caacagtcgc cagttcccta
1621 gttcttttag tctccctggg ggcaatcagc ttctggatgt gttccaatgg gtctttacag
1681 tgtagaatat gcatctaaaa ccagaatttc agaaatataa ggaaaaacac ccttgtttct
1741 act

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Mon Mar 07, 2011 5:13 pm 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 27289
Location: Pittsburgh, PA USA
Top 100 HA matches

CY086904.1 Influenza A virus (A/swine/North Carolina/226126/2010(H1N2)) hemagglutinin (HA) gene, complete cds 3449 3449 100% 0.0 100%
CY086888.1 Influenza A virus (A/swine/North Carolina/226124/2010(H1N2)) hemagglutinin (HA) gene, complete cds 3449 3449 100% 0.0 99%
CY086896.1 Influenza A virus (A/swine/North Carolina/226125/2010(H1N2)) hemagglutinin (HA) gene, complete cds 3443 3443 100% 0.0 99%
CY086936.1 Influenza A virus (A/swine/North Carolina/239108/2010(H1N2)) hemagglutinin (HA) gene, partial cds 3198 3198 96% 0.0 98%
FJ638306.1 Influenza A virus (A/swine/NC/00573/2005(H1N1)) segment 4 hemagglutinin (HA) gene, complete cds 2954 2954 98% 0.0 96%
FJ638298.1 Influenza A virus (A/swine/IL/00685/2005(H1N1)) segment 4 hemagglutinin (HA) gene, complete cds 2946 2946 98% 0.0 96%
CY016323.1 Influenza A virus (A/Michigan/1/2003(H1N1)) segment 4 sequence 2910 2910 100% 0.0 95%
CY002808.1 Influenza A virus (A/New York/399/2003(H1N1)) segment 4, complete sequence 2910 2910 100% 0.0 96%
CY002624.1 Influenza A virus (A/New York/230/2003(H1N1)) segment 4, complete sequence 2910 2910 100% 0.0 96%
CY002536.1 Influenza A virus (A/New York/227/2003(H1N1)) segment 4, complete sequence 2904 2904 99% 0.0 96%
CY002688.1 Influenza A virus (A/New York/223/2003(H1N1)) segment 4, complete sequence 2902 2902 99% 0.0 96%
CY002528.1 Influenza A virus (A/New York/220/2002(H1N1)) segment 4, complete sequence 2902 2902 100% 0.0 95%
CY003296.1 Influenza A virus (A/New York/228/2003(H1N1)) segment 4, complete sequence 2896 2896 99% 0.0 96%
CY016329.1 Influenza A virus (A/Michigan/6/2003(H1N1)) segment 4 sequence 2890 2890 100% 0.0 95%
CY002680.1 Influenza A virus (A/New York/222/2003(H1N1)) segment 4, complete sequence 2886 2886 99% 0.0 96%
CY016328.1 Influenza A virus (A/Michigan/5/2003(H1N1)) segment 4 sequence 2882 2882 100% 0.0 95%
CY003384.1 Influenza A virus (A/New York/293/2003(H1N1)) segment 4, complete sequence 2880 2880 99% 0.0 96%
CY019341.1 Influenza A virus (A/Memphis/6/2003(H1N1)) segment 4, complete sequence 2876 2876 99% 0.0 96%
CY002984.1 Influenza A virus (A/New York/221/2003(H1N1)) segment 4, complete sequence 2872 2872 99% 0.0 95%
CY006427.1 Influenza A virus (A/New York/350/2003(H1N1)) segment 4, complete sequence 2872 2872 98% 0.0 95%
CY003704.1 Influenza A virus (A/New York/496/2003(H1N1)) segment 4, complete sequence 2870 2870 99% 0.0 95%
CY008996.1 Influenza A virus (A/New York/484/2003(H1N1)) segment 4, complete sequence 2870 2870 99% 0.0 95%
CY006667.1 Influenza A virus (A/New York/493/2003(H1N1)) segment 4, complete sequence 2870 2870 99% 0.0 95%
CY003688.1 Influenza A virus (A/New York/486/2003(H1N1)) segment 4, complete sequence 2870 2870 99% 0.0 95%
CY008524.1 Influenza A virus (A/New York/483/2003(H1N1)) segment 4, complete sequence 2864 2864 98% 0.0 95%
CY003472.1 Influenza A virus (A/New York/443/2001(H1N1)) segment 4, complete sequence 2863 2863 100% 0.0 95%
CY003376.1 Influenza A virus (A/New York/292/2003(H1N1)) segment 4, complete sequence 2863 2863 99% 0.0 95%
CY002704.1 Influenza A virus (A/New York/348/2003(H1N1)) segment 4, complete sequence 2863 2863 99% 0.0 95%
CY006915.1 Influenza A virus (A/New York/488/2003(H1N1)) segment 4, complete sequence 2863 2863 99% 0.0 95%
CY019883.1 Influenza A virus (A/Memphis/5/2003(H1N1)) segment 4, complete sequence 2859 2859 98% 0.0 95%
CY016327.1 Influenza A virus (A/Michigan/4/2003(H1N1)) segment 4 sequence 2851 2851 100% 0.0 95%
CY010268.1 Influenza A virus (A/Canterbury/53/2001(H1N1)) segment 4, complete sequence 2847 2847 99% 0.0 95%
CY011152.1 Influenza A virus (A/Wellington/1/2001(H1N1)) segment 4, complete sequence 2845 2845 99% 0.0 95%
CY010396.1 Influenza A virus (A/Canterbury/01/2001(H1N1)) segment 4, complete sequence 2831 2831 99% 0.0 95%
FJ986622.1 Influenza A virus (A/Michigan/09/2007(H1N2)) segment 4 hemagglutinin (HA) gene, partial cds 2825 2825 96% 0.0 96%
CY026219.1 Influenza A virus (A/Kentucky/UR06-0028/2007(H1N1)) segment 4, complete sequence 2823 2823 99% 0.0 95%
CY025437.1 Influenza A virus (A/Illinois/UR06-0333/2007(H1N1)) segment 4, complete sequence 2823 2823 99% 0.0 95%
CY010308.1 Influenza A virus (A/Canterbury/119/2001(H1N1)) segment 4, complete sequence 2823 2823 99% 0.0 95%
CY003304.1 Influenza A virus (A/New York/291/2002(H1N1)) segment 4, complete sequence 2823 2823 99% 0.0 95%
FJ611898.1 Influenza A virus (A/swine/Minnesota/07002083/2007(H1N1)) segment 4 hemagglutinin (HA) gene, complete cds 2821 2821 97% 0.0 95%
CY027939.1 Influenza A virus (A/Virginia/UR06-0295/2007(H1N1)) segment 4, complete sequence 2815 2815 99% 0.0 95%
CY027707.1 Influenza A virus (A/Virginia/UR06-0549/2007(H1N1)) segment 4, complete sequence 2815 2815 99% 0.0 95%
CY027467.1 Influenza A virus (A/Ohio/UR06-0394/2007(H1N1)) segment 4, complete sequence 2815 2815 99% 0.0 95%
CY027435.1 Influenza A virus (A/Illinois/UR06-0094/2007(H1N1)) segment 4, complete sequence 2815 2815 99% 0.0 95%
CY027419.1 Influenza A virus (A/Tennessee/UR06-0262/2007(H1N1)) segment 4, complete sequence 2815 2815 99% 0.0 95%
CY026795.1 Influenza A virus (A/Illinois/UR06-0491/2007(H1N1)) segment 4, complete sequence 2815 2815 99% 0.0 95%
CY027275.1 Influenza A virus (A/Illinois/UR06-0116/2007(H1N1)) segment 4, complete sequence 2813 2813 99% 0.0 95%
CY028419.1 Influenza A virus (A/Illinois/UR06-0215/2007(H1N1)) segment 4, complete sequence 2811 2811 98% 0.0 95%
CY028067.1 Influenza A virus (A/Illinois/UR06-0093/2007(H1N1)) segment 4, complete sequence 2811 2811 98% 0.0 95%
CY027395.1 Influenza A virus (A/Illinois/UR06-0136/2007(H1N1)) segment 4, complete sequence 2811 2811 99% 0.0 95%
CY026859.1 Influenza A virus (A/North Carolina/UR06-0099/2007(H1N1)) segment 4, complete sequence 2811 2811 98% 0.0 95%
CY027883.1 Influenza A virus (A/Texas/UR06-0503/2007(H1N1)) segment 4, complete sequence 2807 2807 99% 0.0 95%
CY027699.1 Influenza A virus (A/Illinois/UR06-0131/2007(H1N1)) segment 4, complete sequence 2807 2807 99% 0.0 95%
CY027227.1 Influenza A virus (A/Colorado/UR06-0499/2007(H1N1)) segment 4, complete sequence 2807 2807 99% 0.0 95%
CY027091.1 Influenza A virus (A/Illinois/UR06-0137/2007(H1N1)) segment 4, complete sequence 2807 2807 99% 0.0 95%
CY026499.1 Influenza A virus (A/Texas/UR06-0468/2007(H1N1)) segment 4, complete sequence 2807 2807 99% 0.0 95%
CY025595.1 Influenza A virus (A/Illinois/UR06-0415/2007(H1N1)) segment 4, complete sequence 2807 2807 99% 0.0 95%
CY027211.1 Influenza A virus (A/California/UR06-0585/2007(H1N1)) segment 4, complete sequence 2805 2805 99% 0.0 95%
CY027147.1 Influenza A virus (A/North Carolina/UR06-0011/2006(H1N1)) segment 4, complete sequence 2805 2805 99% 0.0 95%
CY025445.1 Influenza A virus (A/Texas/UR06-0467/2007(H1N1)) segment 4, complete sequence 2805 2805 99% 0.0 95%
CY027235.1 Influenza A virus (A/Virginia/UR06-0117/2007(H1N1)) segment 4, complete sequence 2803 2803 98% 0.0 95%
HQ166044.1 Influenza A virus (A/Netherlands/26/2007(H1N1)) segment 4 hemagglutinin (HA) gene, complete cds 2801 2801 100% 0.0 95%
CY028459.1 Influenza A virus (A/California/UR06-0442/2007(H1N1)) segment 4, complete sequence 2801 2801 98% 0.0 95%
CY028219.1 Influenza A virus (A/Texas/UR06-0420/2007(H1N1)) segment 4, complete sequence 2801 2801 98% 0.0 95%
CY027819.1 Influenza A virus (A/Illinois/UR06-0074/2007(H1N1)) segment 4, complete sequence 2801 2801 98% 0.0 95%
CY026971.1 Influenza A virus (A/Illinois/UR06-0095/2007(H1N1)) segment 4, complete sequence 2801 2801 98% 0.0 95%
CY006675.1 Influenza A virus (A/New York/494/2002(H1N1)) segment 4, complete sequence 2801 2801 97% 0.0 95%
CY027763.1 Influenza A virus (A/Ohio/UR06-0112/2007(H1N1)) segment 4, complete sequence 2799 2799 99% 0.0 95%
CY027355.1 Influenza A virus (A/California/UR06-0564/2007(H1N1)) segment 4, complete sequence 2799 2799 99% 0.0 95%
CY026907.1 Influenza A virus (A/Virginia/UR06-0254/2007(H1N1)) segment 4, complete sequence 2799 2799 99% 0.0 95%
CY026531.1 Influenza A virus (A/California/UR06-0302/2007(H1N1)) segment 4, complete sequence 2799 2799 99% 0.0 95%
CY026339.1 Influenza A virus (A/Texas/UR06-0542/2007(H1N1)) segment 4, complete sequence 2799 2799 99% 0.0 95%
CY020157.1 Influenza A virus (A/Western Australia/77/2005(H1N1)) segment 4, complete sequence 2799 2799 99% 0.0 95%
CY016691.1 Influenza A virus (A/South Australia/57/2005(H1N1)) segment 4, complete sequence 2799 2799 99% 0.0 95%
CY006195.1 Influenza A virus (A/New York/497/2003(H1N1)) segment 4, complete sequence 2799 2799 99% 0.0 95%
EU097945.1 Influenza A virus (A/Denmark/11/2005(H1N1)) hemagglutinin (HA) gene, complete cds 2797 2797 97% 0.0 95%
CY025493.1 Influenza A virus (A/Kentucky/UR06-0042/2007(H1N1)) segment 4, complete sequence 2797 2797 99% 0.0 95%
CY027139.1 Influenza A virus (A/Ohio/UR06-0177/2007(H1N1)) segment 4, complete sequence 2795 2795 98% 0.0 95%
CY041450.1 Influenza A virus (A/California/UR06-0439/2007(H1N1)) segment 4, complete sequence 2791 2791 99% 0.0 95%
CY028323.1 Influenza A virus (A/Texas/UR06-0026/2007(H1N1)) segment 4, complete sequence 2791 2791 99% 0.0 95%
CY028139.1 Influenza A virus (A/Kansas/UR06-0191/2007(H1N1)) segment 4, complete sequence 2791 2791 99% 0.0 95%
CY026643.1 Influenza A virus (A/New York/UR06-0253/2007(H1N1)) segment 4, complete sequence 2791 2791 99% 0.0 95%
CY025221.1 Influenza A virus (A/Michigan/UR06-0015/2006(H1N1)) segment 4, complete sequence 2791 2791 99% 0.0 95%
CY019997.1 Influenza A virus (A/Waikato/17/2005(H1N1)) segment 4, complete sequence 2791 2791 99% 0.0 95%
CY013557.1 Influenza A virus (A/Wellington/10/2005(H1N1)) segment 4, complete sequence 2791 2791 99% 0.0 95%
EU097938.1 Influenza A virus (A/Denmark/16/2001(H1N1)) hemagglutinin (HA) gene, complete cds 2789 2789 97% 0.0 95%
CY027483.1 Influenza A virus (A/Illinois/UR06-0115/2007(H1N1)) segment 4, complete sequence 2789 2789 98% 0.0 95%
CY016459.1 Influenza A virus (A/Waikato/11/2005(H1N1)) segment 4, complete sequence 2789 2789 99% 0.0 95%
CY028403.1 Influenza A virus (A/Ohio/UR06-0429/2007(H1N1)) segment 4, complete sequence 2787 2787 98% 0.0 95%
CY017315.1 Influenza A virus (A/Waikato/4/2005(H1N1)) segment 4, complete sequence 2787 2787 98% 0.0 95%
HM590675.1 Influenza A virus (A/swine/Illinois/03033/2010(H1N2)) segment 4 hemagglutinin (HA) gene, complete cds 2783 2783 99% 0.0 95%
CY025587.1 Influenza A virus (A/Texas/UR06-0526/2007(H1N1)) segment 4, complete sequence 2783 2783 99% 0.0 95%
CY025373.1 Influenza A virus (A/California/UR06-0435/2007(H1N1)) segment 4, complete sequence 2783 2783 99% 0.0 95%
CY022581.1 Influenza A virus (A/Auckland/619/2005(H1N1)) segment 4, complete sequence 2783 2783 99% 0.0 95%
CY021757.1 Influenza A virus (A/South Australia/51/2005(H1N1)) segment 4, complete sequence 2783 2783 99% 0.0 95%
CY015580.1 Influenza A virus (A/Wellington/14/2005(H1N1)) segment 4, complete sequence 2783 2783 99% 0.0 95%
FJ231773.1 Influenza A virus (A/Rheinland-Pfalz/58/2005(H1N1)) segment 4 hemagglutinin (HA) gene, complete cds 2781 2781 97% 0.0 95%
EU097952.1 Influenza A virus (A/Denmark/79/2005(H1N1)) hemagglutinin (HA) gene, complete cds 2781 2781 97% 0.0 95%
CY028147.1 Influenza A virus (A/Kentucky/UR06-0182/2007(H1N1)) segment 4, complete sequence 2781 2781 99% 0.0 95%
CY027675.1 Influenza A virus (A/Kentucky/UR06-0449/2007(H1N1)) segment 4, complete sequence 2781 2781 99% 0.0 95%

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Mon Mar 07, 2011 5:16 pm 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 27289
Location: Pittsburgh, PA USA
Top 100 NA sequences

CY086906.1 Influenza A virus (A/swine/North Carolina/226126/2010(H1N2)) neuraminidase (NA) gene, complete cds 2789 2789 100% 0.0 100%
CY086898.1 Influenza A virus (A/swine/North Carolina/226125/2010(H1N2)) neuraminidase (NA) gene, complete cds 2789 2789 100% 0.0 99%
CY086890.1 Influenza A virus (A/swine/North Carolina/226124/2010(H1N2)) neuraminidase (NA) gene, complete cds 2789 2789 100% 0.0 100%
HQ424895.1 Influenza A virus (A/swine/North Carolina/44837-4/2009(H1N2)) segment 6 neuraminidase (NA) gene, complete cds 2623 2623 100% 0.0 98%
CY086938.1 Influenza A virus (A/swine/North Carolina/239108/2010(H1N2)) neuraminidase (NA) gene, complete cds 2615 2615 100% 0.0 98%
AY129157.1 Influenza A virus (A/Swine/Korea/CY02/02(H1N2)) neuraminidase (NA) mRNA, complete cds 2353 2353 100% 0.0 96%
GU135927.1 Influenza A virus (A/swine/Iowa/H03HO7/2003(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 2345 2345 100% 0.0 95%
CY041881.1 Influenza A virus (A/mallard/South Dakota/Sg-00128/2007(H3N2)) segment 6 sequence 2329 2329 100% 0.0 95%
CY041873.1 Influenza A virus (A/mallard/South Dakota/Sg-00127/2007(H3N2)) segment 6 sequence 2329 2329 100% 0.0 95%
CY041865.1 Influenza A virus (A/northern pintail/South Dakota/Sg-00126/2007(H3N2)) segment 6 sequence 2329 2329 100% 0.0 95%
CY041857.1 Influenza A virus (A/mallard/South Dakota/Sg-00125/2007(H3N2)) segment 6 sequence 2329 2329 100% 0.0 95%
AF455698.1 Influenza A virus (A/Swine/Illinois/100084/01 (H1N2)) neuraminidase (NA) gene, complete cds 2329 2329 100% 0.0 95%
GU135893.1 Influenza A virus (A/swine/Iowa/H03BF5/2003(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 2311 2311 99% 0.0 95%
EU798824.1 Influenza A virus (A/swine/Korea/Asan04/2006(H1N2)) segment 6 neuraminidase (NA) gene, complete cds 2305 2305 100% 0.0 95%
AF455697.1 Influenza A virus (A/Swine/Illinois/100085A/01 (H1N2)) neuraminidase (NA) gene, complete cds 2305 2305 100% 0.0 95%
EU798823.1 Influenza A virus (A/swine/Korea/JL04/2005(H1N2)) segment 6 neuraminidase (NA) gene, complete cds 2298 2298 100% 0.0 95%
EU798820.1 Influenza A virus (A/swine/Korea/Hongsong2/2004(H1N2)) segment 6 neuraminidase (NA) gene, complete cds 2298 2298 100% 0.0 95%
DQ666927.1 Influenza A virus (A/swine/Korea/S5/2005(H1N2)) segment 6 neuraminidase gene, complete cds 2298 2298 100% 0.0 95%
AF455695.1 Influenza A virus (A/Swine/Iowa/930/01(H1N2)) neuraminidase (NA) gene, complete cds 2298 2298 100% 0.0 95%
AF455691.1 Influenza A virus (A/Swine/Ohio/891/01(H1N2)) neuraminidase (NA) gene, complete cds 2298 2298 100% 0.0 95%
EU798821.1 Influenza A virus (A/swine/Korea/JL01/2005(H1N2)) segment 6 neuraminidase (NA) gene, complete cds 2290 2290 100% 0.0 95%
AF153237.1 Influenza A virus (A/Swine/Texas/4199-2/98 (H3N2)) neuraminidase gene, partial cds 2290 2290 98% 0.0 95%
AF153238.1 Influenza A virus (A/Swine/Minnesota/9088-2/98 (H3N2)) neuraminidase gene, partial cds 2282 2282 98% 0.0 95%
EU798825.1 Influenza A virus (A/swine/Korea/PZ4/2006(H1N2)) segment 6 neuraminidase (NA) gene, complete cds 2274 2274 100% 0.0 95%
DQ666935.1 Influenza A virus (A/swine/Korea/S11/2005(H1N2)) segment 6 neuraminidase gene, complete cds 2266 2266 100% 0.0 95%
AF251428.2 Influenza A virus (A/Swine/Minnesota/593/99 (H3N2)) neuraminidase (NA) gene, complete cds 2266 2266 100% 0.0 95%
AF251412.3 Influenza A virus (A/Swine/Iowa/533/99 (H3N2)) neuraminidase (NA) gene, complete cds 2266 2266 100% 0.0 95%
AY038015.1 Influenza A virus (A/Turkey/MO/24093/99(H1N2)) neuraminidase (N2) gene, complete cds 2258 2258 100% 0.0 95%
AF251404.1 Influenza A virus (A/Swine/Nebraska/209/98 (H3N2)) neuraminidase (NA) gene, complete cds 2258 2258 100% 0.0 95%
EU139841.1 Influenza A virus (A/swine/Kansas/00246/2004(H1N2)) neuraminidase (NA) gene, partial cds 2256 2256 95% 0.0 96%
AF268136.1 Influenza A virus (A/Swine/Oklahoma/18717/99(H3N2)) neuraminidase protein gene, partial cds 2256 2256 99% 0.0 95%
EU798826.1 Influenza A virus (A/swine/Korea/PZ7/2006(H1N2)) segment 6 neuraminidase (NA) gene, complete cds 2250 2250 100% 0.0 95%
AF268135.1 Influenza A virus (A/Swine/Illinois/21587/99(H3N2)) neuraminidase protein gene, partial cds 2246 2246 98% 0.0 95%
AY233391.1 Influenza A virus (A/duck/NC/91347/01(H1N2)) neuraminidase (NA) gene, complete cds 2242 2242 100% 0.0 95%
AF251420.1 Influenza A virus (A/Swine/Iowa/569/99 (H3N2)) neuraminidase (NA) gene, complete cds 2242 2242 100% 0.0 95%
AF268140.1 Influenza A virus (A/Swine/Oklahoma/18089/99(H3N2)) neuraminidase protein gene, partial cds 2240 2240 98% 0.0 95%
AF268139.1 Influenza A virus (A/Swine/NorthCarolina/16497/99(H3N2)) neuraminidase protein gene, partial cds 2236 2236 98% 0.0 95%
EU798828.1 Influenza A virus (A/swine/Korea/CY08/2007(H1N2)) segment 6 neuraminidase (NA) gene, complete cds 2234 2234 100% 0.0 94%
EU798827.1 Influenza A virus (A/swine/Korea/PZ14/2006(H1N2)) segment 6 neuraminidase (NA) gene, complete cds 2234 2234 100% 0.0 94%
EU798822.1 Influenza A virus (A/swine/Korea/JL02/2005(H1N2)) segment 6 neuraminidase (NA) gene, complete cds 2234 2234 100% 0.0 94%
AF455696.1 Influenza A virus (A/Swine/Indiana/P12439/00 (H1N2)) neuraminidase (NA) gene, complete cds 2232 2232 99% 0.0 94%
EF584366.1 Influenza A virus (A/Athens/23/97 (H3N2)) segment 6 neuraminidase (NA) gene, complete cds 2226 2226 100% 0.0 94%
AF533996.1 Influenza A virus (A/Buenos Aires/4559/96(H3N2)) neuraminidase (NA) gene, complete cds 2226 2226 100% 0.0 94%
EU857298.1 Influenza A virus (A/Hong Kong/CUHK4803/1997(H3N2)) neuraminidase (NA) gene, complete cds 2218 2218 100% 0.0 94%
EU857293.1 Influenza A virus (A/Hong Kong/CUHK4391/1997(H3N2)) neuraminidase (NA) gene, complete cds 2218 2218 100% 0.0 94%
EU857289.1 Influenza A virus (A/Hong Kong/CUHK4245/1997(H3N2)) neuraminidase (NA) gene, complete cds 2218 2218 100% 0.0 94%
DQ666943.1 Influenza A virus (A/swine/Korea/S14/2006(H1N2)) segment 6 neuraminidase gene, complete cds 2218 2218 100% 0.0 94%
CY010006.1 Influenza A virus (A/New York/563/1996(H3N2)) segment 6, complete sequence 2218 2218 100% 0.0 94%
AF533995.1 Influenza A virus (A/Buenos Aires/4459/96(H3N2)) neuraminidase (NA) gene, complete cds 2218 2218 100% 0.0 94%
AF268137.1 Influenza A virus (A/Swine/Wisconsin/14094/99(H3N2)) neuraminidase protein gene, partial cds 2212 2212 98% 0.0 95%
CY036849.1 Influenza A virus (A/Siena/1/1997(H3N2)) segment 6, complete sequence 2210 2210 100% 0.0 94%
EU857297.1 Influenza A virus (A/Hong Kong/CUHK4622/1997(H3N2)) neuraminidase (NA) gene, complete cds 2210 2210 100% 0.0 94%
EU857296.1 Influenza A virus (A/Hong Kong/CUHK4542/1997(H3N2)) neuraminidase (NA) gene, complete cds 2210 2210 100% 0.0 94%
EU857130.1 Influenza A virus (A/Hong Kong/CUHK12626/1997(H3N2)) neuraminidase (NA) gene, complete cds 2210 2210 100% 0.0 94%
DQ666946.1 Influenza A virus (A/swine/Korea/S15/2006(H1N2)) segment 6 neuraminidase gene, complete cds 2210 2210 100% 0.0 94%
AF533998.1 Influenza A virus (A/Buenos Aires/32/96(H3N2)) neuraminidase (NA) gene, complete cds 2210 2210 100% 0.0 94%
EU857212.1 Influenza A virus (A/Hong Kong/CUHK22736/1997(H3N2)) neuraminidase (NA) gene, complete cds 2202 2202 100% 0.0 94%
EU857180.1 Influenza A virus (A/Hong Kong/CUHK20320/1997(H3N2)) neuraminidase (NA) gene, complete cds 2202 2202 100% 0.0 94%
EU857175.1 Influenza A virus (A/Hong Kong/CUHK20217/1997(H3N2)) neuraminidase (NA) gene, complete cds 2202 2202 100% 0.0 94%
EU857169.1 Influenza A virus (A/Hong Kong/CUHK20010/1997(H3N2)) neuraminidase (NA) gene, complete cds 2202 2202 100% 0.0 94%
EF584363.1 Influenza A virus (A/Sydney/16/1997(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 2202 2202 100% 0.0 94%
EF584343.1 Influenza A virus (A/Bur/23/1996(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 2202 2202 100% 0.0 94%
CY012850.1 Influenza A virus (A/New York/554/1996(H3N2)) segment 6, complete sequence 2202 2202 100% 0.0 94%
CY011418.1 Influenza A virus (A/New York/571/1996(H3N2)) segment 6, complete sequence 2202 2202 100% 0.0 94%
CY011258.1 Influenza A virus (A/New York/557/1996(H3N2)) segment 6, complete sequence 2202 2202 100% 0.0 94%
CY010798.1 Influenza A virus (A/New York/555/1996(H3N2)) segment 6, complete sequence 2202 2202 100% 0.0 94%
CY010614.1 Influenza A virus (A/New York/603/1996(H3N2)) segment 6, complete sequence 2202 2202 100% 0.0 94%
CY009494.1 Influenza A virus (A/New York/570/1996(H3N2)) segment 6, complete sequence 2202 2202 100% 0.0 94%
CY010062.1 Influenza A virus (A/New York/596/1996(H3N2)) segment 6, complete sequence 2202 2202 100% 0.0 94%
CY010014.1 Influenza A virus (A/New York/567/1996(H3N2)) segment 6, complete sequence 2202 2202 100% 0.0 94%
CY009502.1 Influenza A virus (A/New York/573/1996(H3N2)) segment 6, complete sequence 2202 2202 100% 0.0 94%
CY009486.1 Influenza A virus (A/New York/569/1997(H3N2)) segment 6, complete sequence 2202 2202 100% 0.0 94%
AF533997.1 Influenza A virus (A/Buenos Aires/4634/96(H3N2)) neuraminidase (NA) gene, complete cds 2202 2202 100% 0.0 94%
AF455693.1 Influenza A virus (A/Swine/North Carolina/93523/01 (H1N2)) neuraminidase (NA) gene, complete cds 2202 2202 100% 0.0 94%
AJ457942.1 Influenza A virus (A/South Africa/1147/96(H3N2)) NA gene for neuraminidase, genomic RNA 2202 2202 100% 0.0 94%
AJ307602.1 Influenza A virus (A/human/Montreal/MTL63149/00(H3N2)) NA gene for neuramindase, genomic RNA 2202 2202 100% 0.0 94%
AF250126.1 Influenza A virus (A/Swine/Indiana/9K035/99 (H1N2)) neuraminidase (NA) gene, complete cds 2202 2202 100% 0.0 94%
AF153239.1 Influenza A virus (A/Swine/Iowa/8548-1/98) neuraminidase gene, partial cds 2202 2202 98% 0.0 95%
AF038264.1 Influenza A virus H3N2 A/Shiga/25/97 neuraminidase (NA) gene, complete cds 2202 2202 100% 0.0 94%
GQ229370.1 Influenza A virus (A/swine/Hong Kong/NS623/2002(H1N2)) segment 6 neuraminidase (NA) gene, complete cds 2198 2198 100% 0.0 94%
EU139840.1 Influenza A virus (A/swine/Minnesota/00194/2003(H1N2)) neuraminidase (NA) gene, partial cds 2196 2196 94% 0.0 95%
CY010054.1 Influenza A virus (A/New York/595/1996(H3N2)) segment 6, complete sequence 2196 2196 99% 0.0 94%
CY010022.1 Influenza A virus (A/New York/582/1996(H3N2)) segment 6, complete sequence 2196 2196 99% 0.0 94%
EU798836.1 Influenza A virus (A/swine/Korea/CY09/2007(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 2194 2194 100% 0.0 94%
EU857295.1 Influenza A virus (A/Hong Kong/CUHK4529/1997(H3N2)) neuraminidase (NA) gene, complete cds 2194 2194 100% 0.0 94%
EU857208.1 Influenza A virus (A/Hong Kong/CUHK22185/1997(H3N2)) neuraminidase (NA) gene, complete cds 2194 2194 100% 0.0 94%
EU857182.1 Influenza A virus (A/Hong Kong/CUHK20731/1997(H3N2)) neuraminidase (NA) gene, complete cds 2194 2194 100% 0.0 94%
EU857172.1 Influenza A virus (A/Hong Kong/CUHK20199/1997(H3N2)) neuraminidase (NA) gene, complete cds 2194 2194 100% 0.0 94%
EU857131.1 Influenza A virus (A/Hong Kong/CUHK12794/1997(H3N2)) neuraminidase (NA) gene, complete cds 2194 2194 100% 0.0 94%
EU857127.1 Influenza A virus (A/Hong Kong/CUHK12566/1997(H3N2)) neuraminidase (NA) gene, complete cds 2194 2194 100% 0.0 94%
EU857126.1 Influenza A virus (A/Hong Kong/CUHK12563/1997(H3N2)) neuraminidase (NA) gene, complete cds 2194 2194 100% 0.0 94%
EF584375.1 Influenza A virus (A/Brazil/97/1997(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 2194 2194 100% 0.0 94%
EF584348.1 Influenza A virus (A/Minnesota/6/1996(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 2194 2194 100% 0.0 94%
CY015518.1 Influenza A virus (A/New York/601/1996(H3N2)) segment 6, complete sequence 2194 2194 100% 0.0 94%
CY012202.1 Influenza A virus (A/New York/556/1996(H3N2)) segment 6, complete sequence 2194 2194 100% 0.0 94%
CY011426.1 Influenza A virus (A/New York/577/1996(H3N2)) segment 6, complete sequence 2194 2194 100% 0.0 94%
CY011266.1 Influenza A virus (A/New York/559/1996(H3N2)) segment 6, complete sequence 2194 2194 100% 0.0 94%
CY010030.1 Influenza A virus (A/New York/591/1996(H3N2)) segment 6, complete sequence 2194 2194 100% 0.0 94%
CY009710.1 Influenza A virus (A/New York/586/1996(H3N2)) segment 6, complete sequence 2194 2194 100% 0.0 94%
CY009662.1 Influenza A virus (A/New York/568/1996(H3N2)) segment 6, complete sequence 2194 2194 100% 0.0 94%

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Mon Mar 07, 2011 5:17 pm 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 27289
Location: Pittsburgh, PA USA
Top PB2 sequences

CY086901.1 Influenza A virus (A/swine/North Carolina/226126/2010(H1N2)) polymerase PB2 (PB2) gene, complete cds 4587 4587 100% 0.0 100%
CY086893.1 Influenza A virus (A/swine/North Carolina/226125/2010(H1N2)) polymerase PB2 (PB2) gene, complete cds 4587 4587 100% 0.0 100%
CY086885.1 Influenza A virus (A/swine/North Carolina/226124/2010(H1N2)) polymerase PB2 (PB2) gene, complete cds 4579 4579 100% 0.0 99%
CY041844.1 Influenza A virus (A/swine/North Carolina/R08-001877-D08-013371/2008 (H3N2)) segment 1 sequence 4302 4302 100% 0.0 98%
CY035430.2 Influenza A virus (A/swine/Minnesota/SG-00239/2007(H1N2)) segment 1 sequence 4294 4294 100% 0.0 98%
CY042309.1 Influenza A virus (A/swine/Illinois/Sg-00443/2008(H1N1)) segment 1 sequence 4222 4222 100% 0.0 98%
EU735825.1 Influenza A virus (A/turkey/OH/313053/2004(H3N2)) polymerase PB2 (PB2) gene, complete cds 4222 4222 100% 0.0 98%
HM461807.1 Influenza A virus (A/swine/Missouri/02060/2008(H1N1)) segment 1 polymerase PB2 (PB2) gene, partial cds 4212 4212 98% 0.0 98%
CY042317.1 Influenza A virus (A/swine/Illinois/Sg-00445/2008(H1N1)) segment 1 sequence 4211 4211 100% 0.0 97%
CY042313.1 Influenza A virus (A/swine/Illinois/Sg-00444/2008(H1N1)) segment 1 sequence 4207 4207 99% 0.0 97%
EU604691.1 Influenza A virus (A/swine/OH/511445/2007(H1N1)) segment 1 polymerase PB2 (PB2) gene, complete cds 4203 4203 98% 0.0 98%
DQ150422.1 Influenza A virus (A/swine/MI/PU243/04 (H3N1)) polymerase (PB2) gene, complete cds 4199 4199 100% 0.0 97%
HM461799.1 Influenza A virus (A/swine/Minnesota/02011/2008(H1N2)) segment 1 polymerase PB2 (PB2) gene, partial cds 4197 4197 98% 0.0 98%
EU735833.1 Influenza A virus (A/turkey/NC/353568/2005(H3N2)) polymerase PB2 (PB2) gene, complete cds 4197 4197 99% 0.0 97%
GQ484358.1 Influenza A virus (A/swine/Kansas/77778/2007(H1N1)) segment 1 polymerase PB2 (PB2) gene, complete cds 4187 4187 98% 0.0 98%
EU409946.1 Influenza A virus (A/swine/Ohio/24366/2007(H1N1)) polymerase PB2 (PB2) gene, partial cds 4175 4175 97% 0.0 98%
CY035445.1 Influenza A virus (A/swine/Illinois/SG-00244/2007(H1N1)) segment 1 sequence 4163 4163 97% 0.0 98%
DQ335778.1 Influenza A virus (A/turkey/Ohio/313053/04(H3N2)) polymerase PB2 (PB2) gene, complete cds 4155 4155 98% 0.0 97%
EF551042.1 Influenza A virus (A/turkey/Illinois/2004(H3N2)) segment 1 polymerase PB2 (PB2) gene, complete cds 4151 4151 100% 0.0 97%
HM461775.1 Influenza A virus (A/swine/Ohio/02026/2008(H1N1)) segment 1 polymerase PB2 (PB2) gene, partial cds 4149 4149 98% 0.0 97%
EU743217.1 Influenza A virus (A/turkey/MN/366767/2005(H3N2)) segment 1 polymerase PB2 (PB2) gene, complete cds 4149 4149 99% 0.0 97%
HQ840335.1 Influenza A virus (A/swine/South Dakota/152B/2009(H1N2)) segment 1 polymerase PB2 (PB2) gene, complete cds 4123 4123 98% 0.0 97%
CY086933.1 Influenza A virus (A/swine/North Carolina/239108/2010(H1N2)) polymerase PB2 (PB2) gene, complete cds 4119 4119 100% 0.0 97%
CY045652.1 Influenza A virus (A/swine/Oklahoma/011521-4/2008(H1N2)) segment 1 sequence 4111 4111 100% 0.0 97%
CY045644.1 Influenza A virus (A/swine/Oklahoma/011521-5/2008(H1N2)) segment 1 sequence 4111 4111 100% 0.0 97%
CY045620.1 Influenza A virus (A/swine/Oklahoma/011289-9/2008(H1N2)) segment 1 sequence 4111 4111 100% 0.0 97%
CY045612.1 Influenza A virus (A/swine/Oklahoma/010710-8/2008(H1N2)) segment 1 sequence 4111 4111 100% 0.0 97%
DQ469995.1 Influenza A virus (A/turkey/Ontario/31232/2005(H3N2)) polymerase subunit PB2 (PB2) gene, complete cds 4107 4107 98% 0.0 97%
DQ469987.1 Influenza A virus (A/swine/Ontario/33853/2005(H3N2)) polymerase subunit PB2 (PB2) gene, complete cds 4107 4107 98% 0.0 97%
DQ469971.1 Influenza A virus (A/swine/British Columbia/28103/2005(H3N2)) polymerase subunit PB2 (PB2) gene, complete cds 4107 4107 98% 0.0 97%
DQ469955.1 Influenza A virus (A/Ontario/RV1273/2005(H3N2)) polymerase subunit PB2 (PB2) gene, complete cds 4107 4107 98% 0.0 97%
FJ410137.1 Influenza A virus (A/swine/Minnesota/1145/2007(H3N2)) segment 1, complete sequence 4103 4103 100% 0.0 97%
CY045684.1 Influenza A virus (A/swine/Oklahoma/020734-3/2008(H1N2)) segment 1 sequence 4103 4103 100% 0.0 97%
CY045668.1 Influenza A virus (A/swine/Oklahoma/016179-9/2008(H1N2)) segment 1 sequence 4103 4103 100% 0.0 97%
CY045660.1 Influenza A virus (A/swine/Oklahoma/016179-8/2008(H1N2)) segment 1 sequence 4103 4103 100% 0.0 97%
CY045636.1 Influenza A virus (A/swine/Oklahoma/011289-8/2008(H1N2)) segment 1 sequence 4103 4103 100% 0.0 97%
CY045628.1 Influenza A virus (A/swine/Oklahoma/011289-10/2008(H1N2)) segment 1 sequence 4103 4103 100% 0.0 97%
CY045604.1 Influenza A virus (A/swine/Oklahoma/010710-9/2008(H1N2)) segment 1 sequence 4103 4103 100% 0.0 97%
CY045572.1 Influenza A virus (A/swine/Oklahoma/011506/2007(H3N2)) segment 1 sequence 4103 4103 100% 0.0 97%
CY045516.1 Influenza A virus (A/swine/Oklahoma/032726/2008(H1N2)) segment 1 sequence 4103 4103 100% 0.0 97%
GU937744.1 Influenza A virus (A/Kansas/13/2009(H3N2)) segment 1 polymerase PB2 (PB2) gene, partial cds 4100 4100 97% 0.0 97%
CY035443.1 Influenza A virus (A/swine/Minnesota/SG-00243/2006(H3N2)) segment 1 sequence 4100 4100 96% 0.0 98%
CY045700.1 Influenza A virus (A/swine/Oklahoma/020736-1/2008(H1N2)) segment 1 sequence 4096 4096 100% 0.0 97%
CY045692.1 Influenza A virus (A/swine/Oklahoma/020736-2/2008(H1N2)) segment 1 sequence 4096 4096 100% 0.0 97%
CY045588.1 Influenza A virus (A/swine/Oklahoma/010226-16/2008(H1N2)) segment 1 sequence 4096 4096 100% 0.0 97%
CY045676.1 Influenza A virus (A/swine/Oklahoma/020734-2/2008(H1N2)) segment 1 sequence 4088 4088 100% 0.0 97%
CY045580.1 Influenza A virus (A/swine/Texas/008648/2008(H1N2)) segment 1 sequence 4088 4088 100% 0.0 97%
CY045564.1 Influenza A virus (A/swine/Oklahoma/008722/2007(H3N2)) segment 1 sequence 4088 4088 100% 0.0 97%
EU826550.2 Influenza A virus (A/swine/Quebec/4001/2005(H3N2)) segment 1 polymerase PB2 (PB2) gene, complete cds 4084 4084 98% 0.0 97%
CY045596.1 Influenza A virus (A/swine/Oklahoma/010226-17/2008(H1N2)) segment 1 sequence 4080 4080 100% 0.0 97%
CY045540.1 Influenza A virus (A/swine/Oklahoma/053259/2008(H1N2)) segment 1 sequence 4080 4080 100% 0.0 97%
HQ734219.1 Influenza A virus (A/swine/Pennsylvania/62170-3/2010(H3N2)) segment 1 polymerase PB2 (PB2) gene, complete cds 4068 4068 98% 0.0 97%
CY045708.1 Influenza A virus (A/swine/Oklahoma/042169/2008(H1N2)) segment 1 sequence 4064 4064 99% 0.0 97%
HQ734225.1 Influenza A virus (A/swine/Pennsylvania/62170-4/2010(H3N2)) segment 1 polymerase PB2 (PB2) gene, complete cds 4060 4060 98% 0.0 97%
HQ734213.1 Influenza A virus (A/swine/Pennsylvania/62170-2/2010(H3N2)) segment 1 polymerase PB2 (PB2) gene, complete cds 4060 4060 98% 0.0 97%
HQ734207.1 Influenza A virus (A/swine/Pennsylvania/62170-1/2010(H3N2)) segment 1 polymerase PB2 (PB2) gene, complete cds 4060 4060 98% 0.0 97%
CY045524.1 Influenza A virus (A/swine/Texas/050593/2008(H1N2)) segment 1 sequence 4056 4056 100% 0.0 97%
DQ469979.1 Influenza A virus (A/swine/Manitoba/12707/2005(H3N2)) polymerase subunit PB2 (PB2) gene, complete cds 4054 4054 98% 0.0 97%
CY045532.1 Influenza A virus (A/swine/Texas/050625/2008(H1N2)) segment 1 sequence 4048 4048 100% 0.0 97%
FJ638311.1 Influenza A virus (A/swine/IL/07003243/2007(H1N2)) segment 1 polymerase PB2 (PB2) gene, complete cds 4048 4048 98% 0.0 97%
HM461847.1 Influenza A virus (A/swine/Texas/01976/2008(H1N2)) segment 1 polymerase PB2 (PB2) gene, partial cds 4038 4038 98% 0.0 97%
JF316640.1 Influenza A virus (A/swine/Pennsylvania/057108-1/2010(H3N2)) segment 1 polymerase PB2 (PB2) gene, complete cds 4036 4036 98% 0.0 97%
DQ150430.1 Influenza A virus (A/swine/IN/PU542/04 (H3N1)) polymerase (PB2) gene, complete cds 4016 4016 100% 0.0 96%
HM461767.1 Influenza A virus (A/swine/Iowa/02039/2008(H1N2)) segment 1 polymerase PB2 (PB2) gene, partial cds 4014 4014 98% 0.0 97%
CY035414.1 Influenza A virus (A/swine/Minnesota/SG-00234/2005(H3N2)) segment 1 sequence 4010 4010 97% 0.0 97%
EU409958.1 Influenza A virus (A/swine/Ohio/C62006/2006(H1N1)) polymerase PB2 (PB2) gene, partial cds 3992 3992 97% 0.0 97%
CY035433.1 Influenza A virus (A/swine/Minnesota/SG-00240/2007(H1N1)) segment 1 sequence 3990 3990 97% 0.0 97%
DQ469963.1 Influenza A virus (A/swine/Alberta/14722/2005(H3N2)) polymerase subunit PB2 (PB2) gene, complete cds 3990 3990 98% 0.0 97%
AY129163.1 Influenza A virus (A/Swine/Korea/CY02/02(H1N2)) polymerase subunit 2 (PB2) mRNA, complete cds 3985 3985 100% 0.0 96%
CY035417.1 Influenza A virus (A/swine/Minnesota/SG-00235/2007(H3N2)) segment 1 sequence 3983 3983 97% 0.0 97%
EU826558.2 Influenza A virus (A/mink/Nova Scotia/1055488/2007(H3N2)) segment 1 polymerase PB2 (PB2) gene, complete cds 3973 3973 98% 0.0 96%
EU399758.1 Influenza A virus (A/Ontario/1252/2007(H3N2)) polymerase subunit PB2 (PB2) gene, complete cds 3973 3973 98% 0.0 96%
CY035439.1 Influenza A virus (A/swine/Minnesota/SG-00242/2006(H3N2)) segment 1 sequence 3967 3967 97% 0.0 97%
CY045556.1 Influenza A virus (A/swine/Kansas/015252/2009(H3N2)) segment 1 sequence 3961 3961 99% 0.0 96%
CY045548.1 Influenza A virus (A/swine/Oklahoma/001142/2009(H3N2)) segment 1 sequence 3961 3961 99% 0.0 96%
CY033794.2 Influenza A virus (A/mallard/South Dakota/Sg-00128/2007(H3N2)) segment 1 sequence 3961 3961 100% 0.0 96%
CY032880.2 Influenza A virus (A/mallard/South Dakota/Sg-00127/2007(H3N2)) segment 1 sequence 3961 3961 100% 0.0 96%
CY032879.2 Influenza A virus (A/northern pintail/South Dakota/Sg-00126/2007(H3N2)) segment 1 sequence 3961 3961 100% 0.0 96%
CY032878.2 Influenza A virus (A/mallard/South Dakota/Sg-00125/2007(H3N2)) segment 1 sequence 3961 3961 100% 0.0 96%
HM461839.1 Influenza A virus (A/swine/Iowa/02096/2008(H1N1)) segment 1 polymerase PB2 (PB2) gene, partial cds 3959 3959 98% 0.0 96%
CY035436.1 Influenza A virus (A/swine/Minnesota/SG-00241/2007(H1N1)) segment 1 sequence 3959 3959 97% 0.0 97%
GU135880.1 Influenza A virus (A/swine/Iowa/H02PW7/2002(H1N1)) segment 1 polymerase PB2 (PB2) gene, complete cds 3957 3957 98% 0.0 96%
HM125972.1 Influenza A virus (A/swine/MN/48683/2002(H1N1)) segment 1 polymerase PB2 (PB2) gene, complete cds 3957 3957 98% 0.0 96%
FJ638303.1 Influenza A virus (A/swine/NC/00573/2005(H1N1)) segment 1 polymerase PB2 (PB2) gene, complete cds 3955 3955 98% 0.0 96%
EU409953.1 Influenza A virus (A/swine/Ohio/75004/2004(H1N1)) polymerase PB2 (PB2) gene, complete cds 3955 3955 98% 0.0 96%
GU135954.1 Influenza A virus (A/swine/Iowa/H03LS4/2003(H1N1)) segment 1 polymerase PB2 (PB2) gene, complete cds 3949 3949 98% 0.0 96%
GQ457545.1 Influenza A virus (A/Saskatchewan/5350/2009(H1N1)) segment 1 polymerase PB2 (PB2) gene, complete cds 3947 3947 99% 0.0 96%
CY035420.1 Influenza A virus (A/swine/Minnesota/SG-00236/2007(H3N2)) segment 1 sequence 3947 3947 97% 0.0 97%
HM461815.1 Influenza A virus (A/swine/North Carolina/02023/2008(H1N1)) segment 1 polymerase PB2 (PB2) gene, partial cds 3943 3943 98% 0.0 96%
HM461823.1 Influenza A virus (A/swine/North Carolina/02084/2008(H1N1)) segment 1 polymerase PB2 (PB2) gene, partial cds 3943 3943 98% 0.0 96%
FJ638295.1 Influenza A virus (A/swine/IL/00685/2005(H1N1)) segment 1 polymerase PB2 (PB2) gene, complete cds 3943 3943 98% 0.0 96%
CY035423.1 Influenza A virus (A/swine/Minnesota/SG-00237/2007(H3N2)) segment 1 sequence 3935 3935 97% 0.0 97%
GQ457546.1 Influenza A virus (A/Saskatchewan/5351/2009(H1N1)) segment 1 polymerase PB2 (PB2) gene, complete cds 3931 3931 99% 0.0 96%
GQ457544.1 Influenza A virus (A/Saskatchewan/5131/2009(H1N1)) segment 1 polymerase PB2 (PB2) gene, complete cds 3931 3931 99% 0.0 96%
CY035427.1 Influenza A virus (A/swine/Minnesota/SG-00238/2006(H1N1)) segment 1 sequence 3931 3931 97% 0.0 97%
HM461759.1 Influenza A virus (A/swine/Minnesota/02053/2008(H1N1)) segment 1 polymerase PB2 (PB2) gene, partial cds 3927 3927 98% 0.0 96%
GU135888.1 Influenza A virus (A/swine/Iowa/H03BF5/2003(H3N2)) segment 1 polymerase PB2 (PB2) gene, complete cds 3925 3925 98% 0.0 96%
GU135938.1 Influenza A virus (A/swine/Iowa/H03LDH5/2003(H3N2)) segment 1 polymerase PB2 (PB2) gene, complete cds 3925 3925 98% 0.0 96%
AF455738.1 Influenza A virus (A/Swine/Illinois/100084/01 (H1N2)) polymerase subunit (PB2) gene, complete cds 3925 3925 98% 0.0 96%
GU135907.1 Influenza A virus (A/swine/Iowa/H03G1/2003(H1N1)) segment 1 polymerase PB2 (PB2) gene, complete cds 3917 3917 98% 0.0 96%

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Mon Mar 07, 2011 5:19 pm 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 27289
Location: Pittsburgh, PA USA
Top 100 PB1 sequences

CY086902.1 Influenza A virus (A/swine/North Carolina/226126/2010(H1N2)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 4593 4593 100% 0.0 100%
CY086894.1 Influenza A virus (A/swine/North Carolina/226125/2010(H1N2)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 4569 4569 100% 0.0 99%
CY086886.1 Influenza A virus (A/swine/North Carolina/226124/2010(H1N2)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 4557 4557 100% 0.0 99%
EU692907.1 Influenza A virus (A/swine/Minnesota/69353/2006(H1N1)) segment 2 polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 4189 4189 100% 0.0 97%
EU692890.1 Influenza A virus (A/swine/Minnesota/66853/2006(H3N2)) segment 2 polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 4181 4181 100% 0.0 97%
HM461824.1 Influenza A virus (A/swine/North Carolina/02084/2008(H1N1)) segment 2 polymerase PB1 (PB1) gene, partial cds 4169 4169 98% 0.0 98%
EU692900.1 Influenza A virus (A/swine/Minnesota/2411/2007(H1N2)) segment 2 polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 4165 4165 100% 0.0 97%
EU743216.1 Influenza A virus (A/turkey/MN/366767/2005(H3N2)) segment 2 polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 4151 4151 99% 0.0 97%
DQ469964.1 Influenza A virus (A/swine/Alberta/14722/2005(H3N2)) polymerase subunit PB1 (PB1) gene, complete cds 4151 4151 98% 0.0 98%
DQ150423.1 Influenza A virus (A/swine/MI/PU243/04 (H3N1)) polymerase (PB1) gene, complete cds 4149 4149 100% 0.0 97%
DQ469988.1 Influenza A virus (A/swine/Ontario/33853/2005(H3N2)) polymerase subunit PB1 (PB1) gene, complete cds 4143 4143 98% 0.0 97%
DQ469956.1 Influenza A virus (A/Ontario/RV1273/2005(H3N2)) polymerase subunit PB1 (PB1) gene, complete cds 4143 4143 98% 0.0 97%
HQ315644.1 Influenza A virus (A/swine/Minnesota/5947/2007(H3N2)) segment 2 polymerase PB1 (PB1) gene, complete cds 4141 4141 100% 0.0 97%
FJ410138.1 Influenza A virus (A/swine/Minnesota/1145/2007(H3N2)) segment 2, complete sequence 4141 4141 100% 0.0 97%
EU826549.2 Influenza A virus (A/swine/Quebec/4001/2005(H3N2)) segment 2 polymerase PB1 (PB1) gene, complete cds 4137 4137 98% 0.0 97%
EU692892.1 Influenza A virus (A/swine/Minnesota/578/2007(H3N2)) segment 2 polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 4137 4137 100% 0.0 97%
EU735824.1 Influenza A virus (A/turkey/OH/313053/2004(H3N2)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 4133 4133 99% 0.0 97%
EF551043.1 Influenza A virus (A/turkey/Illinois/2004(H3N2)) segment 2 polymerase PB1 (PB1) gene, complete cds 4133 4133 100% 0.0 97%
CY035431.2 Influenza A virus (A/swine/Minnesota/SG-00239/2007(H1N2)) segment 2 sequence 4125 4125 100% 0.0 97%
DQ469972.1 Influenza A virus (A/swine/British Columbia/28103/2005(H3N2)) polymerase subunit PB1 (PB1) gene, complete cds 4119 4119 98% 0.0 97%
EU692902.1 Influenza A virus (A/swine/Minnesota/3239/2007(H1N2)) segment 2 polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 4117 4117 100% 0.0 97%
EU692899.1 Influenza A virus (A/swine/Minnesota/1900/2007(H1N2)) segment 2 polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 4117 4117 100% 0.0 97%
CY035428.1 Influenza A virus (A/swine/Minnesota/SG-00238/2006(H1N1)) segment 2 sequence 4111 4111 97% 0.0 97%
DQ469980.1 Influenza A virus (A/swine/Manitoba/12707/2005(H3N2)) polymerase subunit PB1 (PB1) gene, complete cds 4111 4111 98% 0.0 97%
CY045565.1 Influenza A virus (A/swine/Oklahoma/008722/2007(H3N2)) segment 2 sequence 4109 4109 100% 0.0 97%
DQ335777.1 Influenza A virus (A/turkey/Ohio/313053/04(H3N2)) polymerase PB1 (PB1) gene, complete cds 4103 4103 98% 0.0 97%
FJ638312.1 Influenza A virus (A/swine/IL/07003243/2007(H1N2)) segment 2 polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 4101 4101 100% 0.0 97%
EU692896.1 Influenza A virus (A/swine/Minnesota/7931/2007(H3N2)) segment 2 polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 4101 4101 100% 0.0 97%
CY045573.1 Influenza A virus (A/swine/Oklahoma/011506/2007(H3N2)) segment 2 sequence 4094 4094 100% 0.0 97%
EU692894.1 Influenza A virus (A/swine/Minnesota/1300/2007(H3N2)) segment 2 polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 4094 4094 100% 0.0 97%
CY035415.1 Influenza A virus (A/swine/Minnesota/SG-00234/2005(H3N2)) segment 2 sequence 4088 4088 97% 0.0 97%
EU735832.1 Influenza A virus (A/turkey/NC/353568/2005(H3N2)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 4088 4088 99% 0.0 97%
EU692897.1 Influenza A virus (A/swine/Minnesota/64585/2006(H1N2)) segment 2 polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 4086 4086 100% 0.0 97%
CY035434.1 Influenza A virus (A/swine/Minnesota/SG-00240/2007(H1N1)) segment 2 sequence 4086 4086 97% 0.0 97%
HM461832.1 Influenza A virus (A/swine/Nebraska/02013/2008(H1N1)) segment 2 polymerase PB1 (PB1) gene, partial cds 4058 4058 98% 0.0 97%
EU692898.1 Influenza A virus (A/swine/Minnesota/66743/2006(H1N2)) segment 2 polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 4054 4054 100% 0.0 97%
HQ315645.1 Influenza A virus (A/swine/Minnesota/65767/2006(H3N2)) segment 2 polymerase PB1 (PB1) gene, complete cds 4046 4046 100% 0.0 97%
EU692895.1 Influenza A virus (A/swine/Minnesota/7209/2007(H3N2)) segment 2 polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 4038 4038 100% 0.0 96%
DQ150431.1 Influenza A virus (A/swine/IN/PU542/04 (H3N1)) polymerase (PB1) gene, complete cds 4038 4038 100% 0.0 96%
EU409959.1 Influenza A virus (A/swine/Ohio/C62006/06(H1N1)) polymerase PB1 (PB1) gene, complete cds 4036 4036 98% 0.0 97%
HM461800.1 Influenza A virus (A/swine/Minnesota/02011/2008(H1N2)) segment 2 polymerase PB1 (PB1) gene, partial cds 4034 4034 98% 0.0 97%
GQ457567.1 Influenza A virus (A/Saskatchewan/5351/2009(H1N1)) segment 2 polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 4034 4034 99% 0.0 97%
EU604692.1 Influenza A virus (A/swine/OH/511445/2007(H1N1)) segment 2 polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 4028 4028 98% 0.0 97%
GQ457565.1 Influenza A virus (A/Saskatchewan/5350/2009(H1N1)) segment 2 polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 4026 4026 99% 0.0 97%
EU692901.1 Influenza A virus (A/swine/Minnesota/2728/2007(H1N2)) segment 2 polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 4022 4022 100% 0.0 96%
EU409945.1 Influenza A virus (A/swine/Ohio/24366/07(H1N1)) polymerase PB1 (PB1) gene, complete cds 4022 4022 98% 0.0 97%
GQ457566.1 Influenza A virus (A/Saskatchewan/5131/2009(H1N1)) segment 2 polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 4020 4020 99% 0.0 97%
GU135939.1 Influenza A virus (A/swine/Iowa/H03LDH5/2003(H3N2)) segment 2 polymerase PB1 (PB1) gene, complete cds 4016 4016 98% 0.0 97%
HM125980.1 Influenza A virus (A/swine/MN/23506/2009(H1N1)) segment 2 polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 4016 4016 98% 0.0 97%
CY042310.1 Influenza A virus (A/swine/Illinois/Sg-00443/2008(H1N1)) segment 2 sequence 4016 4016 99% 0.0 96%
EU399757.1 Influenza A virus (A/Ontario/1252/2007(H3N2)) polymerase subunit PB1 (PB1) gene, complete cds 4016 4016 98% 0.0 97%
EU826557.2 Influenza A virus (A/mink/Nova Scotia/1055488/2007(H3N2)) segment 2 polymerase PB1 (PB1) gene, complete cds 4008 4008 98% 0.0 97%
CY045685.1 Influenza A virus (A/swine/Oklahoma/020734-3/2008(H1N2)) segment 2 sequence 3998 3998 100% 0.0 96%
CY045677.1 Influenza A virus (A/swine/Oklahoma/020734-2/2008(H1N2)) segment 2 sequence 3998 3998 100% 0.0 96%
CY045653.1 Influenza A virus (A/swine/Oklahoma/011521-4/2008(H1N2)) segment 2 sequence 3998 3998 100% 0.0 96%
CY045629.1 Influenza A virus (A/swine/Oklahoma/011289-10/2008(H1N2)) segment 2 sequence 3998 3998 100% 0.0 96%
CY045621.1 Influenza A virus (A/swine/Oklahoma/011289-9/2008(H1N2)) segment 2 sequence 3998 3998 100% 0.0 96%
CY045605.1 Influenza A virus (A/swine/Oklahoma/010710-9/2008(H1N2)) segment 2 sequence 3998 3998 100% 0.0 96%
CY045581.1 Influenza A virus (A/swine/Texas/008648/2008(H1N2)) segment 2 sequence 3998 3998 100% 0.0 96%
CY041845.1 Influenza A virus (A/swine/North Carolina/R08-001877-D08-013371/2008 (H3N2)) segment 2 sequence 3998 3998 100% 0.0 96%
CY045709.1 Influenza A virus (A/swine/Oklahoma/042169/2008(H1N2)) segment 2 sequence 3996 3996 99% 0.0 96%
CY045645.1 Influenza A virus (A/swine/Oklahoma/011521-5/2008(H1N2)) segment 2 sequence 3996 3996 99% 0.0 96%
CY045693.1 Influenza A virus (A/swine/Oklahoma/020736-2/2008(H1N2)) segment 2 sequence 3990 3990 100% 0.0 96%
CY045613.1 Influenza A virus (A/swine/Oklahoma/010710-8/2008(H1N2)) segment 2 sequence 3990 3990 100% 0.0 96%
CY045637.1 Influenza A virus (A/swine/Oklahoma/011289-8/2008(H1N2)) segment 2 sequence 3987 3987 99% 0.0 96%
DQ469996.1 Influenza A virus (A/turkey/Ontario/31232/2005(H3N2)) polymerase subunit PB1 (PB1) gene, complete cds 3985 3985 98% 0.0 97%
CY045701.1 Influenza A virus (A/swine/Oklahoma/020736-1/2008(H1N2)) segment 2 sequence 3983 3983 100% 0.0 96%
CY045669.1 Influenza A virus (A/swine/Oklahoma/016179-9/2008(H1N2)) segment 2 sequence 3983 3983 100% 0.0 96%
CY045661.1 Influenza A virus (A/swine/Oklahoma/016179-8/2008(H1N2)) segment 2 sequence 3983 3983 100% 0.0 96%
CY045597.1 Influenza A virus (A/swine/Oklahoma/010226-17/2008(H1N2)) segment 2 sequence 3983 3983 100% 0.0 96%
CY045589.1 Influenza A virus (A/swine/Oklahoma/010226-16/2008(H1N2)) segment 2 sequence 3981 3981 99% 0.0 96%
GQ484357.1 Influenza A virus (A/swine/Kansas/77778/2007(H1N1)) segment 2 polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3977 3977 98% 0.0 97%
CY035446.1 Influenza A virus (A/swine/Illinois/SG-00244/2007(H1N1)) segment 2 sequence 3977 3977 97% 0.0 97%
CY045541.1 Influenza A virus (A/swine/Oklahoma/053259/2008(H1N2)) segment 2 sequence 3975 3975 100% 0.0 96%
CY042318.1 Influenza A virus (A/swine/Illinois/Sg-00445/2008(H1N1)) segment 2 sequence 3975 3975 98% 0.0 96%
HM461760.1 Influenza A virus (A/swine/Minnesota/02053/2008(H1N1)) segment 2 polymerase PB1 (PB1) gene, partial cds 3971 3971 98% 0.0 97%
CY045533.1 Influenza A virus (A/swine/Texas/050625/2008(H1N2)) segment 2 sequence 3967 3967 100% 0.0 96%
EU692893.1 Influenza A virus (A/swine/Minnesota/761/2007(H3N2)) segment 2 polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3967 3967 100% 0.0 96%
CY035424.1 Influenza A virus (A/swine/Minnesota/SG-00237/2007(H3N2)) segment 2 sequence 3965 3965 97% 0.0 97%
HM461792.1 Influenza A virus (A/swine/Minnesota/02093/2008(H1N1)) segment 2 polymerase PB1 (PB1) gene, partial cds 3955 3955 98% 0.0 96%
HM461808.1 Influenza A virus (A/swine/Missouri/02060/2008(H1N1)) segment 2 polymerase PB1 (PB1) gene, partial cds 3955 3955 98% 0.0 96%
HM461816.1 Influenza A virus (A/swine/North Carolina/02023/2008(H1N1)) segment 2 polymerase PB1 (PB1) gene, partial cds 3955 3955 98% 0.0 96%
CY045525.1 Influenza A virus (A/swine/Texas/050593/2008(H1N2)) segment 2 sequence 3951 3951 99% 0.0 96%
CY033790.2 Influenza A virus (A/mallard/South Dakota/Sg-00125/2007(H3N2)) segment 2 sequence 3951 3951 100% 0.0 96%
CY035440.1 Influenza A virus (A/swine/Minnesota/SG-00242/2006(H3N2)) segment 2 sequence 3951 3951 97% 0.0 96%
CY045517.1 Influenza A virus (A/swine/Oklahoma/032726/2008(H1N2)) segment 2 sequence 3943 3943 100% 0.0 96%
CY041877.1 Influenza A virus (A/mallard/South Dakota/Sg-00128/2007(H3N2)) segment 2 sequence 3943 3943 100% 0.0 96%
CY041869.1 Influenza A virus (A/mallard/South Dakota/Sg-00127/2007(H3N2)) segment 2 sequence 3943 3943 100% 0.0 96%
CY041861.1 Influenza A virus (A/northern pintail/South Dakota/Sg-00126/2007(H3N2)) segment 2 sequence 3941 3941 99% 0.0 96%
HM461768.1 Influenza A virus (A/swine/Iowa/02039/2008(H1N2)) segment 2 polymerase PB1 (PB1) gene, partial cds 3931 3931 98% 0.0 96%
CY045557.1 Influenza A virus (A/swine/Kansas/015252/2009(H3N2)) segment 2 sequence 3919 3919 100% 0.0 96%
AF342823.1 Influenza A virus (A/Wisconsin/10/98 (H1N1)) PB1 gene, complete cds 3919 3919 100% 0.0 96%
CY086926.1 Influenza A virus (A/swine/Minnesota/239106/2010(H1N2)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3915 3915 99% 0.0 96%
AF455727.1 Influenza A virus (A/Swine/Iowa/930/01(H1N2)) polymerase subunit (PB1) gene, complete cds 3913 3913 97% 0.0 96%
GU937745.1 Influenza A virus (A/Kansas/13/2009(H3N2)) segment 2 polymerase PB1 (PB1) gene, complete cds 3905 3905 98% 0.0 96%
CY086918.1 Influenza A virus (A/swine/Minnesota/239105/2009(H3N2)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3903 3903 98% 0.0 96%
CY035437.1 Influenza A virus (A/swine/Minnesota/SG-00241/2007(H1N1)) segment 2 sequence 3901 3901 97% 0.0 96%
CY045549.1 Influenza A virus (A/swine/Oklahoma/001142/2009(H3N2)) segment 2 sequence 3887 3887 100% 0.0 96%
HQ840336.1 Influenza A virus (A/swine/South Dakota/152B/2009(H1N2)) segment 2 polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3881 3881 98% 0.0 96%
HQ734220.1 Influenza A virus (A/swine/Pennsylvania/62170-3/2010(H3N2)) segment 2 polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3881 3881 98% 0.0 96%

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Mon Mar 07, 2011 5:21 pm 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 27289
Location: Pittsburgh, PA USA
Top PA sequences

CY086903.1 Influenza A virus (A/swine/North Carolina/226126/2010(H1N2)) polymerase PA (PA) gene, complete cds 4264 4336 100% 0.0 100%
CY086887.1 Influenza A virus (A/swine/North Carolina/226124/2010(H1N2)) polymerase PA (PA) gene, complete cds 4256 4328 100% 0.0 100%
HM461809.1 Influenza A virus (A/swine/Missouri/02060/2008(H1N1)) segment 3 polymerase PA (PA) gene, partial cds 4044 4116 99% 0.0 100%
EU735823.1 Influenza A virus (A/turkey/OH/313053/2004(H3N2)) polymerase PA (PA) gene, complete cds 3669 3742 100% 0.0 100%
DQ335776.1 Influenza A virus (A/turkey/Ohio/313053/04(H3N2)) polymerase (PA) gene, complete cds 3653 3726 100% 0.0 100%
DQ150432.1 Influenza A virus (A/swine/IN/PU542/04 (H3N1)) polymerase (PA) gene, complete cds 3646 3682 100% 0.0 100%
EU743215.1 Influenza A virus (A/turkey/MN/366767/2005(H3N2)) segment 3 polymerase PA (PA) gene, complete cds 3638 3674 100% 0.0 100%
DQ469981.1 Influenza A virus (A/swine/Manitoba/12707/2005(H3N2)) polymerase acidic protein 2 (PA) gene, complete cds 3630 3702 100% 0.0 100%
EU826548.2 Influenza A virus (A/swine/Quebec/4001/2005(H3N2)) segment 3 polymerase PA (PA) gene, complete cds 3622 3694 100% 0.0 100%
DQ469997.1 Influenza A virus (A/turkey/Ontario/31232/2005(H3N2)) polymerase acidic protein 2 (PA) gene, complete cds 3614 3686 100% 0.0 100%
DQ469989.1 Influenza A virus (A/swine/Ontario/33853/2005(H3N2)) polymerase acidic protein 2 (PA) gene, complete cds 3614 3686 100% 0.0 100%
DQ469973.1 Influenza A virus (A/swine/British Columbia/28103/2005(H3N2)) polymerase acidic protein 2 (PA) gene, complete cds 3614 3686 100% 0.0 100%
DQ469965.1 Influenza A virus (A/swine/Alberta/14722/2005(H3N2)) polymerase acidic protein 2 (PA) gene, complete cds 3614 3686 100% 0.0 100%
EF551044.1 Influenza A virus (A/turkey/Illinois/2004(H3N2)) segment 3 polymerase PA (PA) gene, complete cds 3606 3642 100% 0.0 100%
DQ469957.1 Influenza A virus (A/Ontario/RV1273/2005(H3N2)) polymerase acidic protein 2 (PA) gene, complete cds 3606 3678 100% 0.0 100%
DQ150424.1 Influenza A virus (A/swine/MI/PU243/04 (H3N1)) polymerase (PA) gene, complete cds 3598 3670 100% 0.0 100%
HM125973.1 Influenza A virus (A/swine/MN/48683/2002(H1N1)) segment 3 polymerase PA (PA) gene, complete cds 3590 3626 100% 0.0 100%
FJ410139.1 Influenza A virus (A/swine/Minnesota/1145/2007(H3N2)) segment 3, complete sequence 3590 3662 100% 0.0 100%
EU735831.1 Influenza A virus (A/turkey/NC/353568/2005(H3N2)) polymerase PA (PA) gene, complete cds 3590 3662 100% 0.0 100%
GU135866.1 Influenza A virus (A/swine/Iowa/H02NJ56371/2002(H1N1)) segment 3 polymerase PA (PA) gene, complete cds 3582 3654 100% 0.0 100%
GU135874.1 Influenza A virus (A/swine/Iowa/H02NJ56391/2002(H1N1)) segment 3 polymerase PA (PA) gene, complete cds 3582 3618 100% 0.0 100%
GU135956.1 Influenza A virus (A/swine/Iowa/H03LS4/2003(H1N1)) segment 3 polymerase PA (PA) gene, complete cds 3582 3654 100% 0.0 100%
CY045566.1 Influenza A virus (A/swine/Oklahoma/008722/2007(H3N2)) segment 3 sequence 3582 3654 100% 0.0 100%
EU798879.1 Influenza A virus (A/swine/Korea/CAS08/2005(H1N1)) segment 3 polymerase PA (PA) gene, complete cds 3582 3618 100% 0.0 100%
EU798878.1 Influenza A virus (A/swine/Korea/CAN01/2004(H1N1)) segment 3 polymerase PA (PA) gene, complete cds 3582 3618 100% 0.0 100%
FJ638313.1 Influenza A virus (A/swine/IL/07003243/2007(H1N2)) segment 3 polymerase PA (PA) gene, complete cds 3574 3647 100% 0.0 100%
GU135909.1 Influenza A virus (A/swine/Iowa/H03G1/2003(H1N1)) segment 3 polymerase PA (PA) gene, complete cds 3558 3594 100% 0.0 100%
GU135972.1 Influenza A virus (A/swine/Iowa/H03UWF2/2003(H1N1)) segment 3 polymerase PA (PA) gene, complete cds 3558 3631 100% 0.0 100%
DQ889684.1 Influenza A virus (A/Iowa/CEID23/2005(H1N1)) polymerase PA (PA) gene, complete cds 3558 3594 100% 0.0 100%
CY033795.2 Influenza A virus (A/mallard/South Dakota/Sg-00128/2007(H3N2)) segment 3 sequence 3556 3593 99% 0.0 100%
CY033792.2 Influenza A virus (A/northern pintail/South Dakota/Sg-00126/2007(H3N2)) segment 3 sequence 3556 3593 99% 0.0 100%
CY033791.2 Influenza A virus (A/mallard/South Dakota/Sg-00125/2007(H3N2)) segment 3 sequence 3556 3593 99% 0.0 100%
FJ638305.1 Influenza A virus (A/swine/NC/00573/2005(H1N1)) segment 3 polymerase PA (PA) gene, complete cds 3550 3623 100% 0.0 100%
GU135890.1 Influenza A virus (A/swine/Iowa/H03BF5/2003(H3N2)) segment 3 polymerase PA (PA) gene, complete cds 3548 3621 99% 0.0 100%
CY033793.2 Influenza A virus (A/mallard/South Dakota/Sg-00127/2007(H3N2)) segment 3 sequence 3548 3585 99% 0.0 100%
HM461817.1 Influenza A virus (A/swine/North Carolina/02023/2008(H1N1)) segment 3 polymerase PA (PA) gene, partial cds 3544 3581 99% 0.0 100%
HM461841.1 Influenza A virus (A/swine/Iowa/02096/2008(H1N1)) segment 3 polymerase PA (PA) gene, partial cds 3544 3617 99% 0.0 100%
GU135964.1 Influenza A virus (A/swine/Iowa/H03US3/2003(H1N1)) segment 3 polymerase PA (PA) gene, complete cds 3542 3615 100% 0.0 100%
GQ484359.1 Influenza A virus (A/swine/Kansas/77778/2007(H1N1)) segment 3 polymerase PA (PA) gene, complete cds 3542 3579 100% 0.0 100%
CY035444.1 Influenza A virus (A/swine/Minnesota/SG-00243/2006(H3N2)) segment 3 sequence 3542 3579 99% 0.0 100%
CY045702.1 Influenza A virus (A/swine/Oklahoma/020736-1/2008(H1N2)) segment 3 sequence 3535 3571 100% 0.0 100%
CY045694.1 Influenza A virus (A/swine/Oklahoma/020736-2/2008(H1N2)) segment 3 sequence 3535 3571 100% 0.0 100%
CY045646.1 Influenza A virus (A/swine/Oklahoma/011521-5/2008(H1N2)) segment 3 sequence 3535 3571 100% 0.0 100%
CY045614.1 Influenza A virus (A/swine/Oklahoma/010710-8/2008(H1N2)) segment 3 sequence 3535 3571 100% 0.0 100%
CY045606.1 Influenza A virus (A/swine/Oklahoma/010710-9/2008(H1N2)) segment 3 sequence 3535 3571 100% 0.0 100%
CY045598.1 Influenza A virus (A/swine/Oklahoma/010226-17/2008(H1N2)) segment 3 sequence 3535 3571 100% 0.0 100%
CY045526.1 Influenza A virus (A/swine/Texas/050593/2008(H1N2)) segment 3 sequence 3535 3571 100% 0.0 100%
CY041846.1 Influenza A virus (A/swine/North Carolina/R08-001877-D08-013371/2008 (H3N2)) segment 3 sequence 3535 3571 100% 0.0 100%
EU826556.2 Influenza A virus (A/mink/Nova Scotia/1055488/2007(H3N2)) segment 3 polymerase PA (PA) gene, complete cds 3535 3535 100% 0.0 95%
GU135948.1 Influenza A virus (A/swine/Iowa/H03LJ10/2003(H1N1)) segment 3 polymerase PA (PA) gene, complete cds 3533 3605 99% 0.0 100%
CY045670.1 Influenza A virus (A/swine/Oklahoma/016179-9/2008(H1N2)) segment 3 sequence 3527 3563 100% 0.0 100%
CY045654.1 Influenza A virus (A/swine/Oklahoma/011521-4/2008(H1N2)) segment 3 sequence 3527 3527 100% 0.0 95%
CY045630.1 Influenza A virus (A/swine/Oklahoma/011289-10/2008(H1N2)) segment 3 sequence 3527 3563 100% 0.0 100%
CY035432.2 Influenza A virus (A/swine/Minnesota/SG-00239/2007(H1N2)) segment 3 sequence 3527 3563 100% 0.0 100%
FJ638297.1 Influenza A virus (A/swine/IL/00685/2005(H1N1)) segment 3 polymerase PA (PA) gene, complete cds 3527 3599 100% 0.0 100%
CY035441.1 Influenza A virus (A/swine/Minnesota/SG-00242/2006(H3N2)) segment 3 sequence 3525 3597 98% 0.0 100%
FJ611897.1 Influenza A virus (A/swine/Minnesota/07002083/2007(H1N1)) segment 3 polymerase PA (PA) gene, complete cds 3519 3591 100% 0.0 100%
CY045662.1 Influenza A virus (A/swine/Oklahoma/016179-8/2008(H1N2)) segment 3 sequence 3519 3555 100% 0.0 100%
CY045638.1 Influenza A virus (A/swine/Oklahoma/011289-8/2008(H1N2)) segment 3 sequence 3519 3555 100% 0.0 100%
CY045622.1 Influenza A virus (A/swine/Oklahoma/011289-9/2008(H1N2)) segment 3 sequence 3519 3555 100% 0.0 100%
CY045574.1 Influenza A virus (A/swine/Oklahoma/011506/2007(H3N2)) segment 3 sequence 3519 3591 100% 0.0 100%
EU604693.1 Influenza A virus (A/swine/OH/511445/2007(H1N1)) segment 3 polymerase PA (PA) gene, complete cds 3519 3555 100% 0.0 100%
CY035435.1 Influenza A virus (A/swine/Minnesota/SG-00240/2007(H1N1)) segment 3 sequence 3517 3553 99% 0.0 100%
HQ840334.1 Influenza A virus (A/swine/South Dakota/152B/2009(H1N2)) segment 3 polymerase PA (PA) gene, complete cds 3511 3547 100% 0.0 100%
GQ452240.1 Influenza A virus (A/swine/Iowa/H04YS2/2004(H1N1)) segment 3 polymerase PA (PA) gene, complete cds 3511 3547 100% 0.0 100%
CY045518.1 Influenza A virus (A/swine/Oklahoma/032726/2008(H1N2)) segment 3 sequence 3511 3547 100% 0.0 100%
CY042319.1 Influenza A virus (A/swine/Illinois/Sg-00445/2008(H1N1)) segment 3 sequence 3511 3547 100% 0.0 100%
CY042311.1 Influenza A virus (A/swine/Illinois/Sg-00443/2008(H1N1)) segment 3 sequence 3511 3547 100% 0.0 100%
CY035429.1 Influenza A virus (A/swine/Minnesota/SG-00238/2006(H1N1)) segment 3 sequence 3509 3545 99% 0.0 100%
HM461833.1 Influenza A virus (A/swine/Nebraska/02013/2008(H1N1)) segment 3 polymerase PA (PA) gene, partial cds 3505 3541 99% 0.0 100%
CY045686.1 Influenza A virus (A/swine/Oklahoma/020734-3/2008(H1N2)) segment 3 sequence 3503 3539 100% 0.0 100%
CY045678.1 Influenza A virus (A/swine/Oklahoma/020734-2/2008(H1N2)) segment 3 sequence 3503 3539 100% 0.0 100%
CY045590.1 Influenza A virus (A/swine/Oklahoma/010226-16/2008(H1N2)) segment 3 sequence 3503 3539 100% 0.0 100%
CY035425.1 Influenza A virus (A/swine/Minnesota/SG-00237/2007(H3N2)) segment 3 sequence 3501 3573 99% 0.0 100%
CY045710.1 Influenza A virus (A/swine/Oklahoma/042169/2008(H1N2)) segment 3 sequence 3495 3531 100% 0.0 100%
CY042315.1 Influenza A virus (A/swine/Illinois/Sg-00444/2008(H1N1)) segment 3 sequence 3495 3531 100% 0.0 100%
EU399756.1 Influenza A virus (A/Ontario/1252/2007(H3N2)) polymerase acidic protein 2 (PA) gene, complete cds 3495 3567 100% 0.0 100%
GU135925.1 Influenza A virus (A/swine/Iowa/H03HO7/2003(H3N2)) segment 3 polymerase PA (PA) gene, complete cds 3493 3565 99% 0.0 100%
AF251433.1 Influenza A virus (A/Swine/Minnesota/593/99 (H3N2)) polymerase acidic protein 2 (PA) gene, complete cds 3487 3487 100% 0.0 95%
AF251425.1 Influenza A virus (A/Swine/Iowa/569/99 (H3N2)) polymerase acidic protein 2 (PA) gene, complete cds 3487 3487 100% 0.0 95%
AF251417.1 Influenza A virus (A/Swine/Iowa/533/99 (H3N2)) polymerase acidic protein 2 (PA) gene, complete cds 3487 3487 100% 0.0 95%
AF251409.1 Influenza A virus (A/Swine/Nebraska/209/98 (H3N2)) polymerase acidic protein 2 (PA) gene, complete cds 3487 3487 100% 0.0 95%
HM461761.1 Influenza A virus (A/swine/Minnesota/02053/2008(H1N1)) segment 3 polymerase PA (PA) gene, partial cds 3481 3553 99% 0.0 100%
GQ457562.1 Influenza A virus (A/Saskatchewan/5131/2009(H1N1)) segment 3 polymerase PA (PA) gene, complete cds 3479 3551 99% 0.0 100%
CY045542.1 Influenza A virus (A/swine/Oklahoma/053259/2008(H1N2)) segment 3 sequence 3479 3515 100% 0.0 100%
AF455722.1 Influenza A virus (A/Swine/Illinois/100084/01 (H1N2)) polymerase acidic protein 2 (PA) gene, complete cds 3479 3515 100% 0.0 100%
AF455720.1 Influenza A virus (A/Swine/Indiana/P12439/00 (H1N2)) polymerase acidic protein 2 (PA) gene, complete cds 3479 3515 100% 0.0 100%
CY035438.1 Influenza A virus (A/swine/Minnesota/SG-00241/2007(H1N1)) segment 3 sequence 3477 3513 99% 0.0 100%
EU409947.1 Influenza A virus (A/swine/Ohio/24366/07(H1N1)) polymerase PA (PA) gene, partial cds 3475 3511 98% 0.0 100%
HM461777.1 Influenza A virus (A/swine/Ohio/02026/2008(H1N1)) segment 3 polymerase PA (PA) gene, partial cds 3473 3509 99% 0.0 100%
HM461793.1 Influenza A virus (A/swine/Minnesota/02093/2008(H1N1)) segment 3 polymerase PA-like (PA) gene, complete sequence 3473 3545 99% 0.0 100%
GQ457564.1 Influenza A virus (A/Saskatchewan/5351/2009(H1N1)) segment 3 polymerase PA (PA) gene, complete cds 3471 3543 99% 0.0 100%
GQ457563.1 Influenza A virus (A/Saskatchewan/5350/2009(H1N1)) segment 3 polymerase PA (PA) gene, complete cds 3471 3543 99% 0.0 100%
CY045558.1 Influenza A virus (A/swine/Kansas/015252/2009(H3N2)) segment 3 sequence 3471 3507 100% 0.0 100%
CY035447.1 Influenza A virus (A/swine/Illinois/SG-00244/2007(H1N1)) segment 3 sequence 3471 3507 98% 0.0 100%
AF250129.1 Influenza A virus (A/Swine/Indiana/9K035/99 (H1N2)) polymerase acidic protein 2 (PA) gene, complete cds 3471 3507 100% 0.0 100%
GU135940.1 Influenza A virus (A/swine/Iowa/H03LDH5/2003(H3N2)) segment 3 polymerase PA (PA) gene, complete cds 3469 3541 99% 0.0 100%
HM461769.1 Influenza A virus (A/swine/Iowa/02039/2008(H1N2)) segment 3 polymerase PA (PA) gene, partial cds 3465 3501 99% 0.0 100%
CY035418.1 Influenza A virus (A/swine/Minnesota/SG-00235/2007(H3N2)) segment 3 sequence 3465 3537 98% 0.0 100%
DQ145539.1 Influenza A virus (A/swine/Minnesota/00395/2004(H3N1)) PA gene, complete cds 3463 3536 100% 0.0 100%

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Mon Mar 07, 2011 5:23 pm 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 27289
Location: Pittsburgh, PA USA
Top 100 NP sequences

CY086905.1 Influenza A virus (A/swine/North Carolina/226126/2010(H1N2)) nucleocapsid protein (NP) gene, complete cds 3013 3013 100% 0.0 100%
CY086897.1 Influenza A virus (A/swine/North Carolina/226125/2010(H1N2)) nucleocapsid protein (NP) gene, complete cds 3013 3013 100% 0.0 100%
CY086889.1 Influenza A virus (A/swine/North Carolina/226124/2010(H1N2)) nucleocapsid protein (NP) gene, complete cds 3013 3013 100% 0.0 100%
CY069620.1 Influenza A virus (A/Singapore/276/2009(H1N1)) segment 5 sequence 2926 2926 100% 0.0 99%
CY063849.1 Influenza A virus (A/Singapore/KK066/2010(H1N1)) segment 5 sequence 2926 2926 100% 0.0 99%
CY063755.1 Influenza A virus (A/Singapore/GP3084/2009(H1N1)) segment 5 sequence 2926 2926 100% 0.0 99%
CY062541.1 Influenza A virus (A/Mexico city/CIA9/2009(H1N1)) segment 5 sequence 2926 2926 100% 0.0 99%
CY060735.1 Influenza A virus (A/Ontario/35273/2009(H1N1)) segment 5 sequence 2926 2926 100% 0.0 99%
CY060679.1 Influenza A virus (A/Ontario/315107/2009(H1N1)) segment 5 sequence 2926 2926 100% 0.0 99%
CY060575.1 Influenza A virus (A/Ontario/29801/2009(H1N1)) segment 5 sequence 2926 2926 100% 0.0 99%
CY060519.1 Influenza A virus (A/Ontario/222656/2009(H1N1)) segment 5 sequence 2926 2926 100% 0.0 99%
HM014327.1 Influenza A virus (A/Guangzhou/GIRD07/2009(H1N1)) segment 5 nucleocapsid protein (NP) gene, complete cds 2926 2926 100% 0.0 99%
CY055304.1 Influenza A virus (A/Singapore/GN285/2009(H1N1)) segment 5 sequence 2926 2926 100% 0.0 99%
CY054679.1 Influenza A virus (A/Russia/180/2009(H1N1)) segment 5 sequence 2926 2926 100% 0.0 99%
CY054671.1 Influenza A virus (A/Russia/171/2009(H1N1)) segment 5 sequence 2926 2926 100% 0.0 99%
CY054639.1 Influenza A virus (A/Russia/12/2009(H1N1)) segment 5 sequence 2926 2926 100% 0.0 99%
CY053737.2 Influenza A virus (A/Russia/178/2009(H1N1)) segment 5 sequence 2926 2926 100% 0.0 99%
CY053628.1 Influenza A virus (A/Russia/165/2009(H1N1)) segment 5 sequence 2926 2926 100% 0.0 99%
CY047423.1 Influenza A virus (A/Victoria/2005/2009(H1N1)) segment 5 sequence 2926 2926 100% 0.0 99%
CY045235.1 Influenza A virus (A/Taiwan/126/2009(H1N1)) segment 5 sequence 2926 2926 100% 0.0 99%
GQ288373.1 Influenza A virus (A/Fuzhou/01/2009(H1N1)) segment 5 nucleocapsid protein (NP) gene, complete cds 2926 2926 100% 0.0 99%
HQ011419.1 Influenza A virus (A/Guangdong/45/2009(H1N1)) segment 5 nucleocapsid protein (NP) gene, complete cds 2920 2920 99% 0.0 99%
GQ502907.1 Influenza A virus (A/Toronto/R8557/2009(H1N1)) segment 5 nucleocapsid protein (NP) gene, complete cds 2920 2920 99% 0.0 99%
HQ728111.1 Influenza A virus (A/swine/Taiwan/CH-1204/2009(H1N1)) segment 5 nucleocapsid protein (NP) gene, complete cds 2918 2918 100% 0.0 99%
CY069635.2 Influenza A virus (A/Singapore/478/2009(H1N1)) segment 5 sequence 2918 2918 100% 0.0 99%
CY069627.2 Influenza A virus (A/Singapore/471/2009(H1N1)) segment 5 sequence 2918 2918 100% 0.0 99%
CY069642.1 Influenza A virus (A/Singapore/527/2009(H1N1)) segment 5 sequence 2918 2918 99% 0.0 99%
CY060751.1 Influenza A virus (A/Ontario/9739/2009(H1N1)) segment 5 sequence 2918 2918 100% 0.0 99%
CY060743.1 Influenza A virus (A/Ontario/9698/2009(H1N1)) segment 5 sequence 2918 2918 100% 0.0 99%
CY060695.1 Influenza A virus (A/Ontario/315187/2009(H1N1)) segment 5 sequence 2918 2918 100% 0.0 99%
CY060671.1 Influenza A virus (A/Ontario/315047/2009(H1N1)) segment 5 sequence 2918 2918 100% 0.0 99%
CY060663.1 Influenza A virus (A/Ontario/315015/2009(H1N1)) segment 5 sequence 2918 2918 100% 0.0 99%
CY060655.1 Influenza A virus (A/Ontario/315003/2009(H1N1)) segment 5 sequence 2918 2918 100% 0.0 99%
CY060647.1 Influenza A virus (A/Ontario/314603/2009(H1N1)) segment 5 sequence 2918 2918 100% 0.0 99%
CY060599.1 Influenza A virus (A/Ontario/305598/2009(H1N1)) segment 5 sequence 2918 2918 100% 0.0 99%
CY060591.1 Influenza A virus (A/Ontario/305139/2009(H1N1)) segment 5 sequence 2918 2918 100% 0.0 99%
CY060535.1 Influenza A virus (A/Ontario/237882/2009(H1N1)) segment 5 sequence 2918 2918 100% 0.0 99%
CY054663.1 Influenza A virus (A/Russia/100/2009(H1N1)) segment 5 sequence 2918 2918 100% 0.0 99%
CY054655.1 Influenza A virus (A/Russia/61/2009(H1N1)) segment 5 sequence 2918 2918 100% 0.0 99%
CY054647.1 Influenza A virus (A/Russia/19/2009(H1N1)) segment 5 sequence 2918 2918 100% 0.0 99%
CY053753.1 Influenza A virus (A/Russia/200/2009(H1N1)) segment 5 sequence 2918 2918 100% 0.0 99%
CY053729.1 Influenza A virus (A/Russia/74/2009(H1N1)) segment 5 sequence 2918 2918 100% 0.0 99%
CY045955.1 Influenza A virus (A/Toronto/T0106/2009(H1N1)) segment 5 sequence 2918 2918 100% 0.0 99%
CY043351.1 Influenza A virus (A/Denmark/528/2009(H1N1)) segment 5 sequence 2918 2918 100% 0.0 99%
GQ169385.1 Influenza A virus (A/Thailand/104/2009(H1N1)) segment 5 nucleocapsid protein (NP) gene, complete cds 2918 2918 100% 0.0 99%
CY060703.1 Influenza A virus (A/Ontario/315613/2009(H1N1)) segment 5 sequence 2916 2916 99% 0.0 99%
CY060687.1 Influenza A virus (A/Ontario/315181/2009(H1N1)) segment 5 sequence 2916 2916 99% 0.0 99%
CY060623.1 Influenza A virus (A/Ontario/313762/2009(H1N1)) segment 5 sequence 2916 2916 99% 0.0 99%
GU189652.1 Influenza A virus (A/Zhejiang/DTID-ZJU03/2009(H1N1)) segment 5 nucleocapsid protein (NP) gene, complete cds 2916 2916 99% 0.0 99%
GU112093.1 Influenza A virus (A/Zhejiang/DTID-ZJU02/2009(H1N1)) segment 5 nucleocapsid protein (NP) gene, complete cds 2916 2916 99% 0.0 99%
CY045243.1 Influenza A virus (A/Taiwan/137/2009(H1N1)) segment 5 sequence 2916 2916 99% 0.0 99%
GQ258466.1 Influenza A virus (A/Auckland/1/2009(H1N1)) segment 5 nucleocapsid protein (NP) gene, complete cds 2914 2914 99% 0.0 99%
CY060615.1 Influenza A virus (A/Ontario/309862/2009(H1N1)) segment 5 sequence 2912 2912 99% 0.0 99%
CY060567.1 Influenza A virus (A/Ontario/296008/2009(H1N1)) segment 5 sequence 2912 2912 99% 0.0 99%
CY049397.1 Influenza A virus (A/Singapore/ON506/2009(H1N1)) segment 5 sequence 2912 2912 99% 0.0 99%
CY049061.1 Influenza A virus (A/Singapore/ON305/2009(H1N1)) segment 5 sequence 2912 2912 99% 0.0 99%
CY081070.1 Influenza A virus (A/Ontario/3620/2010(H1N1)) nucleocapsid protein (NP) gene, complete cds 2910 2910 100% 0.0 99%
HQ728103.1 Influenza A virus (A/swine/Taiwan/PT-1204/2009(H1N1)) segment 5 nucleocapsid protein (NP) gene, complete cds 2910 2910 100% 0.0 99%
HQ728095.1 Influenza A virus (A/swine/Taiwan/HL-1125/2009(H1N1)) segment 5 nucleocapsid protein (NP) gene, complete cds 2910 2910 100% 0.0 99%
CY060719.1 Influenza A virus (A/Ontario/320266/2009(H1N1)) segment 5 sequence 2910 2910 100% 0.0 99%
CY060711.1 Influenza A virus (A/Ontario/315637/2009(H1N1)) segment 5 sequence 2910 2910 100% 0.0 99%
CY060543.1 Influenza A virus (A/Ontario/25389/2009(H1N1)) segment 5 sequence 2910 2910 100% 0.0 99%
CY060511.1 Influenza A virus (A/Ontario/10296/2009(H1N1)) segment 5 sequence 2910 2910 100% 0.0 99%
CY060503.1 Influenza A virus (A/Ontario/10016/2009(H1N1)) segment 5 sequence 2910 2910 100% 0.0 99%
CY054631.1 Influenza A virus (A/Russia/4/2009(H1N1)) segment 5 sequence 2910 2910 100% 0.0 99%
CY053690.1 Influenza A virus (A/Russia/191/2009(H1N1)) segment 5 sequence 2910 2910 100% 0.0 99%
CY053682.1 Influenza A virus (A/Russia/14/2009(H1N1)) segment 5 sequence 2910 2910 100% 0.0 99%
GQ866932.1 Influenza A virus (A/Thailand/CU-H106/2009(H1N1)) segment 5 nucleocapsid protein (NP) gene, complete cds 2910 2910 100% 0.0 99%
GQ166232.1 Influenza A virus (A/Nonthaburi/102/2009(H1N1)) segment 5 nucleocapsid protein (NP) gene, complete cds 2910 2910 100% 0.0 99%
CY060639.1 Influenza A virus (A/Ontario/314137/2009(H1N1)) segment 5 sequence 2906 2906 99% 0.0 99%
CY060607.1 Influenza A virus (A/Ontario/308054/2009(H1N1)) segment 5 sequence 2906 2906 99% 0.0 99%
CY049341.1 Influenza A virus (A/Singapore/ON582/2009(H1N1)) segment 5 sequence 2906 2906 99% 0.0 99%
CY041969.1 Influenza A virus (A/Israel/276/2009(H1N1)) segment 5 sequence 2906 2906 99% 0.0 99%
CY083771.1 Influenza A virus (A/Athens/INS256/2009(H1N1)) nucleocapsid protein (NP) gene, complete cds 2904 2904 99% 0.0 99%
CY043343.1 Influenza A virus (A/Denmark/524/2009(H1N1)) segment 5 sequence 2904 2904 99% 0.0 99%
CY083716.1 Influenza A virus (A/Madrid/INS112/2009(H1N1)) nucleocapsid protein (NP) gene, complete cds 2902 2902 99% 0.0 99%
CY076796.1 Influenza A virus (A/Ontario/156785/2009(H1N1)) segment 5 sequence 2902 2902 100% 0.0 99%
CY076788.1 Influenza A virus (A/Ontario/152846/2009(H1N1)) segment 5 sequence 2902 2902 100% 0.0 99%
CY076772.1 Influenza A virus (A/Ontario/147723/2009(H1N1)) segment 5 sequence 2902 2902 100% 0.0 99%
CY076756.1 Influenza A virus (A/Ontario/142358/2009(H1N1)) segment 5 sequence 2902 2902 100% 0.0 99%
CY063841.1 Influenza A virus (A/Singapore/GP999/2010(H1N1)) segment 5 sequence 2902 2902 100% 0.0 99%
CY060727.1 Influenza A virus (A/Ontario/328474/2009(H1N1)) segment 5 sequence 2902 2902 100% 0.0 99%
CY060559.1 Influenza A virus (A/Ontario/26184/2009(H1N1)) segment 5 sequence 2902 2902 100% 0.0 99%
GU324338.1 Influenza A virus (A/swine/Taiwan/TD-4119B2/2009(H1N1)) segment 5 nucleocapsid protein (NP) gene, complete cds 2902 2902 100% 0.0 99%
GQ866960.1 Influenza A virus (A/Thailand/CU-H9/2009(H1N1)) segment 5 nucleocapsid protein (NP) gene, complete cds 2902 2902 100% 0.0 99%
CY045979.1 Influenza A virus (A/Toronto/T9842/2009(H1N1)) segment 5 sequence 2902 2902 100% 0.0 99%
CY045971.1 Influenza A virus (A/Toronto/T5362/2009(H1N1)) segment 5 sequence 2902 2902 100% 0.0 99%
CY045512.1 Influenza A virus (A/Toronto/R8564/2009(H1N1)) segment 5 sequence 2902 2902 100% 0.0 99%
GQ385301.1 Influenza A virus (A/Toronto/0462/2009(H1N1)) segment 5 nucleocapsid protein (NP) gene, complete cds 2902 2902 100% 0.0 99%
GQ253487.1 Influenza A virus (A/Zhejiang/2/2009(H1N1)) segment 5 nucleocapsid protein (NP) gene, complete cds 2902 2902 100% 0.0 99%
CY087011.1 Influenza A virus (A/New York/3565/2009(H1N1)) nucleocapsid protein (NP) gene, complete cds 2900 2900 99% 0.0 99%
CY081545.1 Influenza A virus (A/Cambodia/NHRCC00008/2009(H1N1)) nucleocapsid protein (NP) gene, complete cds 2900 2900 99% 0.0 99%
CY081537.1 Influenza A virus (A/Cambodia/NHRCC00007/2009(H1N1)) nucleocapsid protein (NP) gene, complete cds 2900 2900 99% 0.0 99%
CY081529.1 Influenza A virus (A/Cambodia/NHRCC00006/2009(H1N1)) nucleocapsid protein (NP) gene, complete cds 2900 2900 99% 0.0 99%
CY081521.1 Influenza A virus (A/Cambodia/NHRCC00005/2009(H1N1)) nucleocapsid protein (NP) gene, complete cds 2900 2900 99% 0.0 99%
CY081513.1 Influenza A virus (A/Cambodia/NHRCC00004/2009(H1N1)) nucleocapsid protein (NP) gene, complete cds 2900 2900 99% 0.0 99%
CY081505.1 Influenza A virus (A/Cambodia/NHRCC00003/2009(H1N1)) nucleocapsid protein (NP) gene, complete cds 2900 2900 99% 0.0 99%
CY081497.1 Influenza A virus (A/Cambodia/NHRCC00002/2009(H1N1)) nucleocapsid protein (NP) gene, complete cds 2900 2900 99% 0.0 99%
CY081489.1 Influenza A virus (A/Cambodia/NHRCC00001/2009(H1N1)) nucleocapsid protein (NP) gene, complete cds 2900 2900 99% 0.0 99%
HM230696.1 Influenza A virus (A/Zhoushan/1/2009(H1N1)) segment 5 nucleocapsid protein (NP) gene, complete cds 2900 2900 99% 0.0 99%

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Mon Mar 07, 2011 5:32 pm 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 27289
Location: Pittsburgh, PA USA
Top 100 MP sequences

CY086907.1 Influenza A virus (A/swine/North Carolina/226126/2010(H1N2)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1986 1986 100% 0.0 100%
CY086899.1 Influenza A virus (A/swine/North Carolina/226125/2010(H1N2)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1986 1986 100% 0.0 100%
CY086891.1 Influenza A virus (A/swine/North Carolina/226124/2010(H1N2)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1986 1986 100% 0.0 100%
HQ728113.1 Influenza A virus (A/swine/Taiwan/CH-1204/2009(H1N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1970 1970 100% 0.0 99%
HQ728105.1 Influenza A virus (A/swine/Taiwan/PT-1204/2009(H1N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1970 1970 100% 0.0 99%
HQ393496.1 Influenza A virus (A/swine/Taiwan/TD-2542/2010(H1N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1970 1970 100% 0.0 99%
CY069644.1 Influenza A virus (A/Singapore/527/2009(H1N1)) segment 7 sequence 1970 1970 100% 0.0 99%
CY069629.1 Influenza A virus (A/Singapore/471/2009(H1N1)) segment 7 sequence 1970 1970 100% 0.0 99%
CY063851.1 Influenza A virus (A/Singapore/KK066/2010(H1N1)) segment 7 sequence 1970 1970 100% 0.0 99%
CY063791.1 Influenza A virus (A/Singapore/ON1868/2009(H1N1)) segment 7 sequence 1970 1970 100% 0.0 99%
CY063783.1 Influenza A virus (A/Singapore/ON0801/2009(H1N1)) segment 7 sequence 1970 1970 100% 0.0 99%
CY054665.1 Influenza A virus (A/Russia/100/2009(H1N1)) segment 7 sequence 1970 1970 100% 0.0 99%
CY054657.1 Influenza A virus (A/Russia/61/2009(H1N1)) segment 7 sequence 1970 1970 100% 0.0 99%
CY045237.1 Influenza A virus (A/Taiwan/126/2009(H1N1)) segment 7 sequence 1970 1970 100% 0.0 99%
CY045498.1 Influenza A virus (A/Baden-Wurttemberg/448/2009(H1N1)) segment 7 sequence 1970 1970 100% 0.0 99%
CY076719.1 Influenza A virus (A/ferret/Washington/WADDL13230/2009(H1N1)) segment 7 sequence 1968 1968 99% 0.0 99%
CY084463.1 Influenza A virus (A/New York/6537/2009(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1966 1966 99% 0.0 99%
CY086915.1 Influenza A virus (A/swine/Minnesota/226128/2010(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1963 1963 100% 0.0 99%
CY086883.1 Influenza A virus (A/swine/Indiana/240218/2010(H1N2)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1963 1963 100% 0.0 99%
CY081568.1 Influenza A virus (A/swine/South Dakota/4/2010(H1N2)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1963 1963 100% 0.0 99%
HQ661365.1 Influenza A virus (A/Russia/01-MA/2009(H1N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1963 1963 100% 0.0 99%
HQ652623.1 Influenza A virus (A/Jiangsu/S62/2009(H1N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1963 1963 100% 0.0 99%
HQ652622.1 Influenza A virus (A/Jiangsu/S61/2009(H1N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1963 1963 100% 0.0 99%
HQ011421.1 Influenza A virus (A/Guangdong/45/2009(H1N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1963 1963 100% 0.0 99%
CY063843.1 Influenza A virus (A/Singapore/GP999/2010(H1N1)) segment 7 sequence 1963 1963 100% 0.0 99%
CY060713.1 Influenza A virus (A/Ontario/315637/2009(H1N1)) segment 7 sequence 1963 1963 100% 0.0 99%
CY060697.1 Influenza A virus (A/Ontario/315187/2009(H1N1)) segment 7 sequence 1963 1963 100% 0.0 99%
CY060673.1 Influenza A virus (A/Ontario/315047/2009(H1N1)) segment 7 sequence 1963 1963 100% 0.0 99%
CY060665.1 Influenza A virus (A/Ontario/315015/2009(H1N1)) segment 7 sequence 1963 1963 100% 0.0 99%
CY060641.1 Influenza A virus (A/Ontario/314137/2009(H1N1)) segment 7 sequence 1963 1963 100% 0.0 99%
CY060625.1 Influenza A virus (A/Ontario/313762/2009(H1N1)) segment 7 sequence 1963 1963 100% 0.0 99%
CY060601.1 Influenza A virus (A/Ontario/305598/2009(H1N1)) segment 7 sequence 1963 1963 100% 0.0 99%
CY060585.1 Influenza A virus (A/Ontario/304434/2009(H1N1)) segment 7 sequence 1963 1963 100% 0.0 99%
CY060577.1 Influenza A virus (A/Ontario/29801/2009(H1N1)) segment 7 sequence 1963 1963 100% 0.0 99%
CY060569.1 Influenza A virus (A/Ontario/296008/2009(H1N1)) segment 7 sequence 1963 1963 100% 0.0 99%
CY055306.1 Influenza A virus (A/Singapore/GN285/2009(H1N1)) segment 7 sequence 1963 1963 100% 0.0 99%
GU592890.1 Influenza A virus (A/Barnaul/04/2009(H1N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1963 1963 100% 0.0 99%
GU560009.1 Influenza A virus (A/Tomsk/05/2009(H1N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1963 1963 100% 0.0 99%
GU367318.1 Influenza A virus (A/Tomsk/07/2009(H1N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1963 1963 100% 0.0 99%
CY053755.1 Influenza A virus (A/Russia/200/2009(H1N1)) segment 7 sequence 1963 1963 100% 0.0 99%
CY053622.1 Influenza A virus (A/swine/Italy/290271/2009(H1N1)) segment 7 sequence 1963 1963 100% 0.0 99%
GQ360066.1 Influenza A virus (A/Stockholm/32/2009(H1N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1963 1963 100% 0.0 99%
CY060721.1 Influenza A virus (A/Ontario/320266/2009(H1N1)) segment 7 sequence 1959 1959 99% 0.0 99%
CY060705.1 Influenza A virus (A/Ontario/315613/2009(H1N1)) segment 7 sequence 1959 1959 99% 0.0 99%
CY060689.1 Influenza A virus (A/Ontario/315181/2009(H1N1)) segment 7 sequence 1959 1959 99% 0.0 99%
CY060649.1 Influenza A virus (A/Ontario/314603/2009(H1N1)) segment 7 sequence 1959 1959 99% 0.0 99%
CY060529.1 Influenza A virus (A/Ontario/235657/2009(H1N1)) segment 7 sequence 1959 1959 99% 0.0 99%
CY047747.1 Influenza A virus (A/Taiwan/526/2009(H1N1)) segment 7 sequence 1959 1959 99% 0.0 99%
CY045245.1 Influenza A virus (A/Taiwan/137/2009(H1N1)) segment 7 sequence 1959 1959 99% 0.0 99%
GQ359767.1 Influenza A virus (A/Stockholm/31/2009(H1N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1959 1959 100% 0.0 99%
CY043337.1 Influenza A virus (A/Denmark/523/2009(H1N1)) segment 7 sequence 1957 1957 99% 0.0 99%
FN423715.1 Influenza A virus (A/Luxembourg/43/2009(H1N1)) partial matrix protein 1 (M gene), segment 7, viral cRNA 1957 1957 99% 0.0 99%
CY086951.1 Influenza A virus (A/swine/Thailand/CU-M8_2/2009(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1955 1955 100% 0.0 99%
CY050370.1 Influenza A virus (A/Korea/S1/2009(H1N1)) segment 7 sequence 1955 1955 100% 0.0 99%
CY069637.1 Influenza A virus (A/Singapore/478/2009(H1N1)) segment 7 sequence 1955 1955 100% 0.0 99%
CY069622.1 Influenza A virus (A/Singapore/276/2009(H1N1)) segment 7 sequence 1955 1955 100% 0.0 99%
HM780473.1 Influenza A virus (A/Guangdong/06/2009(H1N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1955 1955 100% 0.0 99%
HM370970.1 Influenza A virus (A/turkey/Ontario/FAV110/2009(H1N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1955 1955 100% 0.0 99%
HM370963.1 Influenza A virus (A/turkey/Ontario/FAV110/2009(H1N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1955 1955 100% 0.0 99%
HM370978.1 Influenza A virus (A/turkey/Ontario/FAV114-17/2009(H1N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1955 1955 100% 0.0 99%
HM173600.1 Influenza A virus (A/Blagovechensk/01/2009(H1N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1955 1955 100% 0.0 99%
AB538392.1 Influenza A virus (A/Nagano/RC1/2009(H1N1)) M2, M1 genes for matrix protein 2, matrix protein 1, complete cds, segment: 7 1955 1955 99% 0.0 99%
CY060657.1 Influenza A virus (A/Ontario/315003/2009(H1N1)) segment 7 sequence 1955 1955 100% 0.0 99%
CY060561.1 Influenza A virus (A/Ontario/26184/2009(H1N1)) segment 7 sequence 1955 1955 100% 0.0 99%
HM014333.1 Influenza A virus (A/Guangzhou/GIRD07/2009(H1N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1955 1955 100% 0.0 99%
GU324342.1 Influenza A virus (A/swine/Taiwan/TD-4119B2/2009(H1N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1955 1955 100% 0.0 99%
GU211244.1 Influenza A virus (A/Tomsk/02/2009(H1N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1955 1955 100% 0.0 99%
CY046944.1 Influenza A virus (A/Netherlands/602/2009(H1N1)) segment 7 sequence 1955 1955 100% 0.0 99%
GQ866962.1 Influenza A virus (A/Thailand/CU-H9/2009(H1N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1955 1955 100% 0.0 99%
GQ332646.1 Influenza A virus (A/New York/1682-WC_RG1/2009(H1N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1955 1955 100% 0.0 99%
CY045957.1 Influenza A virus (A/Toronto/T0106/2009(H1N1)) segment 7 sequence 1955 1955 99% 0.0 99%
GQ369419.1 Influenza A virus (A/swine/Alberta/OTH-33-21/2009(H1N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1955 1955 100% 0.0 99%
GQ365365.1 Influenza A virus (A/Stockholm/36/2009(H1N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1955 1955 100% 0.0 99%
GQ360061.1 Influenza A virus (A/Stockholm/33/2009(H1N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1955 1955 100% 0.0 99%
GQ251038.1 Influenza A virus (A/Italy/05/2009(H1N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1955 1955 100% 0.0 99%
CY064794.1 Influenza A virus (A/Guangdong/SB1/2009(H1N1)) segment 7 sequence 1953 1953 99% 0.0 99%
HM230702.1 Influenza A virus (A/Zhoushan/52/2009(H1N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1951 1951 100% 0.0 99%
CY060633.1 Influenza A virus (A/Ontario/314095/2009(H1N1)) segment 7 sequence 1951 1951 99% 0.0 99%
CY060593.1 Influenza A virus (A/Ontario/305139/2009(H1N1)) segment 7 sequence 1951 1951 99% 0.0 99%
CY060521.1 Influenza A virus (A/Ontario/222656/2009(H1N1)) segment 7 sequence 1951 1951 99% 0.0 99%
GQ166660.1 Influenza A virus (A/England/195/2009(H1N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1951 1951 99% 0.0 99%
GU108489.1 Influenza A virus (A/Zhejiang-Yiwu/11/2009(H1N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1949 1949 98% 0.0 99%
CY081088.1 Influenza A virus (A/Ontario/741328/2010(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1947 1947 100% 0.0 99%
CY081072.1 Influenza A virus (A/Ontario/3620/2010(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1947 1947 100% 0.0 99%
HQ728097.1 Influenza A virus (A/swine/Taiwan/HL-1125/2009(H1N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1947 1947 100% 0.0 99%
CY076799.1 Influenza A virus (A/Ontario/156785/2009(H1N1)) segment 7 sequence 1947 1947 100% 0.0 99%
CY076790.1 Influenza A virus (A/Ontario/152846/2009(H1N1)) segment 7 sequence 1947 1947 100% 0.0 99%
CY076782.1 Influenza A virus (A/Ontario/152439/2009(H1N1)) segment 7 sequence 1947 1947 100% 0.0 99%
CY076766.1 Influenza A virus (A/Ontario/147265/2009(H1N1)) segment 7 sequence 1947 1947 100% 0.0 99%
CY076758.1 Influenza A virus (A/Ontario/142358/2009(H1N1)) segment 7 sequence 1947 1947 100% 0.0 99%
HQ011410.1 Influenza A virus (A/Guangdong/01/2009(H1N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1947 1947 100% 0.0 99%
HM230694.1 Influenza A virus (A/Zhoushan/1/2009(H1N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1947 1947 100% 0.0 99%
CY062311.1 Influenza A virus (A/swine/Thailand/CU-RA4/2009(H1N1)) segment 7 sequence 1947 1947 100% 0.0 99%
CY060729.1 Influenza A virus (A/Ontario/328474/2009(H1N1)) segment 7 sequence 1947 1947 100% 0.0 99%
CY060681.1 Influenza A virus (A/Ontario/315107/2009(H1N1)) segment 7 sequence 1947 1947 100% 0.0 99%
CY060553.1 Influenza A virus (A/Ontario/25913/2009(H1N1)) segment 7 sequence 1947 1947 100% 0.0 99%
CY060545.1 Influenza A virus (A/Ontario/25389/2009(H1N1)) segment 7 sequence 1947 1947 100% 0.0 99%
CY060513.1 Influenza A virus (A/Ontario/10296/2009(H1N1)) segment 7 sequence 1947 1947 100% 0.0 99%
CY060505.1 Influenza A virus (A/Ontario/10016/2009(H1N1)) segment 7 sequence 1947 1947 100% 0.0 99%
GU560017.1 Influenza A virus (A/Tomsk/06/2009(H1N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1947 1947 98% 0.0 99%

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Mon Mar 07, 2011 5:33 pm 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 27289
Location: Pittsburgh, PA USA
Top 100 NS sequences

CY086908.1 Influenza A virus (A/swine/North Carolina/226126/2010(H1N2)) nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1713 1713 100% 0.0 100%
CY086900.1 Influenza A virus (A/swine/North Carolina/226125/2010(H1N2)) nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1713 1713 100% 0.0 100%
CY086892.1 Influenza A virus (A/swine/North Carolina/226124/2010(H1N2)) nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1713 1713 100% 0.0 100%
HM230697.1 Influenza A virus (A/Zhoushan/1/2009(H1N1)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1681 1681 100% 0.0 99%
CY050371.1 Influenza A virus (A/Korea/S1/2009(H1N1)) segment 8 sequence 1673 1673 100% 0.0 99%
CY060738.1 Influenza A virus (A/Ontario/35273/2009(H1N1)) segment 8 sequence 1673 1673 100% 0.0 99%
CY060682.1 Influenza A virus (A/Ontario/315107/2009(H1N1)) segment 8 sequence 1673 1673 100% 0.0 99%
CY060650.1 Influenza A virus (A/Ontario/314603/2009(H1N1)) segment 8 sequence 1673 1673 100% 0.0 99%
CY060570.1 Influenza A virus (A/Ontario/296008/2009(H1N1)) segment 8 sequence 1673 1673 100% 0.0 99%
CY055307.1 Influenza A virus (A/Singapore/GN285/2009(H1N1)) segment 8 sequence 1673 1673 100% 0.0 99%
CY054666.1 Influenza A virus (A/Russia/100/2009(H1N1)) segment 8 sequence 1673 1673 100% 0.0 99%
CY054658.1 Influenza A virus (A/Russia/61/2009(H1N1)) segment 8 sequence 1673 1673 100% 0.0 99%
GU108490.1 Influenza A virus (A/Zhejiang-Yiwu/11/2009(H1N1)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1673 1673 100% 0.0 99%
CY045246.1 Influenza A virus (A/Taiwan/137/2009(H1N1)) segment 8 sequence 1673 1673 100% 0.0 99%
CY045230.1 Influenza A virus (A/Taiwan/115/2009(H1N1)) segment 8 sequence 1673 1673 100% 0.0 99%
CY045934.1 Influenza A virus (A/Toronto/3184/2009(H1N1)) segment 8 sequence 1673 1673 100% 0.0 99%
CY045507.1 Influenza A virus (A/Bayern/66/2009(H1N1)) segment 8 sequence 1673 1673 100% 0.0 99%
GQ485660.1 Influenza A virus (A/Ekaterinburg/01/2009(H1N1)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1673 1673 100% 0.0 99%
GQ369280.1 Influenza A virus (A/Stockholm/41/2009(H1N1)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1673 1673 100% 0.0 99%
GQ365686.1 Influenza A virus (A/Stockholm/44/2009(H1N1)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1673 1673 100% 0.0 99%
GQ365681.1 Influenza A virus (A/Stockholm/38/2009(H1N1)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1673 1673 100% 0.0 99%
GQ360065.1 Influenza A virus (A/Stockholm/32/2009(H1N1)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1673 1673 100% 0.0 99%
GQ360063.1 Influenza A virus (A/Stockholm/33/2009(H1N1)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1673 1673 100% 0.0 99%
CY087012.1 Influenza A virus (A/New York/3565/2009(H1N1)) nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1671 1671 99% 0.0 99%
CY084466.1 Influenza A virus (A/New York/6537/2009(H1N1)) nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1671 1671 99% 0.0 99%
HQ840321.1 Influenza A virus (A/swine/Minnesota/165A/2009(H1N1)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1671 1671 99% 0.0 99%
HQ840313.1 Influenza A virus (A/swine/Minnesota/136B/2009(H1N1)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1671 1671 99% 0.0 99%
HQ840308.1 Influenza A virus (A/swine/Minnesota/130A/2009(H1N1)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1671 1671 99% 0.0 99%
HQ840294.1 Influenza A virus (A/swine/Minnesota/074A/2009(H1N1)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1671 1671 99% 0.0 99%
CY065766.1 Influenza A virus (A/British Columbia/GFA0401/2009(H1N1)) segment 8 sequence 1671 1671 99% 0.0 99%
HM569663.1 Influenza A virus (A/Argentina/07-09GP/2009(H1N1)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1671 1671 99% 0.0 99%
HM569679.1 Influenza A virus (A/Argentina/19527/2009(H1N1)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1671 1671 99% 0.0 99%
HM569687.1 Influenza A virus (A/Argentina/19618/2009(H1N1)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1671 1671 99% 0.0 99%
GQ457476.1 Influenza A virus (A/Utah/07/2009(H1N1)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1671 1671 99% 0.0 99%
GQ457459.1 Influenza A virus (A/Utah/05/2009(H1N1)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1671 1671 99% 0.0 99%
GQ377098.1 Influenza A virus (A/Ohio/07/2009(H1N1)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1671 1671 99% 0.0 99%
GQ377096.1 Influenza A virus (A/New York/09/2009(H1N1)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1671 1671 99% 0.0 99%
GQ377042.1 Influenza A virus (A/Montana/07/2009(H1N1)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1671 1671 99% 0.0 99%
GQ359768.1 Influenza A virus (A/Stockholm/31/2009(H1N1)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1671 1671 99% 0.0 99%
GQ323499.1 Influenza A virus (A/Michigan/06/2009(H1N1)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1671 1671 99% 0.0 99%
GQ200252.1 Influenza A virus (A/New York/21/2009(H1N1)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1671 1671 99% 0.0 99%
GQ200239.1 Influenza A virus (A/Georgia/01/2009(H1N1)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1671 1671 99% 0.0 99%
GQ168882.1 Influenza A virus (A/New York/13/2009(H1N1)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1671 1671 99% 0.0 99%
GQ168872.1 Influenza A virus (A/Ohio/07/2009(H1N1)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1671 1671 99% 0.0 99%
GQ168846.1 Influenza A virus (A/New York/22/2009(H1N1)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1671 1671 99% 0.0 99%
GQ160598.1 Influenza A virus (A/Nebraska/03/2009(H1N1)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1671 1671 99% 0.0 99%
FJ998221.1 Influenza A virus (A/Canada-ON/RV1527/2009(H1N1)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1671 1671 99% 0.0 99%
HQ165794.1 Influenza A virus (A/Mombasa/179/2009(H1N1)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1669 1669 99% 0.0 99%
GQ365369.1 Influenza A virus (A/Stockholm/35/2009(H1N1)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1669 1669 99% 0.0 99%
CY086952.1 Influenza A virus (A/swine/Thailand/CU-M8_2/2009(H1N1)) nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1667 1667 99% 0.0 99%
GQ334350.1 Influenza A virus (A/Shizuoka/759/2009(H1N1)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1667 1667 99% 0.0 99%
CY086916.1 Influenza A virus (A/swine/Minnesota/226128/2010(H1N1)) nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1665 1665 100% 0.0 99%
HQ728114.1 Influenza A virus (A/swine/Taiwan/CH-1204/2009(H1N1)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1665 1665 100% 0.0 99%
HQ652625.1 Influenza A virus (A/Jiangsu/S62/2009(H1N1)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1665 1665 100% 0.0 99%
HQ652624.1 Influenza A virus (A/Jiangsu/S61/2009(H1N1)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1665 1665 100% 0.0 99%
CY076798.1 Influenza A virus (A/Ontario/156785/2009(H1N1)) segment 8 sequence 1665 1665 100% 0.0 99%
CY076791.1 Influenza A virus (A/Ontario/152846/2009(H1N1)) segment 8 sequence 1665 1665 100% 0.0 99%
CY076783.1 Influenza A virus (A/Ontario/152439/2009(H1N1)) segment 8 sequence 1665 1665 100% 0.0 99%
CY076775.1 Influenza A virus (A/Ontario/147723/2009(H1N1)) segment 8 sequence 1665 1665 100% 0.0 99%
CY076767.1 Influenza A virus (A/Ontario/147265/2009(H1N1)) segment 8 sequence 1665 1665 100% 0.0 99%
CY076759.1 Influenza A virus (A/Ontario/142358/2009(H1N1)) segment 8 sequence 1665 1665 100% 0.0 99%
HM189508.1 Influenza A virus (A/Korea/CJ63/2009(H1N1)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1665 1665 100% 0.0 99%
CY069645.1 Influenza A virus (A/Singapore/527/2009(H1N1)) segment 8 sequence 1665 1665 100% 0.0 99%
CY069630.1 Influenza A virus (A/Singapore/471/2009(H1N1)) segment 8 sequence 1665 1665 100% 0.0 99%
CY069623.1 Influenza A virus (A/Singapore/276/2009(H1N1)) segment 8 sequence 1665 1665 100% 0.0 99%
HQ011422.1 Influenza A virus (A/Guangdong/45/2009(H1N1)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1665 1665 100% 0.0 99%
HM370971.1 Influenza A virus (A/turkey/Ontario/FAV110/2009(H1N1)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1665 1665 100% 0.0 99%
HM370979.1 Influenza A virus (A/turkey/Ontario/FAV114-17/2009(H1N1)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1665 1665 100% 0.0 99%
CY063852.1 Influenza A virus (A/Singapore/KK066/2010(H1N1)) segment 8 sequence 1665 1665 100% 0.0 99%
CY063834.1 Influenza A virus (A/Singapore/GP562/2010(H1N1)) segment 8 sequence 1665 1665 100% 0.0 99%
CY063784.1 Influenza A virus (A/Singapore/ON0801/2009(H1N1)) segment 8 sequence 1665 1665 100% 0.0 99%
CY060754.1 Influenza A virus (A/Ontario/9739/2009(H1N1)) segment 8 sequence 1665 1665 100% 0.0 99%
CY060746.1 Influenza A virus (A/Ontario/9698/2009(H1N1)) segment 8 sequence 1665 1665 100% 0.0 99%
CY060730.1 Influenza A virus (A/Ontario/328474/2009(H1N1)) segment 8 sequence 1665 1665 100% 0.0 99%
CY060722.1 Influenza A virus (A/Ontario/320266/2009(H1N1)) segment 8 sequence 1665 1665 100% 0.0 99%
CY060690.1 Influenza A virus (A/Ontario/315181/2009(H1N1)) segment 8 sequence 1665 1665 100% 0.0 99%
CY060642.1 Influenza A virus (A/Ontario/314137/2009(H1N1)) segment 8 sequence 1665 1665 100% 0.0 99%
CY060618.1 Influenza A virus (A/Ontario/309862/2009(H1N1)) segment 8 sequence 1665 1665 100% 0.0 99%
CY060546.1 Influenza A virus (A/Ontario/25389/2009(H1N1)) segment 8 sequence 1665 1665 100% 0.0 99%
CY060514.1 Influenza A virus (A/Ontario/10296/2009(H1N1)) segment 8 sequence 1665 1665 100% 0.0 99%
CY060506.1 Influenza A virus (A/Ontario/10016/2009(H1N1)) segment 8 sequence 1665 1665 100% 0.0 99%
GU189653.1 Influenza A virus (A/Zhejiang/DTID-ZJU03/2009(H1N1)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1665 1665 100% 0.0 99%
GU112094.1 Influenza A virus (A/Zhejiang/DTID-ZJU02/2009(H1N1)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1665 1665 100% 0.0 99%
CY046945.1 Influenza A virus (A/Netherlands/602/2009(H1N1)) segment 8 sequence 1665 1665 100% 0.0 99%
GQ332647.1 Influenza A virus (A/New York/1682-WC_RG1/2009(H1N1)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1665 1665 100% 0.0 99%
CY045238.1 Influenza A virus (A/Taiwan/126/2009(H1N1)) segment 8 sequence 1665 1665 100% 0.0 99%
CY045982.1 Influenza A virus (A/Toronto/T9842/2009(H1N1)) segment 8 sequence 1665 1665 100% 0.0 99%
CY045974.1 Influenza A virus (A/Toronto/T5362/2009(H1N1)) segment 8 sequence 1665 1665 100% 0.0 99%
CY045958.1 Influenza A virus (A/Toronto/T0106/2009(H1N1)) segment 8 sequence 1665 1665 100% 0.0 99%
CY045950.1 Influenza A virus (A/Toronto/C2781/2009(H1N1)) segment 8 sequence 1665 1665 100% 0.0 99%
GQ375884.1 Influenza A virus (A/Iwate/1/2009(H1N1)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1665 1665 99% 0.0 99%
GQ365450.1 Influenza A virus (A/Sapporo/1/2009(H1N1)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1665 1665 99% 0.0 99%
GQ359770.1 Influenza A virus (A/Stockholm/30/2009(H1N1)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1665 1665 100% 0.0 99%
GQ166233.1 Influenza A virus (A/Nonthaburi/102/2009(H1N1)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1665 1665 100% 0.0 99%
HQ840329.1 Influenza A virus (A/swine/Minnesota/165A/2009(H1N1)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1663 1663 99% 0.0 99%
HQ840300.1 Influenza A virus (A/swine/Minnesota/130A/2009(H1N1)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1663 1663 99% 0.0 99%
HQ840298.1 Influenza A virus (A/swine/Minnesota/074A/2009(H1N1)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1663 1663 99% 0.0 99%
HM855243.1 Influenza A virus (A/Keiyo/96/2009(H1N1)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1663 1663 99% 0.0 99%
CY065774.1 Influenza A virus (A/Canada/GFA0402/2009(H1N1)) segment 8 sequence 1663 1663 99% 0.0 99%
HM569671.1 Influenza A virus (A/Argentina/08AR/2009(H1N1)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1663 1663 99% 0.0 99%

_________________
www.twitter.com/hniman


Top
 Profile  
 
Display posts from previous:  Sort by  
Post new topic Reply to topic  [ 22 posts ]  Go to page 1, 2, 3  Next

All times are UTC - 5 hours [ DST ]


Who is online

Users browsing this forum: fiyajelek, Yahoo [Bot] and 15 guests


You cannot post new topics in this forum
You cannot reply to topics in this forum
You cannot edit your posts in this forum
You cannot delete your posts in this forum
You cannot post attachments in this forum

Search for:
Jump to:  
Powered by phpBB® Forum Software © phpBB Group