Rhiza Labs FluTracker Forum

The place to discuss the flu
It is currently Wed Oct 18, 2017 12:24 pm

All times are UTC - 5 hours [ DST ]




Post new topic Reply to topic  [ 11 posts ]  Go to page 1, 2  Next
Author Message
PostPosted: Wed Oct 14, 2015 11:44 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
APHIS released full Fujian H5N2 sequences from Dixon County Nebraska.

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Wed Oct 14, 2015 11:44 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
LOCUS KT762900 1744 bp cRNA linear VRL 10-OCT-2015
DEFINITION Influenza A virus (A/chicken/Nebraska/15-017897-1/2015(H5N2))
segment 4 hemagglutinin (HA) gene, complete cds.
ACCESSION KT762900
VERSION KT762900.1 GI:936345705
KEYWORDS .
SOURCE Influenza A virus (A/chicken/Nebraska/15-017897-1/2015(H5N2))
ORGANISM Influenza A virus (A/chicken/Nebraska/15-017897-1/2015(H5N2))
Viruses; ssRNA viruses; ssRNA negative-strand viruses;
Orthomyxoviridae; Influenzavirus A.
REFERENCE 1 (bases 1 to 1744)
AUTHORS Killian,M.
TITLE Direct Submission
JOURNAL Submitted (15-SEP-2015) Diagnostic Virology Laboratory, National
Veterinary Services Laboratories (NVSL), USDA APHIS VS, 1920 Dayton
Avenue, Ames, IA 50010, USA
COMMENT GenBank Accession Numbers KT762897-KT762904 represent sequences
from the 8 segments of Influenza A virus
(A/chicken/Nebraska/15-017897-1/2015(H5N2)).

##Assembly-Data-START##
Assembly Method :: SeqMan NGen v. v4
Sequencing Technology :: IonTorrent
##Assembly-Data-END##
FEATURES Location/Qualifiers
source 1..1744
/organism="Influenza A virus
(A/chicken/Nebraska/15-017897-1/2015(H5N2))"
/mol_type="viral cRNA"
/strain="A/chicken/Nebraska/15-017897-1/2015"
/serotype="H5N2"
/isolation_source="OP swab; pooled sample"
/host="chicken; backyard; hen"
/db_xref="taxon:1718181"
/segment="4"
/country="USA: Dixon County, Nebraska"
/collection_date="01-Jun-2015"
/note="NVSL 15-017897 EP1; Eurasian origin (EA-H5N8 clade
2.3.4.4)-North American reassortant"
gene 17..1720
/gene="HA"
CDS 17..1720
/gene="HA"
/function="receptor binding and fusion protein"
/codon_start=1
/product="hemagglutinin"
/protein_id="ALH21322.1"
/db_xref="GI:936345706"
/translation="MEKIVLPFAVISLVKSDQICIGYHANNSTKQVDTIMEKNVTVTH
AQDILEKTHNGKLCDLNGVKPLILKDCSVAGWLLGNPMCDEFIRVPEWSYIVERANPA
NDLCYPGTLNDYEELKHLLSRINHFEKTLIIPRSSWPNHETSLGVSAACPYQGAPSFF
RNVVWLIKKNDAYPTIKISYNNTNREDLLILWGIHHSNNAAEQTNLYKNPDTYVSVGT
STLNQRLVPKIATRSQVNGQSGRMDFFWTILKPNDAIHFESNGNFIAPEYAYKIVKKG
DSTIMKSEMEYGHCNTKCQTPIGAINSSMPFHNIHPLTIGECPKYVKSNKLVLATGLR
NSPQRERRRKRGLFGAIAGFIEGGWQGMVDGWYGYHHSNEQGSGYAADKESTQKAIDG
VTNKVNSIIDKMNTQFEAVGREFNNLERRIENLNKKMEDGFLDVWTYNAELLVLMENE
RTLDFHDSNVKNLYDKVRLQLRDNAKELGNGCFEFYHKCDNECMESVRNGTYDYPKYS
EEAILKREEISGVKLESIGTYQILSIYSTVASSLALAIIVAGLSLWMCSNGSLQCRIC
I"
mat_peptide 65..1051
/gene="HA"
/product="HA1"
mat_peptide 1052..1717
/gene="HA"
/product="HA2"
ORIGIN
1 ggttcaatct gtcaaaatgg agaaaatagt gcttcctttt gcagtgatta gccttgttaa
61 aagtgatcag atttgcattg gttaccatgc aaacaactca acaaagcagg ttgacacgat
121 aatggagaaa aacgtcactg ttacacatgc ccaagacata ctggaaaaga cacacaacgg
181 gaagctctgc gatcttaatg gagtgaagcc cctgattcta aaggattgta gcgtagctgg
241 gtggctcctt ggaaatccaa tgtgcgacga gttcatcagg gtaccggaat ggtcttacat
301 cgtggagagg gctaacccag ccaacgacct ctgttaccca gggaccctca atgactacga
361 ggaactgaaa cacctattga gcagaataaa tcattttgag aaaactctga tcatccccag
421 gagttcttgg cccaatcatg aaacatcatt aggggtgagc gcagcatgtc cataccaggg
481 agcaccctca tttttcagaa atgtggtatg gctcatcaaa aagaacgatg catacccgac
541 aataaagata agctacaata ataccaatcg ggaagatctt ttgatactgt gggggattca
601 tcattccaac aatgcagcag agcagacaaa tctctataag aacccagaca cttatgtttc
661 cgttgggaca tcaacattaa accagagatt ggtgccaaaa atagctacta gatcccaagt
721 aaacgggcag agtggaagaa tggatttctt ctggacaatt ttaaaaccga atgatgcaat
781 ccactttgag agtaatggaa atttcattgc tccagaatat gcatacaaaa ttgtcaagaa
841 aggggactca acaattatga aaagtgaaat ggagtatggc cactgcaaca ccaaatgtca
901 aactccaata ggggcgataa actctagcat gccattccac aatatacacc ctctcaccat
961 cggggaatgc cccaaatacg tgaagtcaaa caaattagtc cttgcgactg ggctcagaaa
1021 tagtcctcaa agagaaagaa gaagaaaaag aggactattt ggagctatag cagggtttat
1081 agagggagga tggcagggaa tggtagacgg ttggtatggg tatcatcata gcaatgagca
1141 ggggagtggg tacgctgcag acaaagaatc aacccaaaag gcaatagatg gagttaccaa
1201 taaggtcaac tcaatcattg acaaaatgaa cactcaattt gaggccgttg gaagggaatt
1261 taataactta gaaaggagaa tagagaattt aaacaagaaa atggaagacg gattcctaga
1321 tgtctggact tataatgctg aacttttagt tctcatggaa aatgagagaa ctctagattt
1381 ccatgactca aatgtcaaga acctttacga caaagtccga ctacagctta gggataatgc
1441 aaaggagctg ggtaatggtt gtttcgagtt ctatcacaaa tgtgataacg aatgtatgga
1501 gagcgtaaga aatgggacgt atgactaccc taagtattca gaagaagcaa tattaaaaag
1561 agaagaaata agcggagtga aattagaatc aataggaact taccaaatac tgtcaattta
1621 ttcaacagtg gcgagttccc tagcactggc aatcatagtg gctggtctat ctttatggat
1681 gtgctctaat gggtcgttac aatgcagaat ttgcatctaa atttgtgagc tcagattgta
1741 atta

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Wed Oct 14, 2015 11:45 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
EPI620422 A/chicken/Iowa/13542-2/2015 (A/H5N2) segment 4 (HA) 3147.8 0.000000e+00 1704/1704 (100%)
EPI620436 A/turkey/Iowa/14319-1/2015 (A/H5N2) segment 4 (HA) 3142.3 0.000000e+00 1703/1704 (99%)
EPI620457 A/chicken/Iowa/14589-1/2015 (A/H5N2) segment 4 (HA) 3136.7 0.000000e+00 1702/1704 (99%)
EPI620450 A/chicken/Iowa/14399-4/2015 (A/H5N2) segment 4 (HA) 3136.7 0.000000e+00 1702/1704 (99%)
EPI620443 A/chicken/Iowa/14322-6/2015 (A/H5N2) segment 4 (HA) 3136.7 0.000000e+00 1702/1704 (99%)
EPI620415 A/turkey/Iowa/13541-1/2015 (A/H5N2) segment 4 (HA) 3136.7 0.000000e+00 1702/1704 (99%)
EPI620429 A/turkey/Iowa/14318-1/2015 (A/H5N2) segment 4 (HA) 3131.2 0.000000e+00 1701/1704 (99%)
EPI590740 A/turkey/Minnesota/9845-4/2015 (A/H5N2) segment 4 (HA) 3120.1 0.000000e+00 1699/1704 (99%)
EPI620408 A/turkey/Iowa/11762-1/2015 (A/H5N2) segment 4 (HA) 3114.6 0.000000e+00 1698/1704 (99%)
EPI590726 A/turkey/Arkansas/7791-1/2015 (A/H5N2) segment 4 (HA) 3114.6 0.000000e+00 1698/1704 (99%)
EPI586550 A/chicken/BC/FAV24/2014 (A/H5N2) segment 4 (HA) 3114.6 0.000000e+00 1698/1704 (99%)
EPI586518 A/chicken/BC/FAV20/2014 (A/H5N2) segment 4 (HA) 3114.6 0.000000e+00 1698/1704 (99%)
EPI586509 A/poultry/BC/FAV19/2014 (A/H5N2) segment 4 (HA) 3114.6 0.000000e+00 1698/1704 (99%)
EPI584079 A/turkey/BC/FAV14/2014 (A/H5N2) segment 4 (HA) 3114.6 0.000000e+00 1698/1704 (99%)
EPI573298 A/turkey/BC/FAV10/2014 (A/H5N2) segment 4 (HA) 3114.6 0.000000e+00 1698/1704 (99%)
EPI590733 A/chicken/Kansas/8395-3/2015 (A/H5N2) segment 4 (HA) 3109.0 0.000000e+00 1697/1704 (99%)
EPI590719 A/turkey/Missouri/7458-1/2015 (A/H5N2) segment 4 (HA) 3109.0 0.000000e+00 1697/1704 (99%)
EPI590685 A/turkey/Minnesota/9892-2/2015 (A/H5N2) segment 4 (HA) 3109.0 0.000000e+00 1697/1704 (99%)
EPI586542 A/chicken/BC/FAV23/2014 (A/H5N2) segment 4 (HA) 3109.0 0.000000e+00 1697/1704 (99%)
EPI586534 A/chicken/BC/FAV22/2014 (A/H5N2) segment 4 (HA) 3109.0 0.000000e+00 1698/1705 (99%)
EPI586526 A/chicken/BC/FAV21/2014 (A/H5N2) segment 4 (HA) 3109.0 0.000000e+00 1697/1704 (99%)
EPI586493 A/poultry/BC/FAV15/2014 (A/H5N2) segment 4 (HA) 3109.0 0.000000e+00 1697/1704 (99%)
EPI585092 A/pheasant/Washington/3147-2/2015 (A/H5N2) segment 4 (HA) 3109.0 0.000000e+00 1697/1704 (99%)
EPI576470 A/chicken/BC/FAV8/2014 (A/H5N2) segment 4 (HA) 3109.0 0.000000e+00 1697/1704 (99%)
EPI590712 A/turkey/Minnesota/7172-1/2015 (A/H5N2) segment 4 (HA) 3103.5 0.000000e+00 1696/1704 (99%)
EPI590699 A/chicken/Oregon/A01819044/2015 (A/H5N2) segment 4 (HA) 3103.5 0.000000e+00 1696/1704 (99%)
EPI590692 A/chicken/Washington/3490-18/2015 (A/H5N2) segment 4 (HA) 3103.5 0.000000e+00 1696/1704 (99%)
EPI587633 A/chicken/Iowa/04-20/2015 (A/H5N2) segment 4 (HA) 3103.5 0.000000e+00 1696/1704 (99%)
EPI586501 A/poultry/BC/FAV17/2014 (A/H5N2) segment 4 (HA) 3103.5 0.000000e+00 1696/1704 (99%)
EPI576477 A/chicken/BC/FAV9/2014 (A/H5N2) segment 4 (HA) 3103.5 0.000000e+00 1696/1704 (99%)
EPI573281 A/turkey/Washington/61-22/2014 (A/H5N2) segment 4 (HA) 3103.5 0.000000e+00 1696/1704 (99%)
EPI569383 A/Northern pintail/Washington/40964/2014 (A/H5N2) segment 4 (HA) 3103.5 0.000000e+00 1697/1705 (99%)
EPI586558 A/chicken/BC/FAV25/2014 (A/H5N2) segment 4 (HA) 3098.0 0.000000e+00 1695/1704 (99%)
EPI573271 A/chicken/Washington/61-9/2014 (A/H5N2) segment 4 (HA) 3098.0 0.000000e+00 1695/1704 (99%)
EPI573276 A/domestic duck/Washington/61-16/2014 (A/H5N2) segment 4 (HA) 3092.4 0.000000e+00 1694/1704 (99%)
EPI569390 A/gyrfalcon/Washington/41088-6/2014 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1694/1705 (99%)
EPI569376 A/guinea fowl/Oregon/41613-1/2014 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1694/1705 (99%)
EPI569372 A/chicken/Oregon/41613-2/2014 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1694/1705 (99%)
EPI588968 A/chicken/Taiwan/a174/2015 (A/H5N3) segment 4 (HA) 3081.3 0.000000e+00 1693/1705 (99%)
EPI587521 A/American wigeon/BC/050-31/2015 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1693/1705 (99%)
EPI585084 A/turkey/California/K1500169-1.2/2015 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1693/1705 (99%)
EPI573638 A/crane/Kagoshima/KU13/2014(H5N8) (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1693/1705 (99%)
EPI588960 A/duck/Taiwan/a043/2015 (A/H5N2) segment 4 (HA) 3075.8 0.000000e+00 1692/1705 (99%)
EPI588976 A/duck/Taiwan/a068/2015 (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1690/1705 (99%)
EPI573286 A/American green-winged teal/Washington/195750/2014 (A/H5N1) segment 4 (HA) 3064.7 0.000000e+00 1690/1705 (99%)
EPI553208 A/crane/Kagoshima/KU1/2014 (A/H5N8) segment 4 (HA) 3055.5 0.000000e+00 1687/1703 (99%)
EPI573208 A/gadwall/Korea/H1351/2014 (A/H5N8) segment 4 (HA) 3053.6 0.000000e+00 1689/1706 (99%)
EPI561570 A/Baikal teal/Korea/H96/2014 (A/H5N8) segment 4 (HA) 3053.6 0.000000e+00 1688/1705 (99%)
EPI588952 A/goose/Taiwan/a015/2015 (A/H5N8) segment 4 (HA) 3048.1 0.000000e+00 1687/1705 (98%)
EPI585595 A/baikal teal/Korea/2417/2014 (A/H5N8) segment 4 (HA) 3048.1 0.000000e+00 1688/1706 (98%)
EPI585589 A/baikal teal/Korea/2399/2014 (A/H5N8) segment 4 (HA) 3048.1 0.000000e+00 1688/1706 (98%)
EPI585586 A/baikal teal/Korea/1456/2014 (A/H5N8) segment 4 (HA) 3048.1 0.000000e+00 1688/1706 (98%)
EPI573242 A/Common Teal/Korea/H844/2014 (A/H5N8) segment 4 (HA) 3048.1 0.000000e+00 1688/1706 (98%)
EPI561646 A/breeder duck/Korea/H249/2014 (A/H5N8) segment 4 (HA) 3048.1 0.000000e+00 1688/1706 (98%)
EPI561626 A/mallard/Korea/H207/2014 (A/H5N8) segment 4 (HA) 3048.1 0.000000e+00 1688/1706 (98%)
EPI561605 A/broiler duck/Korea/H145/2014 (A/H5N8) segment 4 (HA) 3048.1 0.000000e+00 1688/1706 (98%)
EPI561591 A/breeder duck/Korea/H128/2014 (A/H5N8) segment 4 (HA) 3048.1 0.000000e+00 1688/1706 (98%)
EPI561529 A/Baikal teal/Korea/H66/2014 (A/H5N8) segment 4 (HA) 3048.1 0.000000e+00 1688/1706 (98%)
EPI561508 A/bean goose/Korea/H53/2014 (A/H5N8) segment 4 (HA) 3048.1 0.000000e+00 1688/1706 (98%)
EPI561341 A/Baikal teal/Korea/H41/2014 (A/H5N8) segment 4 (HA) 3048.1 0.000000e+00 1688/1706 (98%)
EPI585594 A/baikal teal/Korea/2416/2014 (A/H5N8) segment 4 (HA) 3042.6 0.000000e+00 1687/1706 (98%)
EPI585592 A/baikal teal/Korea/2406/2014 (A/H5N8) segment 4 (HA) 3042.6 0.000000e+00 1687/1706 (98%)
EPI585591 A/baikal teal/Korea/2403/2014 (A/H5N8) segment 4 (HA) 3042.6 0.000000e+00 1687/1706 (98%)
EPI585590 A/baikal teal/Korea/2402/2014 (A/H5N8) segment 4 (HA) 3042.6 0.000000e+00 1687/1706 (98%)
EPI585582 A/baikal teal/Korea/1448/2014 (A/H5N8) segment 4 (HA) 3042.6 0.000000e+00 1687/1706 (98%)
EPI585581 A/baikal teal/Korea/1447/2014 (A/H5N8) segment 4 (HA) 3042.6 0.000000e+00 1687/1706 (98%)
EPI585579 A/baikal teal/Korea/1445/2014 (A/H5N8) segment 4 (HA) 3042.6 0.000000e+00 1687/1706 (98%)
EPI585577 A/baikal teal/Korea/1437/2014 (A/H5N8) segment 4 (HA) 3042.6 0.000000e+00 1687/1706 (98%)
EPI573199 A/breeder chicken/Korea/H1068/2014 (A/H5N8) segment 4 (HA) 3042.6 0.000000e+00 1687/1706 (98%)
EPI573197 A/chicken/Korea/H881/2014 (A/H5N8) segment 4 (HA) 3042.6 0.000000e+00 1687/1706 (98%)
EPI561674 A/bean goose/Korea/H328/2014 (A/H5N8) segment 4 (HA) 3042.6 0.000000e+00 1687/1706 (98%)
EPI561612 A/breeder duck/Korea/H158/2014 (A/H5N8) segment 4 (HA) 3042.6 0.000000e+00 1687/1706 (98%)
EPI561577 A/breeder chicken/Korea/H122/2014 (A/H5N8) segment 4 (HA) 3042.6 0.000000e+00 1687/1706 (98%)
EPI561563 A/Baikal teal/Korea/H84/2014 (A/H5N8) segment 4 (HA) 3042.6 0.000000e+00 1687/1706 (98%)
EPI561542 A/Baikal teal/Korea/H68/2014 (A/H5N8) segment 4 (HA) 3042.6 0.000000e+00 1687/1706 (98%)
EPI561522 A/broiler duck/Korea/H65/2014 (A/H5N8) segment 4 (HA) 3042.6 0.000000e+00 1687/1706 (98%)
EPI585593 A/baikal teal/Korea/2414/2014 (A/H5N8) segment 4 (HA) 3037.0 0.000000e+00 1686/1706 (98%)
EPI585587 A/baikal teal/Korea/1457/2014 (A/H5N8) segment 4 (HA) 3037.0 0.000000e+00 1686/1706 (98%)
EPI585584 A/baikal teal/Korea/1452/2014 (A/H5N8) segment 4 (HA) 3037.0 0.000000e+00 1686/1706 (98%)
EPI585583 A/baikal teal/Korea/1449/2014 (A/H5N8) segment 4 (HA) 3037.0 0.000000e+00 1686/1706 (98%)
EPI561705 A/bean goose/Korea/H40/2014 (A/H5N8) segment 4 (HA) 3037.0 0.000000e+00 1686/1706 (98%)
EPI561667 A/mallard/Korea/H297/2014 (A/H5N8) segment 4 (HA) 3037.0 0.000000e+00 1687/1707 (98%)
EPI561653 A/breeder chicken/Korea/H250/2014 (A/H5N8) segment 4 (HA) 3037.0 0.000000e+00 1686/1706 (98%)
EPI561633 A/white-fronted goose/Korea/H231/2014 (A/H5N8) segment 4 (HA) 3037.0 0.000000e+00 1686/1706 (98%)
EPI509704 A/broiler duck/Korea/Buan2/2014 (A/H5N8) segment 4 (HA) 3037.0 0.000000e+00 1686/1706 (98%)
EPI585580 A/baikal teal/Korea/1446/2014 (A/H5N8) segment 4 (HA) 3031.5 0.000000e+00 1685/1706 (98%)
EPI573200 A/Korean native chicken/Korea/H1139/2014 (A/H5N8) segment 4 (HA) 3031.5 0.000000e+00 1685/1706 (98%)
EPI573196 A/broiler duck/Korea/H651/2014 (A/H5N8) segment 4 (HA) 3031.5 0.000000e+00 1685/1706 (98%)
EPI573194 A/breeder chicken/Korea/H818/2014 (A/H5N8) segment 4 (HA) 3031.5 0.000000e+00 1685/1706 (98%)
EPI561697 A/spot-billed duck/Korea/H455-42/2014 (A/H5N8) segment 4 (HA) 3031.5 0.000000e+00 1685/1706 (98%)
EPI561681 A/tundra swan/Korea/H411/2014 (A/H5N8) segment 4 (HA) 3031.5 0.000000e+00 1685/1706 (98%)
EPI561660 A/Korean native chicken/Korea/H257/2014 (A/H5N8) segment 4 (HA) 3031.5 0.000000e+00 1685/1706 (98%)
EPI561598 A/broiler duck/Korea/H133/2014 (A/H5N8) segment 4 (HA) 3031.5 0.000000e+00 1685/1706 (98%)
EPI561360 A/broiler duck/Korea/H49/2014 (A/H5N8) segment 4 (HA) 3031.5 0.000000e+00 1685/1706 (98%)
EPI561348 A/broiler duck/Korea/H47/2014 (A/H5N8) segment 4 (HA) 3031.5 0.000000e+00 1685/1706 (98%)
EPI561336 A/broiler duck/Korea/H48/2014 (A/H5N8) segment 4 (HA) 3031.5 0.000000e+00 1685/1706 (98%)
EPI561204 A/broiler duck/Korea/H31/2014 (A/H5N8) segment 4 (HA) 3031.5 0.000000e+00 1685/1706 (98%)
EPI561196 A/broiler duck/Korea/H29/2014 (A/H5N8) segment 4 (HA) 3031.5 0.000000e+00 1685/1706 (98%)
EPI561187 A/waterfowl/Korea/S005/2014 (A/H5N8) segment 4 (HA) 3031.5 0.000000e+00 1685/1706 (98%)
EPI517161 A/Chicken/Kumamoto/1-7/2014 (A/H5N8) segment 4 (HA) 3031.5 0.000000e+00 1685/1706 (98%)
EPI585588 A/baikal teal/Korea/1458/2014 (A/H5N8) segment 4 (HA) 3025.9 0.000000e+00 1684/1706 (98%)
EPI585585 A/baikal teal/Korea/1454/2014 (A/H5N8) segment 4 (HA) 3025.9 0.000000e+00 1684/1706 (98%)
EPI573192 A/breeder chicken/Korea/H503/2014 (A/H5N8) segment 4 (HA) 3025.9 0.000000e+00 1684/1706 (98%)
EPI561690 A/common teal/Korea/H455-30/2014 (A/H5N8) segment 4 (HA) 3025.9 0.000000e+00 1684/1706 (98%)
EPI561556 A/Coot/Korea/H81/2014 (A/H5N8) segment 4 (HA) 3025.9 0.000000e+00 1684/1706 (98%)
EPI561549 A/Baikal teal/Korea/H80/2014 (A/H5N8) segment 4 (HA) 3025.9 0.000000e+00 1684/1706 (98%)
EPI561515 A/Baikal teal/Korea/H62/2014 (A/H5N8) segment 4 (HA) 3025.9 0.000000e+00 1684/1706 (98%)
EPI509709 A/baikal teal/Korea/Donglim3/2014 (A/H5N8) segment 4 (HA) 3025.9 0.000000e+00 1684/1706 (98%)
EPI585578 A/baikal teal/Korea/1441/2014 (A/H5N8) segment 4 (HA) 3020.4 0.000000e+00 1683/1706 (98%)
EPI573240 A/breeder duck/Korea/H345/2014 (A/H5N8) segment 4 (HA) 3020.4 0.000000e+00 1683/1706 (98%)
EPI573203 A/chicken/Korea/H1292/2014 (A/H5N8) segment 4 (HA) 3020.4 0.000000e+00 1683/1706 (98%)
EPI573195 A/breeder chicken/Korea/H818/2014 (A/H5N8) segment 4 (HA) 3020.4 0.000000e+00 1683/1706 (98%)
EPI573207 A/chicken/Korea/H1350/2014 (A/H5N8) segment 4 (HA) 3014.9 0.000000e+00 1682/1706 (98%)
EPI573201 A/chicken/Korea/H1236/2014 (A/H5N8) segment 4 (HA) 3014.9 0.000000e+00 1682/1706 (98%)
EPI561619 A/breeder duck/Korea/H200/2014 (A/H5N8) segment 4 (HA) 3014.9 0.000000e+00 1683/1707 (98%)
EPI573241 A/breeder duck/Korea/H566/2014 (A/H5N8) segment 4 (HA) 3009.3 0.000000e+00 1682/1707 (98%)
EPI573204 A/goose/Korea/H1296/2014 (A/H5N8) segment 4 (HA) 3009.3 0.000000e+00 1682/1707 (98%)
EPI573202 A/chicken/Korea/H1268/2014 (A/H5N8) segment 4 (HA) 3009.3 0.000000e+00 1681/1706 (98%)
EPI542628 A/mallard/Korea/W452/2014 (A/H5N8) segment 4 (HA) 3009.3 0.000000e+00 1681/1706 (98%)
EPI573213 A/broiler duck/Korea/H1556/2014 (A/H5N8) segment 4 (HA) 3003.8 0.000000e+00 1680/1706 (98%)
EPI573205 A/Korean native chicken/Korea/H1299/2014 (A/H5N8) segment 4 (HA) 3003.8 0.000000e+00 1680/1706 (98%)
EPI573198 A/broiler duck/Korea/H959/2014 (A/H5N8) segment 4 (HA) 3003.8 0.000000e+00 1680/1706 (98%)
EPI573212 A/Korean native chicken/Korea/H1554/2014 (A/H5N8) segment 4 (HA) 2998.2 0.000000e+00 1679/1706 (98%)
EPI573211 A/goose/Korea/H1545/2014 (A/H5N8) segment 4 (HA) 2998.2 0.000000e+00 1679/1706 (98%)
EPI573209 A/broiler duck/Korea/H1413/2014 (A/H5N8) segment 4 (HA) 2998.2 0.000000e+00 1679/1706 (98%)
EPI573206 A/breeder duck/Korea/H1343/2014 (A/H5N8) segment 4 (HA) 2998.2 0.000000e+00 1679/1706 (98%)
EPI550849 A/duck/England/36226/14 (A/H5N8) segment 4 (HA) 2998.2 0.000000e+00 1679/1706 (98%)
EPI550848 A/duck/England/36038/14 (A/H5N8) segment 4 (HA) 2998.2 0.000000e+00 1679/1706 (98%)
EPI553349 A/wigeon/Sakha/1/2014 (A/H5N8) segment 4 (HA) 2992.7 0.000000e+00 1678/1706 (98%)
EPI573228 A/broiler duck/Korea/H1755/2014 (A/H5N8) segment 4 (HA) 2987.2 0.000000e+00 1677/1706 (98%)
EPI573227 A/breeder duck/Korea/H1752/2014 (A/H5N8) segment 4 (HA) 2987.2 0.000000e+00 1677/1706 (98%)
EPI573222 A/broiler duck/Korea/H1733/2014 (A/H5N8) segment 4 (HA) 2987.2 0.000000e+00 1677/1706 (98%)
EPI573218 A/Korean native chicken/Korea/H1687/2014 (A/H5N8) segment 4 (HA) 2987.2 0.000000e+00 1677/1706 (98%)
EPI573217 A/broiler duck/Korea/H1685/2014 (A/H5N8) segment 4 (HA) 2987.2 0.000000e+00 1677/1706 (98%)
EPI573216 A/broiler duck/Korea/H1683/2014 (A/H5N8) segment 4 (HA) 2987.2 0.000000e+00 1677/1706 (98%)
EPI573210 A/broiler duck/Korea/H1414/2014 (A/H5N8) segment 4 (HA) 2987.2 0.000000e+00 1677/1706 (98%)
EPI547673 A/duck/England/36254/14 (A/H5N8) segment 4 (HA) 2987.2 0.000000e+00 1677/1706 (98%)
EPI576384 A/MuteSwan/Sweden/SVA-U1503110277-SZ502/2015 (A/H5N8) segment 4 (HA) 2983.5 0.000000e+00 1676/1706 (98%)
EPI576391 A/MuteSwan/Sweden/SVA-1503130141-SZ543/2015 (A/H5N8) segment 4 (HA) 2981.6 0.000000e+00 1676/1706 (98%)
EPI573239 A/mallard/Korea/H1924-6/2014 (A/H5N8) segment 4 (HA) 2981.6 0.000000e+00 1676/1706 (98%)
EPI573229 A/broiler duck/Korea/H1763/2014 (A/H5N8) segment 4 (HA) 2981.6 0.000000e+00 1676/1706 (98%)
EPI573224 A/broiler duck/Korea/H1739/2014 (A/H5N8) segment 4 (HA) 2981.6 0.000000e+00 1676/1706 (98%)
EPI573219 A/goose/Korea/H1689/2014 (A/H5N8) segment 4 (HA) 2981.6 0.000000e+00 1676/1706 (98%)
EPI573235 A/Korean native chicken/Korea/H1903/2014 (A/H5N8) segment 4 (HA) 2976.1 0.000000e+00 1675/1706 (98%)
EPI573231 A/broiler duck/Korea/H1839/2014 (A/H5N8) segment 4 (HA) 2976.1 0.000000e+00 1675/1706 (98%)
EPI573225 A/broiler duck/Korea/H1745/2014 (A/H5N8) segment 4 (HA) 2976.1 0.000000e+00 1675/1706 (98%)
EPI573223 A/broiler duck/Korea/H1734/2014 (A/H5N8) segment 4 (HA) 2976.1 0.000000e+00 1675/1706 (98%)
EPI573221 A/broiler duck/Korea/H1731/2014 (A/H5N8) segment 4 (HA) 2976.1 0.000000e+00 1675/1706 (98%)
EPI573220 A/goose/Korea/H1698/2014 (A/H5N8) segment 4 (HA) 2976.1 0.000000e+00 1675/1706 (98%)
EPI573215 A/breeder duck/Korea/H1596/2014 (A/H5N8) segment 4 (HA) 2976.1 0.000000e+00 1675/1706 (98%)
EPI573214 A/broiler duck/Korea/H1582/2014 (A/H5N8) segment 4 (HA) 2976.1 0.000000e+00 1675/1706 (98%)
EPI573179 A/duck/Netherlands/14015898/2014 (A/H5N8) segment 4 (HA) 2976.1 0.000000e+00 1675/1706 (98%)
EPI552746 A/turkey/Germany/AR2485-86-L00899/2014 (A/H5N8) segment 4 (HA) 2976.1 0.000000e+00 1675/1706 (98%)
EPI548493 A/duck/Chiba/26-372-61/2014 (A/H5N8) segment 4 (HA) 2976.1 0.000000e+00 1675/1706 (98%)
EPI548485 A/duck/Chiba/26-372-48/2014 (A/H5N8) segment 4 (HA) 2976.1 0.000000e+00 1675/1706 (98%)
EPI547678 A/Chicken/Netherlands/14015526/2014 (A/H5N8) segment 4 (HA) 2976.1 0.000000e+00 1675/1706 (98%)
EPI595055 A/common teal/Korea/KU-12/2015 (A/H5N8) segment 4 (HA) 2970.5 0.000000e+00 1675/1707 (98%)
EPI573230 A/broiler duck/Korea/H1803/2014 (A/H5N8) segment 4 (HA) 2970.5 0.000000e+00 1674/1706 (98%)
EPI573187 A/chicken/Netherlands/14016437/2014 (A/H5N8) segment 4 (HA) 2970.5 0.000000e+00 1675/1707 (98%)
EPI573171 A/Chicken/Netherlands/14015824/2014 (A/H5N8) segment 4 (HA) 2970.5 0.000000e+00 1674/1706 (98%)
EPI573163 A/chicken/Netherlands/14015766/2014 (A/H5N8) segment 4 (HA) 2970.5 0.000000e+00 1675/1707 (98%)
EPI548623 A/chicken/Netherlands/14015531/2014 (A/H5N8) segment 4 (HA) 2970.5 0.000000e+00 1674/1706 (98%)
EPI595079 A/mallard/Korea/N15-99/2015 (A/H5N8) segment 4 (HA) 2965.0 0.000000e+00 1674/1707 (98%)
EPI573234 A/broiler duck/Korea/H1864/2014 (A/H5N8) segment 4 (HA) 2965.0 0.000000e+00 1673/1706 (98%)
EPI573233 A/Korean native chicken/Korea/H1847/2014 (A/H5N8) segment 4 (HA) 2965.0 0.000000e+00 1673/1706 (98%)
EPI573232 A/broiler duck/Korea/H1840/2014 (A/H5N8) segment 4 (HA) 2965.0 0.000000e+00 1673/1706 (98%)
EPI553362 A/environment/Kagoshima/KU-ngr-H/2014 (A/H5N8) segment 4 (HA) 2965.0 0.000000e+00 1673/1706 (98%)
EPI553343 A/chicken/Miyazaki/7/2014 (A/H5N8) segment 4 (HA) 2965.0 0.000000e+00 1674/1707 (98%)
EPI573654 A/crane/Kagoshima/KU41/2014(H5N8) (A/H5N8) segment 4 (HA) 2959.5 0.000000e+00 1673/1707 (98%)
EPI573646 A/crane/Kagoshima/KU21/2014(H5N8) (A/H5N8) segment 4 (HA) 2959.5 0.000000e+00 1673/1707 (98%)
EPI573238 A/mallard/Korea/H2003/2014 (A/H5N8) segment 4 (HA) 2959.5 0.000000e+00 1673/1707 (98%)
EPI573237 A/mallard/Korea/H1991/2014 (A/H5N8) segment 4 (HA) 2959.5 0.000000e+00 1673/1707 (98%)
EPI573236 A/spot-billed duck/Korea/H1981/2014 (A/H5N8) segment 4 (HA) 2959.5 0.000000e+00 1673/1707 (98%)
EPI573226 A/Korean native chicken/Korea/H1747/2014 (A/H5N8) segment 4 (HA) 2959.5 0.000000e+00 1672/1706 (98%)
EPI595066 A/mallard/Korea/KU3-2/2015 (A/H5N8) segment 4 (HA) 2953.9 0.000000e+00 1673/1708 (97%)
EPI573664 A/crane/Kagoshima/KU53/2015(H5N8) (A/H5N8) segment 4 (HA) 2953.9 0.000000e+00 1672/1707 (97%)
EPI544756 A/turkey/Germany-MV/R2472/2014 (A/H5N8) segment 4 (HA) 2953.9 0.000000e+00 1663/1694 (98%)
EPI573680 A/mallard duck/Kagoshima/KU116/2015(H5N8) (A/H5N8) segment 4 (HA) 2948.4 0.000000e+00 1671/1707 (97%)
EPI573672 A/mallard duck/Kagoshima/KU70/2015(H5N8) (A/H5N8) segment 4 (HA) 2948.4 0.000000e+00 1671/1707 (97%)
EPI595138 A/greater white-fronted goose/Korea/K14-372-2/2014 (A/H5N8) segment 4 (HA) 2942.8 0.000000e+00 1670/1707 (97%)
EPI595133 A/greater white-fronted goose/Korea/K14-371-4/2014 (A/H5N8) segment 4 (HA) 2942.8 0.000000e+00 1670/1707 (97%)
EPI595124 A/greater white-fronted goose/Korea/K14-369-3/2014 (A/H5N8) segment 4 (HA) 2942.8 0.000000e+00 1670/1707 (97%)
EPI595116 A/greater white-fronted goose/Korea/K14-367-4/2014 (A/H5N8) segment 4 (HA) 2942.8 0.000000e+00 1670/1707 (97%)
EPI595107 A/mandarin duck/Korea/K14-367-1/2014 (A/H5N8) segment 4 (HA) 2942.8 0.000000e+00 1670/1707 (97%)
EPI595094 A/mandarin duck/Korea/K14-366-1/2014 (A/H5N8) segment 4 (HA) 2942.8 0.000000e+00 1670/1707 (97%)
EPI590679 A/eurasian wigeon/Netherlands/1/2015 (A/H5N8) segment 4 (HA) 2942.8 0.000000e+00 1661/1694 (98%)
EPI585111 A/eurasian wigeon/Netherlands/1/2015 (A/H5N8) segment 4 (HA) 2942.8 0.000000e+00 1661/1694 (98%)
EPI595146 A/greater white-fronted goose/Korea/K14-374-1/2014 (A/H5N8) segment 4 (HA) 2939.1 0.000000e+00 1669/1707 (97%)
EPI595082 A/mandarin duck/Korea/K14-363-1/2014 (A/H5N8) segment 4 (HA) 2939.1 0.000000e+00 1669/1707 (97%)
EPI568474 A/green-winged teal/Korea/KU-12/2015 (A/H5) segment 4 (HA) 2931.8 0.000000e+00 1658/1692 (97%)
EPI596301 A/chicken/Netherlands/emc-3/2014 (A/H5N8) segment 4 (HA) 2929.9 0.000000e+00 1653/1685 (98%)
EPI596295 A/eurasian wigeon/Netherlands/2/2014 (A/H5N8) segment 4 (HA) 2929.9 0.000000e+00 1659/1694 (97%)
EPI552776 A/chicken/Netherlands/emc-3/2014 (A/H5N8) segment 4 (HA) 2929.9 0.000000e+00 1653/1685 (98%)
EPI552768 A/eurasian wigeon/Netherlands/emc-2/2014 (A/H5N8) segment 4 (HA) 2929.9 0.000000e+00 1659/1694 (97%)
EPI596289 A/eurasian wigeon/Netherlands/1/2014 (A/H5N8) segment 4 (HA) 2904.1 0.000000e+00 1625/1651 (98%)
EPI552760 A/eurasian wigeon/Netherlands/emc-1/2014 (A/H5N8) segment 4 (HA) 2904.1 0.000000e+00 1625/1651 (98%)
EPI551149 A/eurasian wigeon/Netherlands/emc-2/2014 (A/H5N8) segment 4 (HA) 2894.8 0.000000e+00 1635/1668 (98%)
EPI543010 A/duck/Beijing/CT01/2014 (A/H5N8) segment 4 (HA) 2837.6 0.000000e+00 1585/1609 (98%)
EPI543002 A/duck/Beijing/FS01/2014 (A/H5N8) segment 4 (HA) 2826.5 0.000000e+00 1584/1610 (98%)
EPI475579 A/wild duck/Shandong/628/2011 (A/H5N1) segment 4 (HA) 2826.5 0.000000e+00 1651/1709 (96%)
EPI551143 A/eurasian wigeon/Netherlands/emc-1/2014 (A/H5N8) segment 4 (HA) 2824.6 0.000000e+00 1585/1612 (98%)
EPI593747 A/goose/Shandong/k1201/2009 (A/H5N1) segment 4 (HA) 2821.0 0.000000e+00 1650/1709 (96%)
EPI542617 A/duck/Beijing/FS01/2013 (A/H5N8) segment 4 (HA) 2821.0 0.000000e+00 1581/1609 (98%)
EPI442017 A/duck/Jiangsu/k1203/2010 (A/H5N8) segment 4 (HA) 2821.0 0.000000e+00 1650/1709 (96%)
EPI399960 A/duck/Jiangsu/m234/2012 (A/H5N2) segment 4 (HA) 2776.6 0.000000e+00 1644/1711 (96%)
EPI398966 A/goose/Eastern China/1112/2011 (A/H5N2) segment 4 (HA) 2776.6 0.000000e+00 1643/1710 (96%)
EPI431456 A/duck/Hebei/3/2011 (A/H5N2) segment 4 (HA) 2765.6 0.000000e+00 1641/1710 (95%)
EPI398965 A/duck/Eastern China/1111/2011 (A/H5N2) segment 4 (HA) 2760.0 0.000000e+00 1640/1710 (95%)
EPI602419 A/chicken/Dongguan/3363/2013 (A/H5N6) segment 4 (HA) 2754.5 0.000000e+00 1636/1707 (95%)
EPI602412 A/chicken/Dongguan/2690/2013 (A/H5N6) segment 4 (HA) 2754.5 0.000000e+00 1636/1707 (95%)
EPI602045 A/chicken/Dongguan/2818/2013 (A/H0) segment 4 (HA) 2754.5 0.000000e+00 1636/1707 (95%)
EPI602028 A/chicken/Dongguan/4190/2013 (A/H0) segment 4 (HA) 2750.8 0.000000e+00 1635/1707 (95%)
EPI599662 A/goose/Shantou/1806/2014 (A/H5N6) segment 4 (HA) 2748.9 0.000000e+00 1636/1708 (95%)
EPI599655 A/goose/Shantou/1791/2014 (A/H5N6) segment 4 (HA) 2748.9 0.000000e+00 1636/1708 (95%)
EPI599648 A/goose/Shantou/1763/2014 (A/H5N6) segment 4 (HA) 2748.9 0.000000e+00 1636/1708 (95%)
EPI599339 A/duck/Dongguan/3069/2013 (A/H5N6) segment 4 (HA) 2748.9 0.000000e+00 1635/1707 (95%)
EPI599299 A/chicken/Shenzhen/1395/2013 (A/H5N6) segment 4 (HA) 2748.9 0.000000e+00 1635/1707 (95%)
EPI530054 A/duck/Jiangxi/95/2014 (A/H5N6) segment 4 (HA) 2748.9 0.000000e+00 1635/1707 (95%)
EPI602484 A/chicken/Shenzhen/1061/2013 (A/H5N6) segment 4 (HA) 2743.4 0.000000e+00 1635/1708 (95%)
EPI602103 A/chicken/Shenzhen/2072/2013 (A/H0) segment 4 (HA) 2743.4 0.000000e+00 1634/1707 (95%)
EPI599346 A/chicken/Dongguan/4259/2013 (A/H5N6) segment 4 (HA) 2743.4 0.000000e+00 1634/1707 (95%)
EPI599333 A/silkie chicken/Dongguan/2809/2013 (A/H5N6) segment 4 (HA) 2743.4 0.000000e+00 1634/1707 (95%)
EPI599327 A/duck/Dongguan/2685/2013 (A/H5N6) segment 4 (HA) 2743.4 0.000000e+00 1634/1707 (95%)
EPI599292 A/chicken/Shenzhen/552/2013 (A/H5N6) segment 4 (HA) 2743.4 0.000000e+00 1634/1707 (95%)
EPI544892 A/duck/Shandong/Q1/2013 (A/H5N8) segment 4 (HA) 2743.4 0.000000e+00 1638/1711 (95%)
EPI531456 A/duck/Guangdong/GD01/2014 (A/H5N6) segment 4 (HA) 2743.4 0.000000e+00 1634/1707 (95%)
EPI509698 A/breeder duck/Korea/Gochang1/2014 (A/H5N8) segment 4 (HA) 2743.4 0.000000e+00 1637/1710 (95%)
EPI602477 A/chicken/Shenzhen/715/2013 (A/H5N6) segment 4 (HA) 2737.9 0.000000e+00 1633/1707 (95%)
EPI599320 A/chicken/Shenzhen/2464/2013 (A/H5N6) segment 4 (HA) 2737.9 0.000000e+00 1633/1707 (95%)
EPI599313 A/chicken/Shenzhen/2396/2013 (A/H5N6) segment 4 (HA) 2737.9 0.000000e+00 1633/1707 (95%)
EPI599285 A/chicken/Shenzhen/433/2013 (A/H5N6) segment 4 (HA) 2737.9 0.000000e+00 1633/1707 (95%)
EPI591879 A/duck/Jiangxi/23970/2013 (A/H0) segment 4 (HA) 2737.9 0.000000e+00 1636/1710 (95%)
EPI645049 A/swine/Guangdong/1/2014 (A/H5N6) segment 4 (HA) 2736.0 0.000000e+00 1630/1703 (95%)
EPI602491 A/chicken/Shenzhen/2269/2013 (A/H5N6) segment 4 (HA) 2732.3 0.000000e+00 1632/1707 (95%)
EPI601941 A/chicken/Dongguan/1100/2014 (A/H0) segment 4 (HA) 2732.3 0.000000e+00 1633/1708 (95%)
EPI590813 A/duck/Jiangxi/NCDZT1126/2014 (A/H5N6) segment 4 (HA) 2732.3 0.000000e+00 1632/1707 (95%)
EPI561495 A/Baikal teal/Korea/H52/2014 (A/H5N8) segment 4 (HA) 2732.3 0.000000e+00 1635/1710 (95%)
EPI530985 A/duck/Zhejiang/W24/2013 (A/H5N8) segment 4 (HA) 2732.3 0.000000e+00 1633/1708 (95%)
EPI645042 A/swine/Guangdong/2/2014 (A/H5N6) segment 4 (HA) 2730.5 0.000000e+00 1629/1703 (95%)
EPI590806 A/duck/Jiangxi/NCDZT1123/2014 (A/H5N6) segment 4 (HA) 2726.8 0.000000e+00 1631/1707 (95%)
EPI507673 A/mallard duck/Shanghai/SH-9/2013 (A/H5N8) segment 4 (HA) 2726.8 0.000000e+00 1633/1709 (95%)
EPI602037 A/duck/Ningbo/3262/2013 (A/H0) segment 4 (HA) 2721.2 0.000000e+00 1633/1710 (95%)
EPI593896 A/duck/Guangzhou/41227/2014 (A/H5N6) segment 4 (HA) 2721.2 0.000000e+00 1630/1707 (95%)
EPI593889 A/Guangzhou/39715/2014 (A/H5N6) segment 4 (HA) 2721.2 0.000000e+00 1630/1707 (95%)
EPI583870 A/duck/Shaoxing/5240/2013 (A/H0) segment 4 (HA) 2721.2 0.000000e+00 1633/1710 (95%)
EPI530063 A/environment/Shenzhen/25-24/2013 (A/H5N6) segment 4 (HA) 2721.2 0.000000e+00 1630/1707 (95%)
EPI553144 A/turkey/Italy/14VIR7898-10/2014 (A/H5N8) segment 4 (HA) 2717.5 0.000000e+00 1521/1546 (98%)
EPI530986 A/duck/Zhejiang/6D18/2013 (A/H5N8) segment 4 (HA) 2715.7 0.000000e+00 1632/1710 (95%)
EPI550768 A/duck/Laos/XBY004/2014 (A/H5N6) segment 4 (HA) 2710.2 0.000000e+00 1629/1708 (95%)
EPI550763 A/duck/Laos/XBY004/2014 (A/H5N6) segment 4 (HA) 2710.2 0.000000e+00 1629/1708 (95%)
EPI550759 A/chicken/Laos/XBY003/2014 (A/H5N6) segment 4 (HA) 2710.2 0.000000e+00 1629/1708 (95%)
EPI550757 A/duck/Laos/LPQ002/2014 (A/H5N6) segment 4 (HA) 2710.2 0.000000e+00 1629/1708 (95%)
EPI493825 A/duck/Guangdong/wy19/2008 (A/H5N5) segment 4 (HA) 2710.2 0.000000e+00 1632/1711 (95%)
EPI431448 A/duck/Hebei/2/2011 (A/H5N2) segment 4 (HA) 2706.5 0.000000e+00 1630/1710 (95%)
EPI550752 A/chicken/Laos/LPQ001/2014 (A/H5N6) segment 4 (HA) 2704.6 0.000000e+00 1628/1708 (95%)
EPI596610 A/duck/Vietnam/LBM758/2014 (A/H5N6) segment 4 (HA) 2700.9 0.000000e+00 1627/1708 (95%)
EPI596598 A/muscovy duck/Vietnam/LBM756/2014 (A/H5N6) segment 4 (HA) 2699.1 0.000000e+00 1627/1708 (95%)
EPI596592 A/muscovy duck/Vietnam/LBM755/2014 (A/H5N6) segment 4 (HA) 2699.1 0.000000e+00 1627/1708 (95%)
EPI596586 A/muscovy duck/Vietnam/LBM754/2014 (A/H5N6) segment 4 (HA) 2699.1 0.000000e+00 1627/1708 (95%)
EPI596580 A/duck/Vietnam/LBM752/2014 (A/H5N6) segment 4 (HA) 2699.1 0.000000e+00 1627/1708 (95%)
EPI596574 A/duck/Vietnam/LBM751/2014 (A/H5N6) segment 4 (HA) 2699.1 0.000000e+00 1627/1708 (95%)
EPI590116 A/chicken/Tonghai/802/2014 (A/H5N1) segment 4 (HA) 2699.1 0.000000e+00 1626/1707 (95%)
EPI590115 A/chicken/Tonghai/5/2014 (A/H5N1) segment 4 (HA) 2699.1 0.000000e+00 1626/1707 (95%)
EPI590114 A/chicken/Tonghai/3/2014 (A/H5N1) segment 4 (HA) 2699.1 0.000000e+00 1626/1707 (95%)
EPI590109 A/chicken/AnNing/1/2014 (A/H5N1) segment 4 (HA) 2699.1 0.000000e+00 1626/1707 (95%)
EPI585951 A/chicken/TongHai/302/2014 (A/H5N1) segment 4 (HA) 2699.1 0.000000e+00 1626/1707 (95%)
EPI499478 A/chicken/China/AH/2012 (A/H5N1) segment 4 (HA) 2699.1 0.000000e+00 1628/1709 (95%)
EPI596622 A/duck/Vietnam/LBM760/2014 (A/H5N6) segment 4 (HA) 2693.5 0.000000e+00 1626/1708 (95%)
EPI596616 A/duck/Vietnam/LBM759/2014 (A/H5N6) segment 4 (HA) 2693.5 0.000000e+00 1626/1708 (95%)
EPI596604 A/muscovy duck/Vietnam/LBM757/2014 (A/H5N6) segment 4 (HA) 2693.5 0.000000e+00 1626/1708 (95%)
EPI590898 A/pigeon/Sichuan/NCXN29/2014 (A/H5N1) segment 4 (HA) 2693.5 0.000000e+00 1626/1708 (95%)
EPI590897 A/duck/Sichuan/NCXN11/2014 (A/H5N1) segment 4 (HA) 2693.5 0.000000e+00 1626/1708 (95%)
EPI586256 A/Little egret/Vietnam/WBT210/2014 (A/H5N6) segment 4 (HA) 2693.5 0.000000e+00 1626/1708 (95%)
EPI586255 A/Black-crowned night heron/Vietnam/WBT198/2014 (A/H5N6) segment 4 (HA) 2693.5 0.000000e+00 1626/1708 (95%)
EPI586254 A/Spotted dove/Vietnam/WBT191/2014 (A/H5N6) segment 4 (HA) 2693.5 0.000000e+00 1626/1708 (95%)
EPI493817 A/duck/Guangdong/wy11/2008 (A/H5N5) segment 4 (HA) 2693.5 0.000000e+00 1630/1712 (95%)
EPI590111 A/chicken/AnNing/6/2014 (A/H5N1) segment 4 (HA) 2688.0 0.000000e+00 1625/1708 (95%)
EPI586258 A/Chinese pond heron/Vietnam/WBT231/2014 (A/H5N6) segment 4 (HA) 2688.0 0.000000e+00 1625/1708 (95%)
EPI590110 A/chicken/AnNing/4/2014 (A/H5N1) segment 4 (HA) 2682.5 0.000000e+00 1623/1707 (95%)
EPI586257 A/Common moorhen/Vietnam/WBT226/2014 (A/H5N6) segment 4 (HA) 2682.5 0.000000e+00 1624/1708 (95%)
EPI590896 A/duck/Sichuan/NCXN10/2014 (A/H5N1) segment 4 (HA) 2671.4 0.000000e+00 1623/1709 (94%)
EPI643147 A/Environment/Guangdong/GZ55/2013(H5N8) (A/H5N8) segment 4 (HA) 2667.7 0.000000e+00 1619/1711 (94%)
EPI590113 A/chicken/DaLi/502/2014 (A/H5N1) segment 4 (HA) 2660.3 0.000000e+00 1620/1708 (94%)
EPI590112 A/chicken/DaLi/302/2014 (A/H5N1) segment 4 (HA) 2660.3 0.000000e+00 1620/1708 (94%)
EPI641396 A/chicken/Yunnan/25A/2015 (A/H5N6) segment 4 (HA) 2656.6 0.000000e+00 1621/1709 (94%)
EPI328878 A/duck/Eastern China/031/2009 (A/H5N5) segment 4 (HA) 2654.8 0.000000e+00 1622/1711 (94%)
EPI641398 A/Yunnan/0127/2015 (A/H5N6) segment 4 (HA) 2651.1 0.000000e+00 1619/1708 (94%)
EPI590895 A/environment/Sichuan/NCLL1/2014 (A/H5N6) segment 4 (HA) 2638.1 0.000000e+00 1619/1711 (94%)
EPI602094 A/chicken/Shenzhen/712/2013 (A/H0) segment 4 (HA) 2632.6 0.000000e+00 1618/1711 (94%)
EPI590891 A/duck/Sichuan/NCJPL7/2014 (A/H5N6) segment 4 (HA) 2632.6 0.000000e+00 1618/1711 (94%)
EPI602113 A/environment/Jiangxi/10170/2014 (A/H5N6) segment 4 (HA) 2627.1 0.000000e+00 1618/1712 (94%)
EPI601997 A/black chicken/Jiangxi/10139/2014 (A/H0) segment 4 (HA) 2627.1 0.000000e+00 1618/1712 (94%)
EPI599369 A/environment/Jiangxi/10171/2014 (A/H5N6) segment 4 (HA) 2627.1 0.000000e+00 1618/1712 (94%)
EPI599360 A/environment/Jiangxi/10164/2014 (A/H5N6) segment 4 (HA) 2627.1 0.000000e+00 1618/1712 (94%)
EPI599353 A/duck/Jiangxi/10160/2014 (A/H5N6) segment 4 (HA) 2627.1 0.000000e+00 1618/1712 (94%)
EPI590889 A/Anas_crecca/Hubei/Chenhu1623-5/2014 (A/H5N6) segment 4 (HA) 2627.1 0.000000e+00 1617/1711 (94%)
EPI585724 A/cat/Sichuan/SC18/2014 (A/H5N6) segment 4 (HA) 2627.1 0.000000e+00 1617/1711 (94%)
EPI569711 A/duck/Zhejiang/6D2/2013 (A/H5N6) segment 4 (HA) 2627.1 0.000000e+00 1617/1711 (94%)
EPI569710 A/chicken/Zhejiang/6C2/2013 (A/H5N6) segment 4 (HA) 2627.1 0.000000e+00 1617/1711 (94%)
EPI533583 A/Sichuan/26221/2014 (A/H5N6) segment 4 (HA) 2627.1 0.000000e+00 1617/1711 (94%)
EPI328870 A/duck/Eastern China/008/2008 (A/H5N5) segment 4 (HA) 2627.1 0.000000e+00 1618/1712 (94%)
EPI602107 A/black chicken/Jiangxi/10129/2014 (A/H5N6) segment 4 (HA) 2621.5 0.000000e+00 1617/1712 (94%)
EPI601986 A/black chicken/Jiangxi/10136/2014 (A/H0) segment 4 (HA) 2621.5 0.000000e+00 1617/1712 (94%)
EPI601977 A/black chicken/Jiangxi/10131/2014 (A/H0) segment 4 (HA) 2621.5 0.000000e+00 1617/1712 (94%)
EPI599306 A/chicken/Shenzhen/1845/2013 (A/H5N6) segment 4 (HA) 2621.5 0.000000e+00 1616/1711 (94%)
EPI593753 A/goose/Yangzhou/ZG62/2011 (A/H5N5) segment 4 (HA) 2621.5 0.000000e+00 1617/1712 (94%)
EPI590894 A/duck/Sichuan/NCXJ24/2014 (A/H5N6) segment 4 (HA) 2621.5 0.000000e+00 1616/1711 (94%)
EPI590893 A/duck/Sichuan/NCXJ16/2014 (A/H5N6) segment 4 (HA) 2621.5 0.000000e+00 1616/1711 (94%)
EPI590890 A/chicken/Sichuan/NCJPL1/2014 (A/H5N6) segment 4 (HA) 2621.5 0.000000e+00 1616/1711 (94%)
EPI585731 A/swan goose/Jilin/JL01/2014 (A/H5N6) segment 4 (HA) 2621.5 0.000000e+00 1617/1712 (94%)
EPI547402 A/environment/Zhenjiang/C13/2013 (A/H5N6) segment 4 (HA) 2621.5 0.000000e+00 1617/1712 (94%)
EPI328886 A/duck/Eastern China/108/2008 (A/H5N1) segment 4 (HA) 2621.5 0.000000e+00 1617/1712 (94%)
EPI641394 A/chicken/Yunnan/22/2015 (A/H5N6) segment 4 (HA) 2617.8 0.000000e+00 1616/1711 (94%)
EPI602056 A/chicken/Jiangxi/10122/2014 (A/H0) segment 4 (HA) 2617.8 0.000000e+00 1616/1712 (94%)
EPI493833 A/duck/Guangdong/wy24/2008 (A/H5N5) segment 4 (HA) 2612.3 0.000000e+00 1618/1715 (94%)
EPI442025 A/quail/Jiangsu/k0104/2010 (A/H5N5) segment 4 (HA) 2612.3 0.000000e+00 1618/1715 (94%)
EPI590892 A/duck/Sichuan/NCXJ15/2014 (A/H5N6) segment 4 (HA) 2610.4 0.000000e+00 1614/1711 (94%)
EPI641392 A/chicken/Yunnan/19/2015 (A/H5N6) segment 4 (HA) 2606.7 0.000000e+00 1614/1711 (94%)
EPI602181 A/duck/Jiangxi/13484/2014 (A/H5N6) segment 4 (HA) 2593.8 0.000000e+00 1612/1712 (94%)
EPI602167 A/duck/Jiangxi/13469/2014 (A/H5N6) segment 4 (HA) 2593.8 0.000000e+00 1612/1712 (94%)
EPI589841 A/duck/Nha Trang/75c131/2014 (A/H5N6) segment 4 (HA) 2593.8 0.000000e+00 1612/1712 (94%)
EPI589366 A/muscovy duck/Quang Ninh/4c111/2013 (A/H5N6) segment 4 (HA) 2593.8 0.000000e+00 1612/1712 (94%)
EPI585379 A/duck/Vietnam/1144/2014 (A/H5N6) segment 4 (HA) 2593.8 0.000000e+00 1612/1712 (94%)
EPI585378 A/duck/Vietnam/1434/2014 (A/H5N6) segment 4 (HA) 2593.8 0.000000e+00 1612/1712 (94%)
EPI585376 A/duck/Vietnam/1507/2014 (A/H5N6) segment 4 (HA) 2593.8 0.000000e+00 1612/1712 (94%)
EPI585374 A/duck/Vietnam/1152/2014 (A/H5N6) segment 4 (HA) 2593.8 0.000000e+00 1612/1712 (94%)
EPI602174 A/duck/Jiangxi/13475/2014 (A/H5N6) segment 4 (HA) 2588.3 0.000000e+00 1611/1712 (94%)
EPI589373 A/muscovy duck/Quang Ninh/5c112/2013 (A/H5N6) segment 4 (HA) 2588.3 0.000000e+00 1611/1712 (94%)
EPI585377 A/duck/Vietnam/1511/2014 (A/H5N6) segment 4 (HA) 2588.3 0.000000e+00 1611/1712 (94%)
EPI585389 A/duck/Vietnam/1151/2014 (A/H5N6) segment 4 (HA) 2584.6 0.000000e+00 1605/1704 (94%)
EPI442001 A/goose/Shandong/k1204/2009 (A/H5N5) segment 4 (HA) 2582.7 0.000000e+00 1608/1710 (94%)
EPI442009 A/goose/Guangdong/k0103/2010 (A/H5N5) segment 4 (HA) 2562.4 0.000000e+00 1608/1714 (93%)
EPI593754 A/goose/Yangzhou/ZG60/2009 (A/H5N5) segment 4 (HA) 2549.5 0.000000e+00 1602/1710 (93%)
EPI597677 A/duck/Hunan/316/2005 (A/H5N1) segment 4 (HA) 2505.2 0.000000e+00 1595/1711 (93%)
EPI127384 A/wild duck/Hunan/021/2005 (A/H5N1) segment 4 (HA) 2505.2 0.000000e+00 1595/1711 (93%)
EPI227309 A/Mallard/Huadong/lk/2005 (A/H5N1) segment 4 (HA) 2499.6 0.000000e+00 1593/1710 (93%)
EPI127406 A/wild duck/Hunan/211/2005 (A/H5N1) segment 4 (HA) 2499.6 0.000000e+00 1594/1711 (93%)
EPI439897 A/goose/Guangdong/08/2005 (A/H5N1) segment 4 (HA) 2497.8 0.000000e+00 1594/1711 (93%)
EPI399886 A/duck/HuBei/03/2010 (A/H5N5) segment 4 (HA) 2494.1 0.000000e+00 1594/1712 (93%)
EPI279949 A/Zhejiang/1/2006 (A/H5N1) segment 4 (HA) 2494.1 0.000000e+00 1593/1711 (93%)
EPI276046 A/goose/Hubei/65/2005 (A/H5N1) segment 4 (HA) 2494.1 0.000000e+00 1593/1711 (93%)
EPI181297 A/Zhejiang/1/2006 (A/H5N1) segment 4 (HA) 2494.1 0.000000e+00 1593/1711 (93%)
EPI275982 A/duck/Hubei/49/2005 (A/H5N1) segment 4 (HA) 2488.6 0.000000e+00 1593/1712 (93%)
EPI107769 A/duck/Guangxi/288/2006 (A/H5N1) segment 4 (HA) 2488.6 0.000000e+00 1586/1702 (93%)
EPI337076 A/Sichuan/2/2006 (A/H5N1) segment 4 (HA) 2483.0 0.000000e+00 1591/1711 (92%)
EPI280104 A/Guangdong/1/2006 (A/H5N1) segment 4 (HA) 2483.0 0.000000e+00 1591/1711 (92%)
EPI275774 A/chicken/Hunan/21/2005 (A/H5N1) segment 4 (HA) 2483.0 0.000000e+00 1592/1712 (92%)
EPI224777 A/Shanghai/1/2006 (A/H5N1) segment 4 (HA) 2483.0 0.000000e+00 1591/1711 (92%)
EPI181301 A/Guangdong/1/2006 (A/H5N1) segment 4 (HA) 2483.0 0.000000e+00 1591/1711 (92%)
EPI181298 A/Sichuan/1/2006 (A/H5N1) segment 4 (HA) 2483.0 0.000000e+00 1591/1711 (92%)
EPI164232 A/Sichuan/2/2006 (A/H5N1) segment 4 (HA) 2483.0 0.000000e+00 1591/1711 (92%)
EPI164224 A/Sichuan/1/2006 (A/H5N1) segment 4 (HA) 2483.0 0.000000e+00 1591/1711 (92%)
EPI107913 A/goose/Yunnan/1144/2006 (A/H5N1) segment 4 (HA) 2483.0 0.000000e+00 1585/1702 (93%)
EPI107829 A/goose/Guiyang/1304/2006 (A/H5N1) segment 4 (HA) 2483.0 0.000000e+00 1585/1702 (93%)
EPI107771 A/chicken/Guangxi/463/2006 (A/H5N1) segment 4 (HA) 2483.0 0.000000e+00 1585/1702 (93%)
EPI406406 A/Muscovy duck/Ca Mau/22/2007 (A/H5N1) segment 4 (HA) 2477.5 0.000000e+00 1591/1712 (92%)
EPI337107 A/Shanghai/1/2006 (A/H5N1) segment 4 (HA) 2477.5 0.000000e+00 1590/1711 (92%)
EPI280112 A/Shanghai/1/2006 (A/H5N1) segment 4 (HA) 2477.5 0.000000e+00 1590/1711 (92%)
EPI275966 A/duck/Anhui/56/2005 (A/H5N1) segment 4 (HA) 2477.5 0.000000e+00 1590/1711 (92%)
EPI275386 A/Anhui/2/2005 (A/H5N1) segment 4 (HA) 2477.5 0.000000e+00 1591/1712 (92%)
EPI170615 A/chicken/Vietnam/216/2005 (A/H5N1) segment 4 (HA) 2477.5 0.000000e+00 1590/1711 (92%)
EPI170607 A/Muscovy duck/Vietnam/217/2005 (A/H5N1) segment 4 (HA) 2477.5 0.000000e+00 1590/1711 (92%)
EPI170599 A/duck/Vietnam/218/2005 (A/H5N1) segment 4 (HA) 2477.5 0.000000e+00 1590/1711 (92%)
EPI170591 A/duck/Vietnam/219/2005 (A/H5N1) segment 4 (HA) 2477.5 0.000000e+00 1590/1711 (92%)
EPI108329 A/goose/Guangxi/1898/2006 (A/H5N1) segment 4 (HA) 2477.5 0.000000e+00 1584/1702 (93%)
EPI270188 A/Vietnam/UT30850/2005 (A/H5N1) segment 4 (HA) 2475.6 0.000000e+00 1587/1707 (92%)
EPI106243 A/duck/Laos/3295/2006 (A/H5N1) segment 4 (HA) 2475.6 0.000000e+00 1591/1712 (92%)
EPI620814 A/duck/Vietnam SonLa/NCVD-33/2007 (A/H5N1) segment 4 (HA) 2471.9 0.000000e+00 1590/1712 (92%)
EPI573523 A/wildbird/Anhui/82/2005 (A/H5N1) segment 4 (HA) 2471.9 0.000000e+00 1591/1713 (92%)
EPI286383 A/chicken/Cao Bang/07-42/2007 (A/H5N1) segment 4 (HA) 2471.9 0.000000e+00 1590/1712 (92%)
EPI286381 A/chicken/Nam Dinh/07-32/2007 (A/H5N1) segment 4 (HA) 2471.9 0.000000e+00 1590/1712 (92%)
EPI275958 A/duck/Anhui/1/06 (A/H5N1) segment 4 (HA) 2471.9 0.000000e+00 1591/1713 (92%)
EPI275870 A/chicken/Sichuan/81/2005 (A/H5N1) segment 4 (HA) 2471.9 0.000000e+00 1589/1711 (92%)
EPI227371 A/muscovy duck/VietNam/209/2005 (A/H5) segment 4 (HA) 2471.9 0.000000e+00 1589/1711 (92%)
EPI227010 A/chicken/Ninh Binh/209/2005 (A/H5N1) segment 4 (HA) 2471.9 0.000000e+00 1589/1711 (92%)
EPI181299 A/Fujian/1/2005 (A/H5N1) segment 4 (HA) 2471.9 0.000000e+00 1590/1712 (92%)
EPI180956 A/duck/Laos/22/2006 (A/H5N1) segment 4 (HA) 2471.9 0.000000e+00 1590/1712 (92%)
EPI180951 A/duck/Laos/25/2006 (A/H5N1) segment 4 (HA) 2471.9 0.000000e+00 1590/1712 (92%)
EPI170742 A/duck/Vietnam/215/2005 (A/H5N1) segment 4 (HA) 2471.9 0.000000e+00 1589/1711 (92%)
EPI170741 A/Muscovy duck/Vietnam/213/2005 (A/H5N1) segment 4 (HA) 2471.9 0.000000e+00 1589/1711 (92%)
EPI170740 A/chicken/Vietnam/212/2005 (A/H5N1) segment 4 (HA) 2471.9 0.000000e+00 1589/1711 (92%)
EPI170739 A/Muscovy duck/Vietnam/211/2005 (A/H5N1) segment 4 (HA) 2471.9 0.000000e+00 1589/1711 (92%)
EPI170738 A/duck/Vietnam/210/2005 (A/H5N1) segment 4 (HA) 2471.9 0.000000e+00 1589/1711 (92%)
EPI170714 A/chicken/Vietnam/202/2005 (A/H5N1) segment 4 (HA) 2471.9 0.000000e+00 1589/1711 (92%)
EPI170690 A/duck/Vietnam/205/2005 (A/H5N1) segment 4 (HA) 2471.9 0.000000e+00 1589/1711 (92%)
EPI170674 A/duck/Vietnam/207/2005 (A/H5N1) segment 4 (HA) 2471.9 0.000000e+00 1589/1711 (92%)
EPI170658 A/chicken/Vietnam/209/2005 (A/H5N1) segment 4 (HA) 2471.9 0.000000e+00 1589/1711 (92%)
EPI164285 A/duck/Yunnan/5310/2006 (A/H5N1) segment 4 (HA) 2471.9 0.000000e+00 1589/1711 (92%)
EPI164250 A/Fujian/1/2005 (A/H5N1) segment 4 (HA) 2471.9 0.000000e+00 1590/1712 (92%)
EPI164216 A/Anhui/1/2005 (A/H5N1) segment 4 (HA) 2471.9 0.000000e+00 1590/1712 (92%)
EPI108331 A/goose/Guangxi/1633/2006 (A/H5N1) segment 4 (HA) 2471.9 0.000000e+00 1583/1702 (93%)
EPI107815 A/duck/Guiyang/497/2006 (A/H5N1) segment 4 (HA) 2471.9 0.000000e+00 1584/1703 (93%)
EPI106026 A/China/GD01/2006 (A/H5N1) segment 4 (HA) 2471.9 0.000000e+00 1589/1711 (92%)
EPI101917 A/Anhui/1/2005 (A/H5N1) segment 4 (HA) 2471.9 0.000000e+00 1590/1712 (92%)
EPI97209 A/Duck/Fujian/1734/05 (A/H5N1) segment 4 (HA) 2471.9 0.000000e+00 1586/1706 (92%)
EPI406392 A/chicken/Cao Bang/20/2007 (A/H5N1) segment 4 (HA) 2468.2 0.000000e+00 1589/1712 (92%)
EPI337959 A/Guangxi/1/2005 (A/H5N1) segment 4 (HA) 2466.4 0.000000e+00 1588/1711 (92%)
EPI286619 A/muscovy duck/Son La/07-85/2007 (A/H5N1) segment 4 (HA) 2466.4 0.000000e+00 1587/1710 (92%)
EPI270204 A/Vietnam/UT31239/2007 (A/H5N1) segment 4 (HA) 2466.4 0.000000e+00 1587/1710 (92%)
EPI227293 A/Mallard/Huadong/S/2005 (A/H5N1) segment 4 (HA) 2466.4 0.000000e+00 1588/1711 (92%)
EPI225081 A/duck/Hai Phong /208/2006 (A/H5N1) segment 4 (HA) 2466.4 0.000000e+00 1588/1711 (92%)
EPI170666 A/duck/Vietnam/208/2005 (A/H5N1) segment 4 (HA) 2466.4 0.000000e+00 1588/1711 (92%)
EPI164357 A/goose/Yunnan/5769/2006 (A/H5N1) segment 4 (HA) 2466.4 0.000000e+00 1588/1711 (92%)
EPI164258 A/Guangxi/1/2005 (A/H5N1) segment 4 (HA) 2466.4 0.000000e+00 1588/1711 (92%)
EPI164240 A/Anhui/2/2005 (A/H5N1) segment 4 (HA) 2466.4 0.000000e+00 1592/1715 (92%)
EPI160500 A/duck/Vietnam/NCVD-65/07 (A/H5N1) segment 4 (HA) 2466.4 0.000000e+00 1587/1710 (92%)
EPI108333 A/chicken/Guangxi/1951/2006 (A/H5N1) segment 4 (HA) 2466.4 0.000000e+00 1583/1703 (92%)
EPI108327 A/duck/Guangxi/1830/2006 (A/H5N1) segment 4 (HA) 2466.4 0.000000e+00 1582/1702 (92%)
EPI107865 A/duck/Hunan/856/2006 (A/H5N1) segment 4 (HA) 2466.4 0.000000e+00 1580/1699 (92%)
EPI107831 A/duck/Guiyang/1418/2006 (A/H5N1) segment 4 (HA) 2466.4 0.000000e+00 1583/1703 (92%)
EPI107803 A/duck/Guiyang/3996/2005 (A/H5N1) segment 4 (HA) 2466.4 0.000000e+00 1579/1697 (93%)
EPI107799 A/chicken/Guiyang/3721/2005 (A/H5N1) segment 4 (HA) 2466.4 0.000000e+00 1583/1703 (92%)
EPI107755 A/duck/Guangxi/5270/2005 (A/H5N1) segment 4 (HA) 2466.4 0.000000e+00 1582/1702 (92%)
EPI107753 A/duck/Guangxi/5165/2005 (A/H5N1) segment 4 (HA) 2466.4 0.000000e+00 1582/1702 (92%)
EPI107741 A/duck/Guangxi/4428/2005 (A/H5N1) segment 4 (HA) 2466.4 0.000000e+00 1582/1702 (92%)
EPI101919 A/Anhui/2/2005 (A/H5N1) segment 4 (HA) 2466.4 0.000000e+00 1592/1715 (92%)
EPI164349 A/goose/Yunnan/5599/2006 (A/H5N1) segment 4 (HA) 2464.6 0.000000e+00 1585/1707 (92%)
EPI164341 A/goose/Yunnan/5540/2006 (A/H5N1) segment 4 (HA) 2464.6 0.000000e+00 1585/1707 (92%)
EPI439068 A/domestic green-winged teal/Hunan/3450/2006 (A/H5N1) segment 4 (HA) 2460.9 0.000000e+00 1587/1711 (92%)
EPI406352 A/duck/Son La/34/2007 (A/H5N1) segment 4 (HA) 2460.9 0.000000e+00 1588/1712 (92%)
EPI337141 A/Anhui/1/2006 (A/H5N1) segment 4 (HA) 2460.9 0.000000e+00 1587/1711 (92%)
EPI286391 A/duck/Ninh Binh/07-68/2007 (A/H5N1) segment 4 (HA) 2460.9 0.000000e+00 1586/1710 (92%)
EPI284574 A/duck/Vietnam/NCVD-102/2007 (A/H5N1) segment 4 (HA) 2460.9 0.000000e+00 1586/1710 (92%)
EPI284560 A/duck/Vietnam/NCVD-104/2007 (A/H5N1) segment 4 (HA) 2460.9 0.000000e+00 1586/1710 (92%)
EPI284515 A/muscovy duck/Vietnam/NCVD-120/2007 (A/H5N1) segment 4 (HA) 2460.9 0.000000e+00 1586/1710 (92%)
EPI280136 A/Fujian/1/2007 (A/H5N1) segment 4 (HA) 2460.9 0.000000e+00 1588/1712 (92%)
EPI280032 A/Anhui/1/2006 (A/H5N1) segment 4 (HA) 2460.9 0.000000e+00 1587/1711 (92%)
EPI224965 A/chicken/Hong Kong/D-06-0947/2006 (A/H5N1) segment 4 (HA) 2460.9 0.000000e+00 1588/1712 (92%)
EPI222002 A/environment/Hunan/1-8/2007 (A/H5N1) segment 4 (HA) 2460.9 0.000000e+00 1587/1711 (92%)
EPI221926 A/duck/Phu Tho/07-92/2007 (A/H5N1) segment 4 (HA) 2460.9 0.000000e+00 1586/1710 (92%)
EPI181300 A/Fujian/1/2007 (A/H5N1) segment 4 (HA) 2460.9 0.000000e+00 1588/1712 (92%)
EPI174656 A/duck/Hunan/3340/2006 (A/H5N1) segment 4 (HA) 2460.9 0.000000e+00 1589/1713 (92%)
EPI164373 A/goose/Yunnan/6193/2006 (A/H5N1) segment 4 (HA) 2460.9 0.000000e+00 1587/1711 (92%)
EPI164365 A/goose/Yunnan/5979/2006 (A/H5N1) segment 4 (HA) 2460.9 0.000000e+00 1587/1711 (92%)
EPI164173 A/muscovy duck/Vietnam/NCVD-51/2007 (A/H5N1) segment 4 (HA) 2460.9 0.000000e+00 1586/1710 (92%)
EPI160508 A/duck/Vietnam/NCVD-68/07 (A/H5N1) segment 4 (HA) 2460.9 0.000000e+00 1586/1710 (92%)
EPI160492 A/duck/Vietnam/NCVD-64/07 (A/H5N1) segment 4 (HA) 2460.9 0.000000e+00 1586/1710 (92%)
EPI107857 A/duck/Hunan/5152/2005 (A/H5N1) segment 4 (HA) 2460.9 0.000000e+00 1581/1702 (92%)
EPI107855 A/duck/Hunan/5106/2005 (A/H5N1) segment 4 (HA) 2460.9 0.000000e+00 1581/1702 (92%)
EPI107747 A/duck/Guangxi/4830/2005 (A/H5N1) segment 4 (HA) 2460.9 0.000000e+00 1581/1702 (92%)
EPI107743 A/goose/Guangxi/4513/2005 (A/H5N1) segment 4 (HA) 2460.9 0.000000e+00 1581/1702 (92%)
EPI337121 A/Sichuan/3/2006 (A/H5N1) segment 4 (HA) 2459.0 0.000000e+00 1586/1711 (92%)
EPI280018 A/Sichuan/3/2006 (A/H5N1) segment 4 (HA) 2459.0 0.000000e+00 1586/1711 (92%)
EPI164381 A/goose/Yunnan/6384/2006 (A/H5N1) segment 4 (HA) 2459.0 0.000000e+00 1584/1707 (92%)
EPI620813 A/duck/Vietnam NamDinh/NCVD-88/2007 (A/H5N1) segment 4 (HA) 2455.3 0.000000e+00 1585/1710 (92%)
EPI383687 A/duck/Vietnam/TY114/2007 (A/H5N1) segment 4 (HA) 2455.3 0.000000e+00 1585/1710 (92%)
EPI383685 A/duck/Vietnam/TY103/2007 (A/H5N1) segment 4 (HA) 2455.3 0.000000e+00 1585/1710 (92%)
EPI361516 A/Chicken/Laos/Xaythiani 26/2006 (A/H5N1) segment 4 (HA) 2455.3 0.000000e+00 1588/1713 (92%)
EPI286621 A/muscovy duck/Thai Binh/07-90/2007 (A/H5N1) segment 4 (HA) 2455.3 0.000000e+00 1585/1710 (92%)
EPI286620 A/muscovy duck/Nam Dinh/07-87/2007 (A/H5N1) segment 4 (HA) 2455.3 0.000000e+00 1585/1710 (92%)
EPI286618 A/muscovy duck/Ha Nam/07-84/2007 (A/H5N1) segment 4 (HA) 2455.3 0.000000e+00 1585/1710 (92%)
EPI286616 A/muscovy duck/Ha Nam/07-47/2007 (A/H5N1) segment 4 (HA) 2455.3 0.000000e+00 1585/1710 (92%)
EPI286398 A/duck/Nam Dinh/07-88/2007 (A/H5N1) segment 4 (HA) 2455.3 0.000000e+00 1585/1710 (92%)
EPI286396 A/duck/Thai Ninh/07-86/2007 (A/H5N1) segment 4 (HA) 2455.3 0.000000e+00 1585/1710 (92%)
EPI286376 A/avian/Hong Kong/1993/2007 (A/H5N1) segment 4 (HA) 2455.3 0.000000e+00 1584/1709 (92%)
EPI286374 A/avian/Hong Kong/0828/2007 (A/H5N1) segment 4 (HA) 2455.3 0.000000e+00 1585/1710 (92%)
EPI286373 A/avian/Hong Kong/0719/2007 (A/H5N1) segment 4 (HA) 2455.3 0.000000e+00 1585/1710 (92%)
EPI286372 A/avian/Hong Kong/2065/2007 (A/H5N1) segment 4 (HA) 2455.3 0.000000e+00 1584/1709 (92%)
EPI284576 A/duck/Vietnam/NCVD-107/2007 (A/H5N1) segment 4 (HA) 2455.3 0.000000e+00 1585/1710 (92%)
EPI284572 A/duck/Vietnam/NCVD-94/2007 (A/H5N1) segment 4 (HA) 2455.3 0.000000e+00 1585/1710 (92%)
EPI284570 A/duck/Vietnam/NCVD-113/2007 (A/H5N1) segment 4 (HA) 2455.3 0.000000e+00 1585/1710 (92%)
EPI284567 A/duck/Vietnam/NCVD-021/2008 (A/H5N1) segment 4 (HA) 2455.3 0.000000e+00 1585/1710 (92%)
EPI284566 A/duck/Vietnam/NCVD-020/2008 (A/H5N1) segment 4 (HA) 2455.3 0.000000e+00 1586/1711 (92%)
EPI284553 A/duck/Vietnam/NCVD-99/2007 (A/H5N1) segment 4 (HA) 2455.3 0.000000e+00 1585/1710 (92%)
EPI284494 A/chicken/Vietnam/NCVD-108/2007 (A/H5N1) segment 4 (HA) 2455.3 0.000000e+00 1585/1710 (92%)
EPI284493 A/chicken/Vietnam/NCVD-106/2007 (A/H5N1) segment 4 (HA) 2455.3 0.000000e+00 1585/1710 (92%)
EPI280096 A/Hunan/1/2006 (A/H5N1) segment 4 (HA) 2455.3 0.000000e+00 1586/1711 (92%)
EPI275462 A/Guangxi/1/2005 (A/H5N1) segment 4 (HA) 2455.3 0.000000e+00 1586/1711 (92%)
EPI181296 A/Hunan/1/2006 (A/H5N1) segment 4 (HA) 2455.3 0.000000e+00 1586/1711 (92%)
EPI180895 A/duck/Laos/P0137/2007 (A/H5N1) segment 4 (HA) 2455.3 0.000000e+00 1587/1712 (92%)
EPI180839 A/duck/Laos/P0161/2007 (A/H5N1) segment 4 (HA) 2455.3 0.000000e+00 1586/1711 (92%)
EPI167953 A/long-tailed shrike/Hong Kong/2762/2007 (A/H5N1) segment 4 (HA) 2455.3 0.000000e+00 1580/1702 (92%)
EPI164207 A/duck/Vietnam/NCVD-82/07 (A/H5N1) segment 4 (HA) 2455.3 0.000000e+00 1585/1710 (92%)
EPI160460 A/duck/Vietnam/NCVD-60/07 (A/H5N1) segment 4 (HA) 2455.3 0.000000e+00 1585/1710 (92%)
EPI108515 A/goose/Guangxi/532/2006 (A/H5N1) segment 4 (HA) 2455.3 0.000000e+00 1580/1702 (92%)
EPI108335 A/goose/Guangxi/1458/2006 (A/H5N1) segment 4 (HA) 2455.3 0.000000e+00 1580/1702 (92%)
EPI107833 A/duck/Shantou/13323/2005 (A/H5N1) segment 4 (HA) 2455.3 0.000000e+00 1581/1703 (92%)
EPI107809 A/duck/Guiyang/293/2006 (A/H5N1) segment 4 (HA) 2455.3 0.000000e+00 1581/1703 (92%)
EPI107765 A/duck/Guangxi/150/2006 (A/H5N1) segment 4 (HA) 2455.3 0.000000e+00 1580/1702 (92%)
EPI78021 A/chicken/Malaysia/5223/2007 (A/H5N1) segment 4 (HA) 2455.3 0.000000e+00 1579/1700 (92%)
EPI221918 A/duck/Nong-Khai/Thailand/KU-56/2007 (A/H5N1) segment 4 (HA) 2453.5 0.000000e+00 1587/1712 (92%)
EPI164293 A/duck/Yunnan/6490/2006 (A/H5N1) segment 4 (HA) 2453.5 0.000000e+00 1583/1707 (92%)
EPI123798 A/Chicken/Laos/Xaythiani 36/2006 (A/H5N1) segment 4 (HA) 2453.5 0.000000e+00 1586/1710 (92%)
EPI123796 A/Chicken/Laos/Xaythiani 32/2006 (A/H5N1) segment 4 (HA) 2453.5 0.000000e+00 1586/1710 (92%)
EPI276022 A/duck/Jiangxi/80/2005 (A/H5N1) segment 4 (HA) 2451.6 0.000000e+00 1588/1714 (92%)
EPI164165 A/muscovy duck/Vietnam/NCVD-47/2007 (A/H5N1) segment 4 (HA) 2451.6 0.000000e+00 1584/1710 (92%)
EPI123800 A/Chicken/Laos/Xaythiani 37/2006 (A/H5N1) segment 4 (HA) 2451.6 0.000000e+00 1588/1714 (92%)
EPI406336 A/duck/Soc Trang/31/2007 (A/H5N1) segment 4 (HA) 2449.8 0.000000e+00 1586/1712 (92%)
EPI286617 A/muscovy duck/Bac Gieng/07-66/2007 (A/H5N1) segment 4 (HA) 2449.8 0.000000e+00 1584/1710 (92%)
EPI286615 A/muscovy duck/Bac Ninh/07-69/2007 (A/H5N1) segment 4 (HA) 2449.8 0.000000e+00 1585/1711 (92%)
EPI286401 A/duck/Nam Dinh/07-91/2007 (A/H5N1) segment 4 (HA) 2449.8 0.000000e+00 1584/1710 (92%)
EPI286399 A/chicken/Thai Binh/07-89/2007 (A/H5N1) segment 4 (HA) 2449.8 0.000000e+00 1584/1710 (92%)
EPI286387 A/duck/Ha Tinh/07-53/2007 (A/H5N1) segment 4 (HA) 2449.8 0.000000e+00 1584/1710 (92%)
EPI286375 A/avian/Hong Kong/2372/2007 (A/H5N1) segment 4 (HA) 2449.8 0.000000e+00 1584/1710 (92%)
EPI284582 A/duck/Vietnam/NCVD-110/2007 (A/H5N1) segment 4 (HA) 2449.8 0.000000e+00 1584/1710 (92%)
EPI284573 A/duck/Vietnam/NCVD-100/2007 (A/H5N1) segment 4 (HA) 2449.8 0.000000e+00 1584/1710 (92%)
EPI284571 A/duck/Vietnam/NCVD-116/2007 (A/H5N1) segment 4 (HA) 2449.8 0.000000e+00 1584/1710 (92%)
EPI284565 A/duck/Vietnam/NCVD-019/2008 (A/H5N1) segment 4 (HA) 2449.8 0.000000e+00 1584/1710 (92%)
EPI284513 A/muscovy duck/Vietnam/NCVD-114/2007 (A/H5N1) segment 4 (HA) 2449.8 0.000000e+00 1585/1711 (92%)
EPI284511 A/muscovy duck/Vietnam/NCVD-101/2007 (A/H5N1) segment 4 (HA) 2449.8 0.000000e+00 1584/1710 (92%)

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Wed Oct 14, 2015 11:50 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
EPI620459 A/chicken/Iowa/14589-1/2015 (A/H5N2) segment 6 (NA) 2599.4 0.000000e+00 1409/1410 (99%)
EPI620452 A/chicken/Iowa/14399-4/2015 (A/H5N2) segment 6 (NA) 2599.4 0.000000e+00 1409/1410 (99%)
EPI620445 A/chicken/Iowa/14322-6/2015 (A/H5N2) segment 6 (NA) 2599.4 0.000000e+00 1409/1410 (99%)
EPI620438 A/turkey/Iowa/14319-1/2015 (A/H5N2) segment 6 (NA) 2599.4 0.000000e+00 1409/1410 (99%)
EPI620431 A/turkey/Iowa/14318-1/2015 (A/H5N2) segment 6 (NA) 2599.4 0.000000e+00 1409/1410 (99%)
EPI620424 A/chicken/Iowa/13542-2/2015 (A/H5N2) segment 6 (NA) 2599.4 0.000000e+00 1409/1410 (99%)
EPI620417 A/turkey/Iowa/13541-1/2015 (A/H5N2) segment 6 (NA) 2599.4 0.000000e+00 1409/1410 (99%)
EPI587635 A/chicken/Iowa/04-20/2015 (A/H5N2) segment 6 (NA) 2599.4 0.000000e+00 1409/1410 (99%)
EPI620410 A/turkey/Iowa/11762-1/2015 (A/H5N2) segment 6 (NA) 2582.7 0.000000e+00 1406/1410 (99%)
EPI590742 A/turkey/Minnesota/9845-4/2015 (A/H5N2) segment 6 (NA) 2582.7 0.000000e+00 1406/1410 (99%)
EPI590687 A/turkey/Minnesota/9892-2/2015 (A/H5N2) segment 6 (NA) 2582.7 0.000000e+00 1406/1410 (99%)
EPI590721 A/turkey/Missouri/7458-1/2015 (A/H5N2) segment 6 (NA) 2577.2 0.000000e+00 1405/1410 (99%)
EPI590714 A/turkey/Minnesota/7172-1/2015 (A/H5N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI586544 A/chicken/BC/FAV23/2014 (A/H5N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI586511 A/poultry/BC/FAV19/2014 (A/H5N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI584081 A/turkey/BC/FAV14/2014 (A/H5N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI590735 A/chicken/Kansas/8395-3/2015 (A/H5N2) segment 6 (NA) 2566.1 0.000000e+00 1403/1410 (99%)
EPI590728 A/turkey/Arkansas/7791-1/2015 (A/H5N2) segment 6 (NA) 2566.1 0.000000e+00 1403/1410 (99%)
EPI590701 A/chicken/Oregon/A01819044/2015 (A/H5N2) segment 6 (NA) 2566.1 0.000000e+00 1403/1410 (99%)
EPI586520 A/chicken/BC/FAV20/2014 (A/H5N2) segment 6 (NA) 2566.1 0.000000e+00 1403/1410 (99%)
EPI585094 A/pheasant/Washington/3147-2/2015 (A/H5N2) segment 6 (NA) 2566.1 0.000000e+00 1403/1410 (99%)
EPI573282 A/turkey/Washington/61-22/2014 (A/H5N2) segment 6 (NA) 2566.1 0.000000e+00 1403/1410 (99%)
EPI586552 A/chicken/BC/FAV24/2014 (A/H5N2) segment 6 (NA) 2560.6 0.000000e+00 1402/1410 (99%)
EPI586528 A/chicken/BC/FAV21/2014 (A/H5N2) segment 6 (NA) 2560.6 0.000000e+00 1402/1410 (99%)
EPI586495 A/poultry/BC/FAV15/2014 (A/H5N2) segment 6 (NA) 2560.6 0.000000e+00 1402/1410 (99%)
EPI573278 A/domestic duck/Washington/61-16/2014 (A/H5N2) segment 6 (NA) 2560.6 0.000000e+00 1402/1410 (99%)
EPI573273 A/chicken/Washington/61-9/2014 (A/H5N2) segment 6 (NA) 2560.6 0.000000e+00 1402/1410 (99%)
EPI569385 A/Northern pintail/Washington/40964/2014 (A/H5N2) segment 6 (NA) 2560.6 0.000000e+00 1402/1410 (99%)
EPI586536 A/chicken/BC/FAV22/2014 (A/H5N2) segment 6 (NA) 2556.9 0.000000e+00 1401/1410 (99%)
EPI586560 A/chicken/BC/FAV25/2014 (A/H5N2) segment 6 (NA) 2555.0 0.000000e+00 1401/1410 (99%)
EPI586503 A/poultry/BC/FAV17/2014 (A/H5N2) segment 6 (NA) 2555.0 0.000000e+00 1401/1410 (99%)
EPI576479 A/chicken/BC/FAV9/2014 (A/H5N2) segment 6 (NA) 2555.0 0.000000e+00 1401/1410 (99%)
EPI576472 A/chicken/BC/FAV8/2014 (A/H5N2) segment 6 (NA) 2555.0 0.000000e+00 1401/1410 (99%)
EPI573300 A/turkey/BC/FAV10/2014 (A/H5N2) segment 6 (NA) 2555.0 0.000000e+00 1401/1410 (99%)
EPI590694 A/chicken/Washington/3490-18/2015 (A/H5N2) segment 6 (NA) 2549.5 0.000000e+00 1400/1410 (99%)
EPI418959 A/American green-winged teal/Wisconsin/10OS3127/2010 (A/H5N2) segment 6 (NA) 2477.5 0.000000e+00 1387/1410 (98%)
EPI512135 A/northern pintail/Mississippi/12OS420/2012 (A/H0) segment 6 (NA) 2471.9 0.000000e+00 1386/1410 (98%)
EPI450007 A/blue-winged teal/Louisiana/AI09-5234/2009 (A/H11N2) segment 6 (NA) 2471.9 0.000000e+00 1386/1410 (98%)
EPI418609 A/American green-winged teal/Mississippi/11OS98/2011 (A/H0) segment 6 (NA) 2460.9 0.000000e+00 1384/1410 (98%)
EPI332004 A/blue-winged teal/Guatemala/CIP049-10/2009 (A/H11N2) segment 6 (NA) 2460.9 0.000000e+00 1384/1410 (98%)
EPI331988 A/blue-winged teal/Guatemala/CIP049-03/2009 (A/H11N2) segment 6 (NA) 2460.9 0.000000e+00 1384/1410 (98%)
EPI512150 A/northern shoveler/Mississippi/12OS456/2012 (A/H14N2) segment 6 (NA) 2455.3 0.000000e+00 1383/1410 (98%)
EPI420145 A/northern shoveler/California/3676/2010 (A/H8N2) segment 6 (NA) 2455.3 0.000000e+00 1383/1410 (98%)
EPI419288 A/American wigeon/Iowa/10OS2748/2010 (A/H2N2) segment 6 (NA) 2455.3 0.000000e+00 1383/1410 (98%)
EPI418807 A/American green-winged teal/Illinois/10OS3589/2010 (A/H6N2) segment 6 (NA) 2455.3 0.000000e+00 1383/1410 (98%)
EPI418497 A/blue-winged teal/Illinois/10OS3610/2010 (A/H6N2) segment 6 (NA) 2455.3 0.000000e+00 1383/1410 (98%)
EPI418472 A/mallard/Illinois/10OS3245/2010 (A/H0) segment 6 (NA) 2455.3 0.000000e+00 1383/1410 (98%)
EPI387177 A/mallard/California/2396/2010 (A/H5N2) segment 6 (NA) 2455.3 0.000000e+00 1383/1410 (98%)
EPI333605 A/American green-winged teal/Mississippi/404/2010 (A/H0) segment 6 (NA) 2455.3 0.000000e+00 1383/1410 (98%)
EPI331996 A/blue-winged teal/Guatemala/CIP049-11/2009 (A/H11N2) segment 6 (NA) 2455.3 0.000000e+00 1383/1410 (98%)
EPI512531 A/gadwall/Mississippi/11OS6084/2011 (A/H11N2) segment 6 (NA) 2438.7 0.000000e+00 1380/1410 (97%)
EPI512524 A/northern shoveler/Mississippi/11OS6077/2011 (A/H11N2) segment 6 (NA) 2438.7 0.000000e+00 1380/1410 (97%)
EPI418721 A/mallard/Wisconsin/10OS2538/2010 (A/H3N2) segment 6 (NA) 2438.7 0.000000e+00 1380/1410 (97%)
EPI512591 A/northern shoveler/Mississippi/11OS5875/2011 (A/H5N2) segment 6 (NA) 2433.2 0.000000e+00 1379/1410 (97%)
EPI419077 A/mallard/Wisconsin/10OS3066/2010 (A/H6N2) segment 6 (NA) 2427.6 0.000000e+00 1378/1410 (97%)
EPI616345 A/American green-winged teal/Mississippi/12OS5061/2012 (A/H5N2) segment 6 (NA) 2422.1 0.000000e+00 1377/1410 (97%)
EPI419118 A/mallard/Mississippi/10OS4593/2010 (A/H1N2) segment 6 (NA) 2422.1 0.000000e+00 1377/1410 (97%)
EPI280744 A/avian/Missouri/466554-6/2006 (A/H5N2) segment 6 (NA) 2422.1 0.000000e+00 1377/1410 (97%)
EPI221406 A/American green-winged teal/California/HKWF609/2007 (A/H5N2) segment 6 (NA) 2422.1 0.000000e+00 1377/1410 (97%)
EPI419654 A/gadwall/Missouri/10MO0280/2010 (A/H5N2) segment 6 (NA) 2416.5 0.000000e+00 1377/1411 (97%)
EPI419647 A/mallard/Missouri/10MO0253/2010 (A/H1N2) segment 6 (NA) 2416.5 0.000000e+00 1376/1410 (97%)
EPI419111 A/gadwall/Mississippi/10OS4531/2010 (A/H6N2) segment 6 (NA) 2416.5 0.000000e+00 1376/1410 (97%)
EPI419138 A/northern shoveler/Mississippi/10OS4526/2010 (A/H6N2) segment 6 (NA) 2411.0 0.000000e+00 1375/1410 (97%)
EPI413459 A/mallard/Ohio/11OS2213/2011 (A/H11N2) segment 6 (NA) 2411.0 0.000000e+00 1375/1410 (97%)
EPI328608 A/northern shoveler/California/8855/2008 (A/H5N2) segment 6 (NA) 2411.0 0.000000e+00 1375/1410 (97%)
EPI513011 A/northern pintail/Wisconsin/11OS4111/2011 (A/H6N2) segment 6 (NA) 2405.5 0.000000e+00 1375/1411 (97%)
EPI328639 A/mallard/California/11100/2008 (A/H11N2) segment 6 (NA) 2405.5 0.000000e+00 1374/1410 (97%)
EPI328582 A/northern shoveler/California/9680/2008 (A/H6N2) segment 6 (NA) 2405.5 0.000000e+00 1374/1410 (97%)
EPI328476 A/green-winged teal/California/11285/2008 (A/H0) segment 6 (NA) 2405.5 0.000000e+00 1374/1410 (97%)
EPI328156 A/mallard/California/11353/2008 (A/H10N2) segment 6 (NA) 2405.5 0.000000e+00 1374/1410 (97%)
EPI328489 A/green-winged teal/California/7972/2008 (A/H6N2) segment 6 (NA) 2399.9 0.000000e+00 1373/1410 (97%)
EPI328108 A/northern shoveler/California/9017/2008 (A/H11N2) segment 6 (NA) 2399.9 0.000000e+00 1373/1410 (97%)
EPI419755 A/northern shoveler/California/2815/2011 (A/H5N2) segment 6 (NA) 2394.4 0.000000e+00 1372/1410 (97%)
EPI418643 A/mallard/Illinois/10OS3249/2010 (A/H11N2) segment 6 (NA) 2394.4 0.000000e+00 1372/1410 (97%)
EPI327900 A/northern pintail/California/6791/2008 (A/H11N2) segment 6 (NA) 2394.4 0.000000e+00 1372/1410 (97%)
EPI285601 A/wild bird/Wisconsin/433163-1/2006 (A/H5N2) segment 6 (NA) 2394.4 0.000000e+00 1372/1410 (97%)
EPI420032 A/mallard/California/2571V/2011 (A/H0) segment 6 (NA) 2388.8 0.000000e+00 1371/1410 (97%)
EPI420024 A/mallard/California/2571P/2011 (A/H11N2) segment 6 (NA) 2388.8 0.000000e+00 1371/1410 (97%)
EPI334262 A/mallard/Iowa/3195/2009 (A/H0) segment 6 (NA) 2388.8 0.000000e+00 1372/1411 (97%)
EPI442430 A/brant/Alaska/44332-426/2007 (A/H10N2) segment 6 (NA) 2377.8 0.000000e+00 1369/1410 (97%)
EPI285602 A/wild bird/Wisconsin/439436-2/2006 (A/H5N2) segment 6 (NA) 2377.8 0.000000e+00 1369/1410 (97%)
EPI285592 A/wild bird/Wisconsin/439436/2006 (A/H5N2) segment 6 (NA) 2377.8 0.000000e+00 1369/1410 (97%)
EPI328316 A/mallard/California/6420/2008 (A/H6N2) segment 6 (NA) 2372.2 0.000000e+00 1369/1411 (97%)
EPI299469 A/American green-winged teal/Wisconsin/08OS2291/2008 (A/H3N2) segment 6 (NA) 2372.2 0.000000e+00 1368/1410 (97%)
EPI299389 A/gadwall/Wisconsin/08OS2293/2008 (A/H3N2) segment 6 (NA) 2372.2 0.000000e+00 1368/1410 (97%)
EPI299381 A/American green-winged teal/Wisconsin/08OS2292/2008 (A/H3N2) segment 6 (NA) 2372.2 0.000000e+00 1368/1410 (97%)
EPI280848 A/wild bird/Minnesota/460613-12/2006 (A/H5N2) segment 6 (NA) 2372.2 0.000000e+00 1368/1410 (97%)
EPI449517 A/mallard/Minnesota/Sg-00847/2008 (A/H0) segment 6 (NA) 2366.7 0.000000e+00 1367/1410 (96%)
EPI413390 A/mallard/Ohio/10OS1470/2010 (A/H3N2) segment 6 (NA) 2366.7 0.000000e+00 1367/1410 (96%)
EPI413383 A/mallard/Ohio/10OS1469/2010 (A/H3N2) segment 6 (NA) 2366.7 0.000000e+00 1367/1410 (96%)
EPI413369 A/mallard/Ohio/10OS1467/2010 (A/H3N2) segment 6 (NA) 2366.7 0.000000e+00 1367/1410 (96%)
EPI285597 A/mallard/NV/450206/2006 (A/H5N2) segment 6 (NA) 2366.7 0.000000e+00 1367/1410 (96%)
EPI285595 A/mallard/NV/449567-4/2006 (A/H5N2) segment 6 (NA) 2366.7 0.000000e+00 1367/1410 (96%)
EPI285594 A/mallard/NV/449567-2/2006 (A/H5N2) segment 6 (NA) 2366.7 0.000000e+00 1367/1410 (96%)
EPI280656 A/mallard/Arkansas/473507-9/2006 (A/H5N2) segment 6 (NA) 2366.7 0.000000e+00 1367/1410 (96%)
EPI280544 A/mallard/Nevada/450206-4/2006 (A/H5N2) segment 6 (NA) 2366.7 0.000000e+00 1367/1410 (96%)
EPI222394 A/northern pintail/Saskatchewan/22910/2007 (A/H3N2) segment 6 (NA) 2366.7 0.000000e+00 1367/1410 (96%)
EPI187901 A/mallard/Minnesota/Sg-00129/2007 (A/H6N2) segment 6 (NA) 2363.0 0.000000e+00 1359/1399 (97%)
EPI449695 A/green-winged teal/Minnesota/Sg-01073/2008 (A/H6N2) segment 6 (NA) 2361.1 0.000000e+00 1366/1410 (96%)
EPI449653 A/mallard/Minnesota/Sg-01040/2008 (A/H3N2) segment 6 (NA) 2361.1 0.000000e+00 1366/1410 (96%)
EPI285593 A/mallard/NV/449567-1/2006 (A/H5N2) segment 6 (NA) 2361.1 0.000000e+00 1366/1410 (96%)
EPI280552 A/mallard/Nevada/449567-3/2006 (A/H5N2) segment 6 (NA) 2361.1 0.000000e+00 1366/1410 (96%)
EPI76383 A/mallard/Maryland/182/2006 (A/H5N2) segment 6 (NA) 2361.1 0.000000e+00 1366/1410 (96%)
EPI512972 A/blue-winged teal/Wisconsin/11OS3052/2011 (A/H3N2) segment 6 (NA) 2355.6 0.000000e+00 1365/1410 (96%)
EPI512920 A/mallard/Wisconsin/11OS3106/2011 (A/H3N2) segment 6 (NA) 2355.6 0.000000e+00 1365/1410 (96%)
EPI512832 A/mallard/Wisconsin/11OS3491/2011 (A/H4N2) segment 6 (NA) 2355.6 0.000000e+00 1365/1410 (96%)
EPI512507 A/mallard/Wisconsin/11OS3171/2011 (A/H3N2) segment 6 (NA) 2355.6 0.000000e+00 1365/1410 (96%)
EPI419063 A/American green-winged teal/Wisconsin/10OS2955/2010 (A/H5N2) segment 6 (NA) 2355.6 0.000000e+00 1365/1410 (96%)
EPI334137 A/blue-winged teal/Wisconsin/3060/2009 (A/H3N2) segment 6 (NA) 2355.6 0.000000e+00 1365/1410 (96%)
EPI299648 A/American green-winged teal/Illinois/08OS2311/2008 (A/H0) segment 6 (NA) 2355.6 0.000000e+00 1366/1411 (96%)
EPI299477 A/gadwall/Wisconsin/08OS2296/2008 (A/H6N2) segment 6 (NA) 2355.6 0.000000e+00 1366/1411 (96%)
EPI285598 A/mallard/NV/453350-8/2006 (A/H5N2) segment 6 (NA) 2355.6 0.000000e+00 1365/1410 (96%)
EPI513071 A/American green-winged teal/Wisconsin/11OS3580/2011 (A/H12N2) segment 6 (NA) 2350.1 0.000000e+00 1364/1410 (96%)
EPI513025 A/blue-winged teal/Iowa/44555-551/2011 (A/H3N2) segment 6 (NA) 2350.1 0.000000e+00 1364/1410 (96%)
EPI512986 A/mallard/Wisconsin/11OS3079/2011 (A/H3N2) segment 6 (NA) 2350.1 0.000000e+00 1364/1410 (96%)
EPI455888 A/mallard/New Jersey/Sg-00884/2008 (A/H11N2) segment 6 (NA) 2350.1 0.000000e+00 1364/1410 (96%)
EPI419090 A/mallard/Wisconsin/10OS3067/2010 (A/H4N2) segment 6 (NA) 2350.1 0.000000e+00 1364/1410 (96%)
EPI413404 A/mallard/Michigan/10OS1497/2010 (A/H3N2) segment 6 (NA) 2350.1 0.000000e+00 1364/1410 (96%)
EPI285578 A/northern pintail/Wisconsin/462764/2006 (A/H5N2) segment 6 (NA) 2350.1 0.000000e+00 1364/1410 (96%)
EPI220636 A/mallard/South Dakota/Sg-00457/2008 (A/H4N2) segment 6 (NA) 2348.2 0.000000e+00 1357/1400 (96%)
EPI513141 A/American green-winged teal/Wisconsin/11OS3069/2011 (A/H0) segment 6 (NA) 2344.5 0.000000e+00 1363/1410 (96%)
EPI513105 A/mallard/Wisconsin/11OS4492/2011 (A/H4N2) segment 6 (NA) 2344.5 0.000000e+00 1363/1410 (96%)
EPI513085 A/mallard/Wisconsin/11OS4104/2011 (A/H1N2) segment 6 (NA) 2344.5 0.000000e+00 1363/1410 (96%)
EPI512955 A/greater scaup/Wisconsin/11OS5760/2011 (A/H10N2) segment 6 (NA) 2344.5 0.000000e+00 1363/1410 (96%)
EPI448307 A/mallard/Minnesota/346250/2000 (A/H5N2) segment 6 (NA) 2344.5 0.000000e+00 1364/1411 (96%)
EPI419070 A/mallard/Wisconsin/10OS3051/2010 (A/H4N2) segment 6 (NA) 2344.5 0.000000e+00 1363/1410 (96%)
EPI418714 A/mallard/Wisconsin/10OS2524/2010 (A/H11N2) segment 6 (NA) 2344.5 0.000000e+00 1363/1410 (96%)
EPI327355 A/American black duck/Newfoundland and Labrador/26516/2007 (A/H3N2) segment 6 (NA) 2344.5 0.000000e+00 1363/1410 (96%)
EPI292632 A/mallard/Washington/44338-120/2007 (A/H6N2) segment 6 (NA) 2344.5 0.000000e+00 1363/1410 (96%)
EPI159142 A/mallard/MN/113/2000 (A/H5N2) segment 6 (NA) 2344.5 0.000000e+00 1364/1411 (96%)
EPI513133 A/mallard/Wisconsin/11OS4085/2011 (A/H0) segment 6 (NA) 2339.0 0.000000e+00 1362/1410 (96%)
EPI512993 A/mallard/Wisconsin/11OS3092/2011 (A/H3N2) segment 6 (NA) 2339.0 0.000000e+00 1362/1410 (96%)
EPI165988 A/mallard/MN/1/2000 (A/H5N2) segment 6 (NA) 2339.0 0.000000e+00 1363/1411 (96%)
EPI512941 A/mallard/Illinois/11OS4311/2011 (A/H4N2) segment 6 (NA) 2333.4 0.000000e+00 1361/1410 (96%)
EPI455945 A/mallard/New Jersey/Sg-00942/2008 (A/H0) segment 6 (NA) 2333.4 0.000000e+00 1361/1410 (96%)
EPI448776 A/mallard/Minnesota/355779/2000 (A/H5N2) segment 6 (NA) 2333.4 0.000000e+00 1362/1411 (96%)
EPI292624 A/mallard/Washington/44338-112/2007 (A/H6N2) segment 6 (NA) 2333.4 0.000000e+00 1362/1411 (96%)
EPI513093 A/long-tailed duck/Wisconsin/11OS4599/2011 (A/H4N2) segment 6 (NA) 2327.9 0.000000e+00 1360/1410 (96%)
EPI328100 A/northern shoveler/California/9187/2008 (A/H6N2) segment 6 (NA) 2327.9 0.000000e+00 1360/1410 (96%)
EPI234273 A/blue-winged teal/Minnesota/Sg-00797/2008 (A/H3N2) segment 6 (NA) 2327.9 0.000000e+00 1346/1389 (96%)
EPI187967 A/mallard/Minnesota/Sg-00187/2007 (A/H11N2) segment 6 (NA) 2326.1 0.000000e+00 1337/1376 (97%)
EPI486103 A/northern pintail/California/1865/2009 (A/H9N2) segment 6 (NA) 2322.4 0.000000e+00 1359/1410 (96%)
EPI391942 A/blue-winged teal/New Brunswick/03756/2009 (A/H4N2) segment 6 (NA) 2316.8 0.000000e+00 1358/1410 (96%)
EPI290887 A/rock dove/Oregon/20547-004/2007 (A/H1N2) segment 6 (NA) 2316.8 0.000000e+00 1358/1410 (96%)
EPI290879 A/rock dove/Oregon/20547-003/2007 (A/H1N2) segment 6 (NA) 2316.8 0.000000e+00 1358/1410 (96%)
EPI327964 A/green-winged teal/California/8326/2008 (A/H1N2) segment 6 (NA) 2311.3 0.000000e+00 1357/1410 (96%)
EPI18635 A/turkey/CA/D0208652-C/02 (A/H5N2) segment 6 (NA) 2311.3 0.000000e+00 1358/1411 (96%)
EPI33729 A/blue-winged teal/Ohio/908/2002 (A/H3N2) segment 6 (NA) 2305.7 0.000000e+00 1357/1411 (96%)
EPI447997 A/blue-winged teal/Texas/AI09-6182/2009 (A/H6N2) segment 6 (NA) 2294.7 0.000000e+00 1354/1410 (96%)
EPI327812 A/mallard/California/5250/2009 (A/H5N2) segment 6 (NA) 2294.7 0.000000e+00 1354/1410 (96%)
EPI327772 A/mallard/California/5495/2009 (A/H4N2) segment 6 (NA) 2294.7 0.000000e+00 1354/1410 (96%)
EPI327756 A/mallard/California/5149/2009 (A/H5N2) segment 6 (NA) 2294.7 0.000000e+00 1354/1410 (96%)
EPI456563 A/mallard/Arkansas/AI09-5649/2009 (A/H9N2) segment 6 (NA) 2289.1 0.000000e+00 1353/1410 (95%)
EPI328252 A/mallard/California/8035/2008 (A/H5N2) segment 6 (NA) 2289.1 0.000000e+00 1353/1410 (95%)
EPI327820 A/mallard/California/5222/2009 (A/H5N2) segment 6 (NA) 2289.1 0.000000e+00 1353/1410 (95%)
EPI327796 A/mallard/California/5276/2009 (A/H5N2) segment 6 (NA) 2289.1 0.000000e+00 1353/1410 (95%)
EPI327780 A/mallard/California/5296/2009 (A/H5N2) segment 6 (NA) 2289.1 0.000000e+00 1353/1410 (95%)
EPI327748 A/mallard/California/5174/2009 (A/H5N2) segment 6 (NA) 2289.1 0.000000e+00 1353/1410 (95%)
EPI327732 A/mallard/California/5205/2009 (A/H0) segment 6 (NA) 2289.1 0.000000e+00 1353/1410 (95%)
EPI327716 A/mallard/California/5319/2009 (A/H5N2) segment 6 (NA) 2289.1 0.000000e+00 1353/1410 (95%)
EPI327692 A/mallard/California/5386/2009 (A/H5N2) segment 6 (NA) 2289.1 0.000000e+00 1353/1410 (95%)
EPI327676 A/mallard/California/5191/2009 (A/H5N2) segment 6 (NA) 2289.1 0.000000e+00 1353/1410 (95%)
EPI162405 A/mallard/MD/185/2003 (A/H5N2) segment 6 (NA) 2289.1 0.000000e+00 1354/1411 (95%)
EPI387352 A/mallard/California/5197/2009 (A/H5N2) segment 6 (NA) 2283.6 0.000000e+00 1352/1410 (95%)
EPI327828 A/mallard/California/5212/2009 (A/H5N2) segment 6 (NA) 2283.6 0.000000e+00 1352/1410 (95%)
EPI327764 A/mallard/California/5502/2009 (A/H5N2) segment 6 (NA) 2283.6 0.000000e+00 1352/1410 (95%)
EPI327740 A/mallard/California/5192/2009 (A/H4N2) segment 6 (NA) 2283.6 0.000000e+00 1353/1411 (95%)
EPI327700 A/mallard/California/5359/2009 (A/H5N2) segment 6 (NA) 2283.6 0.000000e+00 1352/1410 (95%)
EPI280488 A/wild bird/Minnesota/459254-5/2006 (A/H5N2) segment 6 (NA) 2283.6 0.000000e+00 1353/1411 (95%)
EPI59460 A/environment/Ohio/1001/2005 (A/H3N2) segment 6 (NA) 2283.6 0.000000e+00 1353/1411 (95%)
EPI45682 A/gadwall/Ohio/37/1999 (A/H6N2) segment 6 (NA) 2283.6 0.000000e+00 1353/1411 (95%)
EPI414478 A/mallard/Interior Alaska/10BM02980R0/2010 (A/H9N2) segment 6 (NA) 2278.0 0.000000e+00 1351/1410 (95%)
EPI395064 A/northern pintail/Interior Alaska/10BM14807R2/2010 (A/H9N2) segment 6 (NA) 2278.0 0.000000e+00 1351/1410 (95%)
EPI395050 A/American green-winged teal/Interior Alaska/10BM16586R0/2010 (A/H0) segment 6 (NA) 2278.0 0.000000e+00 1351/1410 (95%)
EPI387219 A/American wigeon/California/3180/2010 (A/H5N2) segment 6 (NA) 2278.0 0.000000e+00 1351/1410 (95%)
EPI327684 A/mallard/California/5491/2009 (A/H5N2) segment 6 (NA) 2278.0 0.000000e+00 1351/1410 (95%)
EPI280856 A/waterfowl/Minnesota/459675/2006 (A/H5N2) segment 6 (NA) 2278.0 0.000000e+00 1352/1411 (95%)
EPI171087 A/environment/New York/11653-1/2005 (A/H5N2) segment 6 (NA) 2278.0 0.000000e+00 1352/1411 (95%)
EPI59840 A/green-winged teal/Ohio/1747/2005 (A/H11N2) segment 6 (NA) 2278.0 0.000000e+00 1352/1411 (95%)
EPI187903 A/green-winged teal/Minnesota/Sg-00131/2007 (A/H3N2) segment 6 (NA) 2274.3 0.000000e+00 1344/1400 (96%)
EPI645362 A/American green-winged teal/Ohio/13OS1769/2013 (A/H7N2) segment 6 (NA) 2272.5 0.000000e+00 1351/1411 (95%)
EPI595341 A/mallard/Maryland/06OS196/2006 (A/H6N2) segment 6 (NA) 2272.5 0.000000e+00 1351/1411 (95%)
EPI459696 A/northern shoveler/California/2696/2011 (A/H14N2) segment 6 (NA) 2272.5 0.000000e+00 1350/1410 (95%)
EPI420246 A/northern pintail/California/2548/2010 (A/H11N2) segment 6 (NA) 2272.5 0.000000e+00 1350/1410 (95%)
EPI419476 A/northern shoveler/Arkansas/11OS386/2011 (A/H9N2) segment 6 (NA) 2272.5 0.000000e+00 1350/1410 (95%)
EPI395071 A/northern shoveler/Interior Alaska/10BM16764R0/2010 (A/H9N2) segment 6 (NA) 2272.5 0.000000e+00 1350/1410 (95%)
EPI387226 A/northern shoveler/California/3183/2010 (A/H11) segment 6 (NA) 2272.5 0.000000e+00 1351/1411 (95%)
EPI280792 A/green winged teal/Ohio/464069/2006 (A/H5N2) segment 6 (NA) 2272.5 0.000000e+00 1351/1411 (95%)
EPI280776 A/mallard/Indiana/465297-2/2006 (A/H5N2) segment 6 (NA) 2272.5 0.000000e+00 1352/1412 (95%)
EPI227357 A/mallard/Quebec/16566/2005 (A/H11N2) segment 6 (NA) 2272.5 0.000000e+00 1351/1411 (95%)
EPI526285 A/blue-winged teal/Ohio/13OS1831/2013 (A/H3N2) segment 6 (NA) 2267.0 0.000000e+00 1350/1411 (95%)
EPI476363 A/blue-winged teal/Canada/3296/2011 (A/H11N2) segment 6 (NA) 2267.0 0.000000e+00 1349/1410 (95%)
EPI454861 A/American black duck/North Carolina/1321373/2004 (A/H3N2) segment 6 (NA) 2267.0 0.000000e+00 1350/1411 (95%)
EPI405105 A/American black duck/New Brunswick/02651/2007 (A/H3N2) segment 6 (NA) 2267.0 0.000000e+00 1350/1411 (95%)
EPI404704 A/American black duck/New Brunswick/02650/2007 (A/H3N2) segment 6 (NA) 2267.0 0.000000e+00 1350/1411 (95%)
EPI187907 A/northern shoveler/Minnesota/Sg-00138/2007 (A/H3N2) segment 6 (NA) 2267.0 0.000000e+00 1345/1403 (95%)
EPI173525 A/mallard/Maryland/897/2004 (A/H5N2) segment 6 (NA) 2267.0 0.000000e+00 1350/1411 (95%)
EPI55261 A/environment/Ohio/994/2005 (A/H3N2) segment 6 (NA) 2267.0 0.000000e+00 1350/1411 (95%)
EPI187902 A/green-winged teal/Minnesota/Sg-00130/2007 (A/H3N2) segment 6 (NA) 2263.3 0.000000e+00 1338/1394 (95%)
EPI596185 A/mallard/Maryland/13OS2946/2013 (A/H5N2) segment 6 (NA) 2261.4 0.000000e+00 1349/1411 (95%)
EPI280688 A/mallard/Kentucky/472048-2/2006 (A/H5N2) segment 6 (NA) 2261.4 0.000000e+00 1349/1411 (95%)
EPI526321 A/American green-winged teal/Ohio/13OS2056/2013 (A/H3N2) segment 6 (NA) 2255.9 0.000000e+00 1348/1411 (95%)
EPI510556 A/mallard/QC/2323-25/2006 (A/H5N2) segment 6 (NA) 2255.9 0.000000e+00 1347/1410 (95%)
EPI327469 A/unknown/New York/59316/2006 (A/H5N2) segment 6 (NA) 2255.9 0.000000e+00 1349/1412 (95%)
EPI280752 A/mallard/Michigan/466547-5/2006 (A/H5N2) segment 6 (NA) 2255.9 0.000000e+00 1348/1411 (95%)
EPI255437 A/chicken/New York/439235/2006 (A/H5N2) segment 6 (NA) 2255.9 0.000000e+00 1348/1411 (95%)
EPI167456 A/Muscovy duck/New York/62095-1/2006 (A/H5N2) segment 6 (NA) 2255.9 0.000000e+00 1348/1411 (95%)
EPI455908 A/mallard/New Jersey/Sg-00893/2008 (A/H3N2) segment 6 (NA) 2250.3 0.000000e+00 1347/1411 (95%)
EPI455895 A/mallard/New Jersey/Sg-00888/2008 (A/H3N2) segment 6 (NA) 2250.3 0.000000e+00 1347/1411 (95%)
EPI334336 A/mallard/Wisconsin/2543/2009 (A/H3N2) segment 6 (NA) 2250.3 0.000000e+00 1347/1411 (95%)
EPI280496 A/green winged teal/Delaware/458672-5/2006 (A/H5N2) segment 6 (NA) 2250.3 0.000000e+00 1347/1411 (95%)
EPI275225 A/thick-billed murre/Alaska/44085-155/2006 (A/H9N2) segment 6 (NA) 2250.3 0.000000e+00 1348/1412 (95%)
EPI255451 A/duck/New York/445743/2006 (A/H5N2) segment 6 (NA) 2250.3 0.000000e+00 1347/1411 (95%)
EPI177177 A/unknown/New York/78436/2006 (A/H5N2) segment 6 (NA) 2250.3 0.000000e+00 1347/1411 (95%)
EPI275226 A/thick-billed murre/Alaska/44145-186/2006 (A/H9N2) segment 6 (NA) 2246.6 0.000000e+00 1347/1412 (95%)
EPI595369 A/mallard/Maryland/06OS2460/2006 (A/H2N2) segment 6 (NA) 2244.8 0.000000e+00 1346/1411 (95%)
EPI512927 A/mallard/Illinois/11OS4121/2011 (A/H6N2) segment 6 (NA) 2244.8 0.000000e+00 1346/1411 (95%)
EPI419748 A/northern shoveler/California/2810/2011 (A/H11N2) segment 6 (NA) 2244.8 0.000000e+00 1345/1410 (95%)
EPI285567 A/chicken/Pennsylvania/446080-7/2006 (A/H5N2) segment 6 (NA) 2244.8 0.000000e+00 1346/1411 (95%)
EPI280840 A/mallard/Oregon/461067-2/2006 (A/H5N2) segment 6 (NA) 2244.8 0.000000e+00 1347/1412 (95%)
EPI280712 A/green winged teal/Ohio/468160/2006 (A/H5N2) segment 6 (NA) 2244.8 0.000000e+00 1346/1411 (95%)
EPI280640 A/Canada goose/New York/475813-2/2007 (A/H5N2) segment 6 (NA) 2244.8 0.000000e+00 1347/1412 (95%)
EPI280576 A/duck/Pennsylvania/446080-6/2006 (A/H5N2) segment 6 (NA) 2244.8 0.000000e+00 1346/1411 (95%)
EPI280568 A/duck/Pennsylvania/446080-7/2006 (A/H5N2) segment 6 (NA) 2244.8 0.000000e+00 1346/1411 (95%)
EPI229366 A/chicken/PA/298101-4/2004 (A/H2N2) segment 6 (NA) 2244.8 0.000000e+00 1347/1412 (95%)
EPI178104 A/northern pintail/California/44242-758/2006 (A/H5N2) segment 6 (NA) 2244.8 0.000000e+00 1303/1347 (96%)
EPI60087 A/mallard/Maryland/631/2005 (A/H3N2) segment 6 (NA) 2244.8 0.000000e+00 1348/1413 (95%)
EPI645432 A/northern pintail/Wisconsin/13OS2778/2013 (A/H6N2) segment 6 (NA) 2239.3 0.000000e+00 1345/1411 (95%)
EPI486682 A/mallard/California/3070/2012 (A/H11N2) segment 6 (NA) 2239.3 0.000000e+00 1344/1410 (95%)
EPI449100 A/common murre/Newfoundland/AB341/2011 (A/H1N2) segment 6 (NA) 2239.3 0.000000e+00 1345/1411 (95%)
EPI290537 A/northern shoveler/Washington/44249-604/2006 (A/H9N2) segment 6 (NA) 2239.3 0.000000e+00 1346/1412 (95%)
EPI285582 A/Northern shoveler/Washington/467923/2006 (A/H5N2) segment 6 (NA) 2239.3 0.000000e+00 1346/1412 (95%)
EPI63472 A/mallard/Maryland/712/2005 (A/H3N2) segment 6 (NA) 2239.3 0.000000e+00 1347/1413 (95%)
EPI60505 A/mallard/Maryland/615/2005 (A/H3N2) segment 6 (NA) 2239.3 0.000000e+00 1347/1413 (95%)
EPI60068 A/mallard/Maryland/691/2005 (A/H3N2) segment 6 (NA) 2239.3 0.000000e+00 1347/1413 (95%)
EPI60049 A/mallard/Maryland/681/2005 (A/H3N2) segment 6 (NA) 2239.3 0.000000e+00 1347/1413 (95%)
EPI290593 A/northern shoveler/Washington/44249-645/2006 (A/H5N2) segment 6 (NA) 2233.7 0.000000e+00 1345/1412 (95%)
EPI280696 A/northern pintail/California/469993/2006 (A/H5N2) segment 6 (NA) 2233.7 0.000000e+00 1345/1412 (95%)
EPI227317 A/mallard.Maryland/708/2005 (A/H3N2) segment 6 (NA) 2233.7 0.000000e+00 1346/1413 (95%)
EPI60524 A/mallard/Maryland/710/2005 (A/H3N2) segment 6 (NA) 2233.7 0.000000e+00 1346/1413 (95%)
EPI615682 A/duck/Peru-PuV196/2009 (A/H10N2) segment 6 (NA) 2230.0 0.000000e+00 1315/1369 (96%)
EPI449126 A/common murre/Newfoundland/AB364/2011 (A/H1N2) segment 6 (NA) 2228.2 0.000000e+00 1344/1412 (95%)
EPI290681 A/northern shoveler/Washington/44249-675/2006 (A/H10N2) segment 6 (NA) 2228.2 0.000000e+00 1344/1412 (95%)
EPI512605 A/American widgeon/Mississippi/11OS6073/2011 (A/H6N2) segment 6 (NA) 2222.6 0.000000e+00 1341/1410 (95%)
EPI280704 A/northern pintail/Utah/469648/2006 (A/H5N2) segment 6 (NA) 2222.6 0.000000e+00 1343/1412 (95%)
EPI154587 A/northern shoveler/California/HKWF268/2007 (A/H6N2) segment 6 (NA) 2211.6 0.000000e+00 1341/1412 (94%)
EPI2451 A/duck/Hokkaido/5/1977 (A/H3N2) segment 6 (NA) 2211.6 0.000000e+00 1339/1410 (94%)
EPI442476 A/tundra swan/Alaska/44049-168/2006 (A/H5N2) segment 6 (NA) 2206.0 0.000000e+00 1339/1411 (94%)
EPI442449 A/greater white-fronted goose/Alaska/44065-031/2006 (A/H5N2) segment 6 (NA) 2206.0 0.000000e+00 1339/1411 (94%)
EPI442447 A/greater white-fronted goose/Alaska/44049-046/2006 (A/H5N2) segment 6 (NA) 2206.0 0.000000e+00 1339/1411 (94%)
EPI290823 A/northern shoveler/California/44363-062/2007 (A/H9N2) segment 6 (NA) 2206.0 0.000000e+00 1340/1412 (94%)
EPI280600 A/white front goose/Alaska/477003/2007 (A/H5N2) segment 6 (NA) 2206.0 0.000000e+00 1339/1411 (94%)
EPI280584 A/tundra swan/Alaska/442960/2006 (A/H5N2) segment 6 (NA) 2206.0 0.000000e+00 1339/1411 (94%)
EPI280480 A/waterfowl/Colorado/443593/2006 (A/H5N2) segment 6 (NA) 2206.0 0.000000e+00 1339/1411 (94%)
EPI270365 A/thick-billed murre/Newfoundland/031/2007 (A/H11N2) segment 6 (NA) 2202.3 0.000000e+00 1326/1392 (95%)
EPI280504 A/waterfowl/Colorado/457952-2/2006 (A/H5N2) segment 6 (NA) 2200.5 0.000000e+00 1338/1411 (94%)
EPI3423 A/duck/Hong Kong/301/1978 (A/H7N2) segment 6 (NA) 2189.4 0.000000e+00 1335/1410 (94%)
EPI285596 A/mallard/NV/449567-5/2006 (A/H5N2) segment 6 (NA) 2187.6 0.000000e+00 1266/1307 (96%)
EPI300721 A/swine/KU/16/2001 (A/H7N2) segment 6 (NA) 2183.9 0.000000e+00 1334/1410 (94%)
EPI328260 A/mallard/California/8028/2008 (A/H11N2) segment 6 (NA) 2178.3 0.000000e+00 1335/1412 (94%)
EPI89425 A/duck/Hong Kong/293/1978 (A/H7N2) segment 6 (NA) 2178.3 0.000000e+00 1334/1411 (94%)
EPI100260 A/duck/BritishColumbia/CN26-6/05 (A/H5N2) segment 6 (NA) 2174.6 0.000000e+00 1303/1365 (95%)
EPI547659 A/seagull/Chile/SAG14259/2007 (A/H13N2) segment 6 (NA) 2172.8 0.000000e+00 1333/1411 (94%)
EPI403031 A/shorebird/Delaware Bay/208/2001 (A/H6N2) segment 6 (NA) 2172.8 0.000000e+00 1334/1412 (94%)
EPI343818 A/shorebird/Delaware Bay/113/2001 (A/H0) segment 6 (NA) 2172.8 0.000000e+00 1334/1412 (94%)
EPI403024 A/shorebird/Delaware Bay/124/2001 (A/H6N2) segment 6 (NA) 2167.2 0.000000e+00 1333/1412 (94%)
EPI343828 A/shorebird/Delaware Bay/77/2001 (A/H6N2) segment 6 (NA) 2167.2 0.000000e+00 1333/1412 (94%)
EPI285566 A/duck/New York/440410/2006 (A/H5N2) segment 6 (NA) 2167.2 0.000000e+00 1296/1357 (95%)
EPI289817 A/mallard/Alaska/44430-052/2008 (A/H7N2) segment 6 (NA) 2163.5 0.000000e+00 1332/1412 (94%)
EPI454562 A/ruddy turnstone/Delaware/421731/2001 (A/H0) segment 6 (NA) 2161.7 0.000000e+00 1332/1412 (94%)
EPI290721 A/northern shoveler/Washington/44249-765/2006 (A/H10N2) segment 6 (NA) 2161.7 0.000000e+00 1333/1413 (94%)
EPI285565 A/duck/New York/440409/2006 (A/H5N2) segment 6 (NA) 2161.7 0.000000e+00 1295/1357 (95%)
EPI442448 A/greater white-fronted goose/Alaska/44064-108/2006 (A/H3N2) segment 6 (NA) 2156.2 0.000000e+00 1332/1413 (94%)
EPI299800 A/mallard/Interior Alaska/6MP0990R1/2006 (A/H0) segment 6 (NA) 2156.2 0.000000e+00 1332/1413 (94%)
EPI298684 A/mallard/Interior Alaska/6MP0988/2006 (A/H0) segment 6 (NA) 2156.2 0.000000e+00 1332/1413 (94%)
EPI298572 A/mallard/Interior Alaska/6MP0992/2006 (A/H3N2) segment 6 (NA) 2156.2 0.000000e+00 1332/1413 (94%)
EPI298564 A/mallard/Interior Alaska/6MP0991/2006 (A/H3N2) segment 6 (NA) 2156.2 0.000000e+00 1332/1413 (94%)
EPI289818 A/mallard/Alaska/44185-067/2006 (A/H3N2) segment 6 (NA) 2156.2 0.000000e+00 1332/1413 (94%)
EPI289816 A/mallard/Alaska/44187-131/2006 (A/H3N2) segment 6 (NA) 2156.2 0.000000e+00 1332/1413 (94%)
EPI289815 A/mallard/Alaska/44187-129/2006 (A/H3N2) segment 6 (NA) 2156.2 0.000000e+00 1332/1413 (94%)
EPI289814 A/mallard/Alaska/44185-078/2006 (A/H3N2) segment 6 (NA) 2156.2 0.000000e+00 1332/1413 (94%)
EPI289813 A/mallard/Alaska/44185-044/2006 (A/H3N2) segment 6 (NA) 2156.2 0.000000e+00 1332/1413 (94%)
EPI289819 A/mallard/Alaska/44185-043/2006 (A/H3N2) segment 6 (NA) 2148.8 0.000000e+00 1328/1409 (94%)
EPI266390 A/great black-backed gull/Newfoundland/296/2008 (A/H13N2) segment 6 (NA) 2146.9 0.000000e+00 1325/1406 (94%)
EPI442445 A/emperor goose/Alaska/44297-269/2007 (A/H2N2) segment 6 (NA) 2145.1 0.000000e+00 1331/1414 (94%)
EPI442444 A/emperor goose/Alaska/44297-260/2007 (A/H2N2) segment 6 (NA) 2145.1 0.000000e+00 1331/1414 (94%)
EPI178111 A/northern pintail/California/44221-692/2006 (A/H11N2) segment 6 (NA) 2145.1 0.000000e+00 1287/1349 (95%)
EPI178120 A/northern pintail/California/44221-797/2006 (A/H5N2) segment 6 (NA) 2134.0 0.000000e+00 1285/1349 (95%)
EPI178118 A/northern pintail/California/44221-789/2006 (A/H5N2) segment 6 (NA) 2134.0 0.000000e+00 1285/1349 (95%)
EPI178116 A/northern pintail/California/44249-053/2006 (A/H5N2) segment 6 (NA) 2134.0 0.000000e+00 1285/1349 (95%)
EPI178103 A/northern pintail/California/44242-732/2006 (A/H6N2) segment 6 (NA) 2134.0 0.000000e+00 1285/1349 (95%)
EPI227390 A/northern shoveler/California/K138/2005 (A/H6N2) segment 6 (NA) 2128.5 0.000000e+00 1327/1413 (93%)
EPI234212 A/chicken/Pennsylvania/Sg-00427/2004 (A/H2N2) segment 6 (NA) 2124.8 0.000000e+00 1274/1335 (95%)
EPI285584 A/mallard/Mississippi/469988-2/2006 (A/H5N2) segment 6 (NA) 2117.4 0.000000e+00 1325/1413 (93%)
EPI42116 A/duck/Hong Kong/784/1979 (A/H9N2) segment 6 (NA) 2117.4 0.000000e+00 1323/1411 (93%)
EPI442433 A/brant/Alaska/44339-481/2007 (A/H1N2) segment 6 (NA) 2111.8 0.000000e+00 1324/1413 (93%)
EPI296459 A/northern shoveler/California/JN1447/2007 (A/H7N2) segment 6 (NA) 2111.8 0.000000e+00 1324/1413 (93%)
EPI290895 A/western grebe/Washington/20569-004/2007 (A/H1N2) segment 6 (NA) 2111.8 0.000000e+00 1324/1413 (93%)
EPI285590 A/northern pintail/California/491335/2007 (A/H5N2) segment 6 (NA) 2111.8 0.000000e+00 1324/1413 (93%)
EPI285583 A/Northern shoveler/Mississippi/469987-3/2006 (A/H5N2) segment 6 (NA) 2111.8 0.000000e+00 1324/1413 (93%)
EPI234211 A/chicken/Pennsylvania/Sg-00426/2004 (A/H2N2) segment 6 (NA) 2111.8 0.000000e+00 1314/1398 (93%)
EPI442432 A/brant/Alaska/44339-464/2007 (A/H1N2) segment 6 (NA) 2108.1 0.000000e+00 1323/1413 (93%)
EPI285587 A/Canada goose/Colorado/474037-5/2006 (A/H5N2) segment 6 (NA) 2106.3 0.000000e+00 1324/1414 (93%)
EPI280528 A/mallard/Idaho/455398-2/2006 (A/H5N2) segment 6 (NA) 2106.3 0.000000e+00 1325/1415 (93%)
EPI2447 A/duck/Hokkaido/95/01 (A/H2N2) segment 6 (NA) 2106.3 0.000000e+00 1320/1410 (93%)
EPI615759 A/whimbrel/Peru/P41/2007 (A/H13N2) segment 6 (NA) 2104.5 0.000000e+00 1294/1371 (94%)
EPI285585 A/Canada goose/Colorado/473047-2/2006 (A/H5N2) segment 6 (NA) 2100.8 0.000000e+00 1323/1414 (93%)
EPI2973 A/duck/Hokkaido/120/2001 (A/H6N2) segment 6 (NA) 2100.8 0.000000e+00 1320/1411 (93%)
EPI442478 A/tundra swan/Alaska/44056-144/2006 (A/H5N2) segment 6 (NA) 2095.2 0.000000e+00 1323/1415 (93%)
EPI290508 A/mallard/Washington/44242-124/2006 (A/H3N2) segment 6 (NA) 2095.2 0.000000e+00 1323/1415 (93%)
EPI285589 A/tundra swan/Alaska//480410/2007 (A/H5N2) segment 6 (NA) 2095.2 0.000000e+00 1323/1415 (93%)
EPI280672 A/Canada goose/Wyoming/473197-12/2006 (A/H5N2) segment 6 (NA) 2095.2 0.000000e+00 1323/1415 (93%)
EPI280520 A/mallard/Washington/456277-7/2006 (A/H5N2) segment 6 (NA) 2095.2 0.000000e+00 1324/1416 (93%)
EPI280512 A/mallard/Washington/456277-2/2006 (A/H5N2) segment 6 (NA) 2095.2 0.000000e+00 1323/1415 (93%)
EPI181647 A/duck/Tsukuba/28/2005 (A/H6N2) segment 6 (NA) 2095.2 0.000000e+00 1318/1410 (93%)
EPI178125 A/northern pintail/California/44291-447/2006 (A/H11N2) segment 6 (NA) 2095.2 0.000000e+00 1278/1349 (94%)
EPI510510 A/swan/BC/2045/2008 (A/H5N2) segment 6 (NA) 2089.7 0.000000e+00 1321/1414 (93%)
EPI442477 A/tundra swan/Alaska/44050-005/2006 (A/H5N2) segment 6 (NA) 2084.1 0.000000e+00 1322/1416 (93%)
EPI442475 A/tundra swan/Alaska/44049-099/2006 (A/H5N2) segment 6 (NA) 2084.1 0.000000e+00 1321/1415 (93%)
EPI326953 A/environment/Korea/ESD11/2003 (A/H3N2) segment 6 (NA) 2084.1 0.000000e+00 1311/1402 (93%)
EPI280832 A/tundra swan/Alaska/462958/2006 (A/H5N2) segment 6 (NA) 2084.1 0.000000e+00 1321/1415 (93%)
EPI280680 A/Canada goose/Wyoming/473197-10/2006 (A/H5N2) segment 6 (NA) 2084.1 0.000000e+00 1321/1415 (93%)
EPI280536 A/tundra swan/Alaska/450959/2006 (A/H5N2) segment 6 (NA) 2084.1 0.000000e+00 1322/1416 (93%)
EPI133453 A/aquatic bird/Korea/KN-2/2005 (A/H3N2) segment 6 (NA) 2084.1 0.000000e+00 1317/1411 (93%)
EPI439820 A/white faced whistling duck/Colombia/1/2011 (A/H5N2) segment 6 (NA) 2082.3 0.000000e+00 1284/1362 (94%)
EPI470945 A/duck/Hong Kong/Y439/1997 (A/H9N2) segment 6 (NA) 2078.6 0.000000e+00 1316/1411 (93%)
EPI363657 A/duck/Shantou/7904/2006 (A/H6N2) segment 6 (NA) 2078.6 0.000000e+00 1315/1410 (93%)
EPI285599 A/Canada goose/Alaska//453648/2006 (A/H5N2) segment 6 (NA) 2078.6 0.000000e+00 1322/1417 (93%)
EPI290524 A/mallard/Washington/44242-264/2006 (A/H5N2) segment 6 (NA) 2073.1 0.000000e+00 1319/1415 (93%)
EPI285600 A/mallard/Washington/456273-3/2006 (A/H5N2) segment 6 (NA) 2073.1 0.000000e+00 1319/1415 (93%)
EPI280560 A/white front goose/Alaska/446843/2006 (A/H5N2) segment 6 (NA) 2073.1 0.000000e+00 1319/1415 (93%)
EPI439813 A/black bellied whistling duck/Colombia/1/2011 (A/H5N2) segment 6 (NA) 2050.9 0.000000e+00 1263/1339 (94%)
EPI615842 A/gull/Peru/CH02/2009 (A/H13N2) segment 6 (NA) 2047.2 0.000000e+00 1286/1374 (93%)
EPI401265 A/feline/Korea/02/2011 (A/H3N2) segment 6 (NA) 2039.8 0.000000e+00 1310/1412 (92%)
EPI615765 A/gull/Peru/P43/2007 (A/H13N2) segment 6 (NA) 2038.0 0.000000e+00 1262/1341 (94%)
EPI573617 A/chicken/Pennsylvania/7659/1985 (A/H5N2) segment 6 (NA) 2034.3 0.000000e+00 1309/1412 (92%)
EPI314164 A/turkey/Massachusetts/3740/1965 (A/H6N2) segment 6 (NA) 2034.3 0.000000e+00 1310/1413 (92%)
EPI13142 A/turkey/Massachussetts/3740/65 (A/H6N2) segment 6 (NA) 2034.3 0.000000e+00 1310/1413 (92%)
EPI5923 A/Duck/Hong Kong/Y439/97 (A/H9N2) segment 6 (NA) 2034.3 0.000000e+00 1308/1410 (92%)
EPI407903 A/turkey/Massachusetts/3740/1965 (A/H6N2) segment 6 (NA) 2028.7 0.000000e+00 1309/1413 (92%)
EPI327415 A/duck/Egypt/053/2005 (A/H6N2) segment 6 (NA) 2028.7 0.000000e+00 1309/1413 (92%)
EPI228509 A/whiskered tern/Egypt/04/2004 (A/H6N2) segment 6 (NA) 2028.7 0.000000e+00 1309/1413 (92%)
EPI3189 A/turkey/Massachusetts/3740/1965 (A/H6N2) segment 6 (NA) 2028.7 0.000000e+00 1309/1413 (92%)
EPI615799 A/black skimmer/Peru/CH55/2010 (A/H13N2) segment 6 (NA) 2019.5 0.000000e+00 1273/1362 (93%)
EPI178123 A/northern pintail/California/44290-230/2006 (A/H5N2) segment 6 (NA) 2017.7 0.000000e+00 1264/1349 (93%)
EPI158516 A/turkey/CO/118899/1974 (A/H5N2) segment 6 (NA) 2017.7 0.000000e+00 1307/1413 (92%)
EPI470924 A/chicken/Korea/25232-MS96CE6/1996 (A/H9N2) segment 6 (NA) 2012.1 0.000000e+00 1305/1412 (92%)
EPI470906 A/turkey/Minnesota/511/1978 (A/H9N2) segment 6 (NA) 2012.1 0.000000e+00 1305/1412 (92%)
EPI25861 A/dove/Korea/S11/03 (A/H3N2) segment 6 (NA) 2006.6 0.000000e+00 1307/1415 (92%)
EPI25855 A/duck/Korea/S8/03 (A/H3N2) segment 6 (NA) 2006.6 0.000000e+00 1307/1415 (92%)
EPI25853 A/duck/Korea/S7/03 (A/H3N2) segment 6 (NA) 2006.6 0.000000e+00 1307/1415 (92%)
EPI251751 A/mallard/Sweden/55/2002 (A/H11N2) segment 6 (NA) 2001.0 0.000000e+00 1302/1411 (92%)
EPI251696 A/mallard/Sweden/3/2002 (A/H1N2) segment 6 (NA) 2001.0 0.000000e+00 1302/1411 (92%)
EPI178105 A/northern pintail/California/44221-608/2006 (A/H1N2) segment 6 (NA) 2001.0 0.000000e+00 1263/1351 (93%)
EPI89212 A/duck/Nanchang/1749/1992 (A/H11N2) segment 6 (NA) 1995.5 0.000000e+00 1301/1411 (92%)
EPI42841 A/blue-winged teal/New York/370ac/1979 (A/H4N2) segment 6 (NA) 1995.5 0.000000e+00 1303/1413 (92%)
EPI326948 A/duck/Korea/JS53/2004 (A/H3N2) segment 6 (NA) 1990.0 0.000000e+00 1301/1412 (92%)
EPI42670 A/mallard duck/New York/189/1982 (A/H5N2) segment 6 (NA) 1990.0 0.000000e+00 1301/1412 (92%)
EPI25857 A/duck/Korea/S9/03 (A/H3N2) segment 6 (NA) 1990.0 0.000000e+00 1304/1415 (92%)
EPI243159 A/turkey/Minnesota/833/1980 (A/H4N2) segment 6 (NA) 1984.4 0.000000e+00 1300/1412 (92%)
EPI86892 A/pintail duck/ALB/86/1976 (A/H3N2) segment 6 (NA) 1984.4 0.000000e+00 1302/1414 (92%)
EPI86264 A/mallard duck/ALB/57/1976 (A/H5N2) segment 6 (NA) 1984.4 0.000000e+00 1302/1414 (92%)
EPI178126 A/northern pintail/California/44345-820/2007 (A/H5N2) segment 6 (NA) 1980.7 0.000000e+00 1259/1351 (93%)
EPI618943 A/mallard/Sweden/223/2002 (A/H10N2) segment 6 (NA) 1978.9 0.000000e+00 1298/1411 (91%)
EPI370016 A/mallard/New York/6750/1978 (A/H2N2) segment 6 (NA) 1978.9 0.000000e+00 1300/1413 (92%)
EPI251702 A/mallard/Sweden/4/2002 (A/H10N2) segment 6 (NA) 1978.9 0.000000e+00 1298/1411 (91%)
EPI407875 A/mallard/New York/6750/1978 (A/H2N2) segment 6 (NA) 1973.3 0.000000e+00 1299/1413 (91%)
EPI618958 A/mallard/Sweden/737/2002 (A/H10N2) segment 6 (NA) 1967.8 0.000000e+00 1296/1411 (91%)
EPI618934 A/mallard/Sweden/831/2002 (A/H10N2) segment 6 (NA) 1967.8 0.000000e+00 1296/1411 (91%)
EPI372385 A/teal/Egypt/13203-NAMRU3/2006 (A/H6N2) segment 6 (NA) 1967.8 0.000000e+00 1295/1410 (91%)
EPI42793 A/mallard duck/New York/170/1982 (A/H1N2) segment 6 (NA) 1967.8 0.000000e+00 1297/1412 (91%)
EPI514876 A/mallard/Sweden/1195/2002 (A/H4N2) segment 6 (NA) 1962.3 0.000000e+00 1295/1411 (91%)
EPI468177 A/finch/England/2051/1991 (A/H5N2) segment 6 (NA) 1962.3 0.000000e+00 1296/1412 (91%)
EPI372370 A/shoveler/Egypt/13251-NAMRU3/2006 (A/H6N2) segment 6 (NA) 1962.3 0.000000e+00 1294/1410 (91%)
EPI171095 A/mallard/Wisconsin/944/1982 (A/H5N2) segment 6 (NA) 1962.3 0.000000e+00 1296/1412 (91%)
EPI169610 A/blue goose/WI/711/1975 (A/H5N2) segment 6 (NA) 1962.3 0.000000e+00 1296/1412 (91%)
EPI158981 A/chicken/NJ/7207-4/2000 (A/H5N2) segment 6 (NA) 1962.3 0.000000e+00 1296/1412 (91%)
EPI99872 A/duck/Denmark/65047/04 (A/H5N2) segment 6 (NA) 1962.3 0.000000e+00 1294/1410 (91%)
EPI33748 A/mallard/Ohio/275/1987 (A/H4N2) segment 6 (NA) 1962.3 0.000000e+00 1296/1412 (91%)
EPI3161 A/duck/Pennsylvania/10218/1984 (A/H5N2) segment 6 (NA) 1962.3 0.000000e+00 1297/1413 (91%)
EPI514914 A/mallard/Sweden/274/2002 (A/H4N2) segment 6 (NA) 1956.7 0.000000e+00 1294/1411 (91%)
EPI485697 A/mallard/Sweden/7/2002 (A/H5N2) segment 6 (NA) 1956.7 0.000000e+00 1294/1411 (91%)
EPI267603 A/mallard/Netherlands/3/1999 (A/H5N2) segment 6 (NA) 1956.7 0.000000e+00 1294/1411 (91%)
EPI238601 A/mallard/Netherlands/3/1999 (A/H5N2) segment 6 (NA) 1956.7 0.000000e+00 1294/1411 (91%)
EPI236202 A/mallard/Sweden/7/2002 (A/H5N2) segment 6 (NA) 1956.7 0.000000e+00 1294/1411 (91%)
EPI13146 A/turkey/Minnesota/3689-1551/1981 (A/H5N2) segment 6 (NA) 1956.7 0.000000e+00 1295/1412 (91%)
EPI90096 A/duck/Minnesota/1516/1981 (A/H5N2) segment 6 (NA) 1951.2 0.000000e+00 1296/1414 (91%)
EPI87446 A/pintail duck/ALB/599/1979 (A/H4N2) segment 6 (NA) 1951.2 0.000000e+00 1294/1412 (91%)
EPI87429 A/blue-winged teal/ALB/580/1979 (A/H4N2) segment 6 (NA) 1951.2 0.000000e+00 1294/1412 (91%)
EPI87395 A/mallard duck/ALB/354/1978 (A/H4N2) segment 6 (NA) 1951.2 0.000000e+00 1294/1412 (91%)
EPI85601 A/pintail duck/ALB/367/1978 (A/H6N2) segment 6 (NA) 1951.2 0.000000e+00 1294/1412 (91%)
EPI85497 A/mallard duck/ALB/250/1978 (A/H6N2) segment 6 (NA) 1951.2 0.000000e+00 1294/1412 (91%)
EPI41987 A/mallard duck/Alberta/205/1978 (A/H6N2) segment 6 (NA) 1951.2 0.000000e+00 1294/1412 (91%)
EPI251860 A/whitefronted goose/Netherlands/2/1999 (A/H6N2) segment 6 (NA) 1945.6 0.000000e+00 1291/1410 (91%)
EPI240865 A/Canada goose/Wisconsin/902/1975 (A/H5N2) segment 6 (NA) 1945.6 0.000000e+00 1294/1413 (91%)
EPI85592 A/pintail duck/ALB/133/1978 (A/H6N2) segment 6 (NA) 1945.6 0.000000e+00 1293/1412 (91%)
EPI85560 A/mallard duck/ALB/290/1978 (A/H6N2) segment 6 (NA) 1945.6 0.000000e+00 1293/1412 (91%)
EPI85543 A/mallard duck/ALB/280/1978 (A/H6N2) segment 6 (NA) 1945.6 0.000000e+00 1293/1412 (91%)
EPI48611 A/mallard/Ohio/424/1988 (A/H3N2) segment 6 (NA) 1945.6 0.000000e+00 1293/1412 (91%)
EPI44027 A/green-winged teal/Ohio/344/1986 (A/H4N2) segment 6 (NA) 1945.6 0.000000e+00 1293/1412 (91%)
EPI25851 A/chicken/Korea/S6/03 (A/H3N2) segment 6 (NA) 1945.6 0.000000e+00 1297/1416 (91%)
EPI618518 A/mallard/Sweden/7146/2004 (A/H9N2) segment 6 (NA) 1940.1 0.000000e+00 1294/1414 (91%)
EPI514862 A/mallard/Sweden/906/2002 (A/H4N2) segment 6 (NA) 1940.1 0.000000e+00 1291/1411 (91%)
EPI377610 A/white fronted goose/Netherlands/22/1999 (A/H2N2) segment 6 (NA) 1940.1 0.000000e+00 1291/1411 (91%)
EPI190310 A/mallard/Netherlands/1/2007 (A/H3N2) segment 6 (NA) 1940.1 0.000000e+00 1292/1412 (91%)
EPI182123 A/mallard/Netherlands/26/2005 (A/H11N2) segment 6 (NA) 1940.1 0.000000e+00 1290/1410 (91%)
EPI181979 A/pink-footed goose/Netherlands/1/2006 (A/H9N2) segment 6 (NA) 1940.1 0.000000e+00 1294/1414 (91%)
EPI156226 A/duck/NY/6874/1978 (A/H3N2) segment 6 (NA) 1940.1 0.000000e+00 1293/1413 (91%)
EPI90043 A/goose/MN/5733-1/1980 (A/H9N2) segment 6 (NA) 1940.1 0.000000e+00 1294/1414 (91%)
EPI86997 A/pintail duck/ALB/627/1979 (A/H3N2) segment 6 (NA) 1940.1 0.000000e+00 1293/1413 (91%)
EPI85613 A/blue-winged teal/ALB/651/1978 (A/H6N2) segment 6 (NA) 1940.1 0.000000e+00 1292/1412 (91%)
EPI42167 A/duck/New Zealand/41/1984 (A/H5N2) segment 6 (NA) 1940.1 0.000000e+00 1294/1414 (91%)
EPI455043 A/green-winged teal/Louisiana/272GW/1987 (A/H10N2) segment 6 (NA) 1934.6 0.000000e+00 1293/1414 (91%)
EPI182147 A/Bewick's swan/Netherlands/5/2007 (A/H9N2) segment 6 (NA) 1934.6 0.000000e+00 1293/1414 (91%)
EPI87412 A/mallard duck/ALB/106/1979 (A/H4N2) segment 6 (NA) 1934.6 0.000000e+00 1291/1412 (91%)
EPI3075 A/mallard/Alberta/223/1979 (A/H4N2) segment 6 (NA) 1934.6 0.000000e+00 1291/1412 (91%)
EPI437374 A/mallard/Alberta/238/1987 (A/H6N2) segment 6 (NA) 1929.0 0.000000e+00 1292/1414 (91%)
EPI437367 A/mallard/Alberta/230/1987 (A/H6N2) segment 6 (NA) 1929.0 0.000000e+00 1292/1414 (91%)
EPI345020 A/mallard/Alberta/144/1987 (A/H0) segment 6 (NA) 1929.0 0.000000e+00 1292/1414 (91%)
EPI296507 A/mallard/Sweden/74/2003 (A/H5N2) segment 6 (NA) 1929.0 0.000000e+00 1290/1412 (91%)
EPI296499 A/mallard/Netherlands/7/2007 (A/H4N2) segment 6 (NA) 1929.0 0.000000e+00 1289/1411 (91%)
EPI240062 A/duck/LA/32M/1987 (A/H6N2) segment 6 (NA) 1929.0 0.000000e+00 1292/1414 (91%)
EPI234210 A/avian/New York/Sg-00425/2004 (A/H2N2) segment 6 (NA) 1929.0 0.000000e+00 1283/1401 (91%)
EPI185342 A/wild duck/Germany/WV2555/2006 (A/H3N2) segment 6 (NA) 1929.0 0.000000e+00 1292/1414 (91%)
EPI158973 A/turkey/MN/40550/1987 (A/H5N2) segment 6 (NA) 1929.0 0.000000e+00 1292/1414 (91%)
EPI105943 A/Bewick's swan/Netherlands/1/2005 (A/H6N2) segment 6 (NA) 1929.0 0.000000e+00 1288/1410 (91%)
EPI87510 A/mallard duck/ALB/630/1984 (A/H4N2) segment 6 (NA) 1929.0 0.000000e+00 1292/1414 (91%)
EPI87137 A/mallard duck/ALB/144/1987 (A/H3N2) segment 6 (NA) 1929.0 0.000000e+00 1292/1414 (91%)
EPI1746 A/duck/Hokkaido/9/99 (A/H9N2) segment 6 (NA) 1929.0 0.000000e+00 1290/1412 (91%)
EPI470955 A/turkey/Texas/1/1981 (A/H9N2) segment 6 (NA) 1923.5 0.000000e+00 1291/1414 (91%)
EPI470922 A/turkey/Texas/28737/1981 (A/H9N2) segment 6 (NA) 1923.5 0.000000e+00 1291/1414 (91%)
EPI437397 A/mallard/Alberta/294/1987 (A/H0) segment 6 (NA) 1923.5 0.000000e+00 1291/1414 (91%)
EPI437388 A/pintail/Alberta/267/1987 (A/H6N2) segment 6 (NA) 1923.5 0.000000e+00 1292/1415 (91%)
EPI437381 A/mallard/Alberta/260/1987 (A/H6N2) segment 6 (NA) 1923.5 0.000000e+00 1291/1414 (91%)
EPI437353 A/mallard/Alberta/196/1987 (A/H6N2) segment 6 (NA) 1923.5 0.000000e+00 1291/1414 (91%)
EPI437346 A/mallard/Alberta/195/1987 (A/H6N2) segment 6 (NA) 1923.5 0.000000e+00 1291/1414 (91%)
EPI437339 A/mallard/Alberta/186/1987 (A/H6N2) segment 6 (NA) 1923.5 0.000000e+00 1291/1414 (91%)
EPI437324 A/coot/Alberta/134/1987 (A/H6N2) segment 6 (NA) 1923.5 0.000000e+00 1291/1414 (91%)
EPI304509 A/duck/France/05057a/2005 (A/H6N2) segment 6 (NA) 1923.5 0.000000e+00 1287/1410 (91%)
EPI226890 A/barnacle goose/Netherlands/1/2005 (A/H6N2) segment 6 (NA) 1923.5 0.000000e+00 1287/1410 (91%)
EPI226672 A/Eurasian wigeon/Netherlands/3/2005 (A/H9N2) segment 6 (NA) 1923.5 0.000000e+00 1293/1416 (91%)
EPI162371 A/turkey/TX/4-1-81/1981 (A/H9N2) segment 6 (NA) 1923.5 0.000000e+00 1291/1414 (91%)
EPI159077 A/turkey/TX/1-40-82/1982 (A/H5N2) segment 6 (NA) 1923.5 0.000000e+00 1293/1416 (91%)
EPI87842 A/mallard duck/Alberta/645/1980 (A/H5N2) segment 6 (NA) 1923.5 0.000000e+00 1290/1413 (91%)
EPI86763 A/mallard duck/ALB/294/1987 (A/H6N2) segment 6 (NA) 1923.5 0.000000e+00 1291/1414 (91%)
EPI86744 A/coot/ALB/134/1987 (A/H6N2) segment 6 (NA) 1923.5 0.000000e+00 1291/1414 (91%)
EPI85743 A/pintail duck/Alberta/1360/1979 (A/H6N2) segment 6 (NA) 1923.5 0.000000e+00 1292/1415 (91%)
EPI501699 A/feline/Guangdong/1/2011 (A/H3N2) segment 6 (NA) 1917.9 0.000000e+00 1290/1414 (91%)
EPI470951 A/turkey/Texas/2/1981 (A/H9N2) segment 6 (NA) 1917.9 0.000000e+00 1290/1414 (91%)
EPI284224 A/canine/Guangdong/2/2007 (A/H3N2) segment 6 (NA) 1917.9 0.000000e+00 1290/1414 (91%)
EPI88180 A/mallard duck/ALB/98/1985 (A/H6N2) segment 6 (NA) 1917.9 0.000000e+00 1290/1414 (91%)
EPI86024 A/shoveler/ALB/114/1985 (A/H6N2) segment 6 (NA) 1917.9 0.000000e+00 1290/1414 (91%)
EPI85967 A/blue-winged teal/ALB/69/1985 (A/H6N2) segment 6 (NA) 1917.9 0.000000e+00 1290/1414 (91%)
EPI544908 A/canine/Korea/VC123578/2012 (A/H3N2) segment 6 (NA) 1912.4 0.000000e+00 1290/1415 (91%)
EPI544901 A/canine/Korea/VC378/2012 (A/H3N2) segment 6 (NA) 1912.4 0.000000e+00 1290/1415 (91%)
EPI460107 A/canine/Korea/MV1/2012 (A/H3N2) segment 6 (NA) 1912.4 0.000000e+00 1290/1415 (91%)
EPI437360 A/mallard/Alberta/197/1987 (A/H6N2) segment 6 (NA) 1912.4 0.000000e+00 1289/1414 (91%)
EPI401902 A/mallard/Alberta/311/1986 (A/H6N2) segment 6 (NA) 1912.4 0.000000e+00 1289/1414 (91%)
EPI284232 A/canine/Guangdong/1/2007 (A/H3N2) segment 6 (NA) 1912.4 0.000000e+00 1289/1414 (91%)
EPI284217 A/canine/Guangdong/2/2006 (A/H3N2) segment 6 (NA) 1912.4 0.000000e+00 1289/1414 (91%)
EPI240173 A/mallard/Ohio/81/1986 (A/H6N2) segment 6 (NA) 1912.4 0.000000e+00 1289/1414 (91%)
EPI238772 A/Pekin duck/Singapore/F59/04/98 (A/H5N2) segment 6 (NA) 1912.4 0.000000e+00 1289/1414 (91%)
EPI182099 A/mallard/Netherlands/71/2006 (A/H6N2) segment 6 (NA) 1912.4 0.000000e+00 1286/1411 (91%)
EPI86005 A/pintail duck/ALB/111/1985 (A/H6N2) segment 6 (NA) 1912.4 0.000000e+00 1289/1414 (91%)
EPI85948 A/mallard duck/ALB/10/1985 (A/H6N2) segment 6 (NA) 1912.4 0.000000e+00 1289/1414 (91%)
EPI60788 A/mallard/Ohio/81/1986 (A/H8N2) segment 6 (NA) 1912.4 0.000000e+00 1289/1414 (91%)
EPI2439 A/duck/Hokkaido/13/00 (A/H9N2) segment 6 (NA) 1912.4 0.000000e+00 1287/1412 (91%)
EPI275224 A/common murre/Alaska/44089-066/2006 (A/H10N2) segment 6 (NA) 1908.7 0.000000e+00 1263/1377 (91%)
EPI470918 A/goose/Minnesota/5733-1243/1980 (A/H9N2) segment 6 (NA) 1906.9 0.000000e+00 1276/1396 (91%)
EPI416236 A/feline/Korea/01/2010 (A/H3N2) segment 6 (NA) 1906.9 0.000000e+00 1288/1414 (91%)
EPI284208 A/canine/Guangdong/1/2006 (A/H3N2) segment 6 (NA) 1906.9 0.000000e+00 1288/1414 (91%)
EPI190326 A/mallard/Netherlands/29/2006 (A/H7N2) segment 6 (NA) 1906.9 0.000000e+00 1285/1411 (91%)
EPI133500 A/duck/Korea/LPM86/2006 (A/H3N2) segment 6 (NA) 1906.9 0.000000e+00 1287/1413 (91%)
EPI133474 A/chicken/Korea/LPM17/2004 (A/H3N2) segment 6 (NA) 1906.9 0.000000e+00 1287/1413 (91%)
EPI133468 A/duck/Korea/LPM01/2004 (A/H3N2) segment 6 (NA) 1906.9 0.000000e+00 1286/1412 (91%)
EPI88263 A/mallard duck/ALB/321/1988 (A/H9N2) segment 6 (NA) 1906.9 0.000000e+00 1288/1414 (91%)
EPI47813 A/bufflehead/Ohio/246/1986 (A/H11N2) segment 6 (NA) 1906.9 0.000000e+00 1288/1414 (91%)
EPI296207 A/duck/Korea/U11/2007 (A/H1N2) segment 6 (NA) 1905.0 0.000000e+00 1266/1381 (91%)
EPI586236 A/muskrat/Russia/63/2014 (A/H2N2) segment 6 (NA) 1901.3 0.000000e+00 1287/1414 (91%)
EPI574211 A/mule duck/Bulgaria/64/2010 (A/H0) segment 6 (NA) 1901.3 0.000000e+00 1287/1414 (91%)
EPI470920 A/turkey/California/1054C/1985 (A/H9N2) segment 6 (NA) 1901.3 0.000000e+00 1287/1414 (91%)
EPI402136 A/mallard/Alberta/549/1986 (A/H6N2) segment 6 (NA) 1901.3 0.000000e+00 1287/1414 (91%)
EPI377586 A/mallard/Sweden/58451/2006 (A/H2N2) segment 6 (NA) 1901.3 0.000000e+00 1287/1414 (91%)
EPI326400 A/canine/Jiangsu/06/2010 (A/H3N2) segment 6 (NA) 1901.3 0.000000e+00 1293/1421 (90%)
EPI34147 A/wigeon/Ohio/379/1988 (A/H5N2) segment 6 (NA) 1901.3 0.000000e+00 1288/1415 (91%)
EPI22283 A/mallard/Alberta/321/88 (A/H9N2) segment 6 (NA) 1901.3 0.000000e+00 1287/1414 (91%)
EPI574173 A/mule duck/Bulgaria/61/2010 (A/H0) segment 6 (NA) 1895.8 0.000000e+00 1286/1414 (90%)
EPI470914 A/turkey/California/1054T/1985 (A/H9N2) segment 6 (NA) 1895.8 0.000000e+00 1286/1414 (90%)
EPI407926 A/turkey/Wisconsin/1/1966 (A/H9N2) segment 6 (NA) 1895.8 0.000000e+00 1290/1418 (90%)
EPI398992 A/canine/Korea/KRIBB01/2011 (A/H3N2) segment 6 (NA) 1895.8 0.000000e+00 1287/1415 (90%)
EPI394664 A/canine/Guangdong/2/2011 (A/H3N2) segment 6 (NA) 1895.8 0.000000e+00 1286/1414 (90%)
EPI377578 A/mallard/Sweden/58112/2006 (A/H2N2) segment 6 (NA) 1895.8 0.000000e+00 1286/1414 (90%)
EPI314188 A/turkey/Wisconsin/1/1966 (A/H9N2) segment 6 (NA) 1895.8 0.000000e+00 1290/1418 (90%)
EPI296364 A/feline/Korea/01/2010 (A/H3N2) segment 6 (NA) 1895.8 0.000000e+00 1286/1414 (90%)
EPI268281 A/duck/Shantou/83/2000 (A/H6N2) segment 6 (NA) 1895.8 0.000000e+00 1285/1413 (90%)
EPI243196 A/turkey/Wisconsin/1/1966 (A/H9N2) segment 6 (NA) 1895.8 0.000000e+00 1290/1418 (90%)
EPI242741 A/turkey/Wisconsin/1/66 (A/H9N2) segment 6 (NA) 1895.8 0.000000e+00 1290/1418 (90%)
EPI242739 A/turkey/Wisconsin/1/1966 (A/H9N2) segment 6 (NA) 1895.8 0.000000e+00 1290/1418 (90%)
EPI242735 A/turkey/WI/1966 (A/H9N2) segment 6 (NA) 1895.8 0.000000e+00 1290/1418 (90%)
EPI133506 A/duck/Korea/LPM92/2006 (A/H3N2) segment 6 (NA) 1895.8 0.000000e+00 1285/1413 (90%)

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Wed Oct 14, 2015 11:52 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
EPI620460 A/chicken/Iowa/14589-1/2015 (A/H5N2) segment 7 (MP) 1814.5 0.000000e+00 982/982 (100%)
EPI620453 A/chicken/Iowa/14399-4/2015 (A/H5N2) segment 7 (MP) 1814.5 0.000000e+00 982/982 (100%)
EPI620446 A/chicken/Iowa/14322-6/2015 (A/H5N2) segment 7 (MP) 1814.5 0.000000e+00 982/982 (100%)
EPI620439 A/turkey/Iowa/14319-1/2015 (A/H5N2) segment 7 (MP) 1814.5 0.000000e+00 982/982 (100%)
EPI620432 A/turkey/Iowa/14318-1/2015 (A/H5N2) segment 7 (MP) 1814.5 0.000000e+00 982/982 (100%)
EPI620425 A/chicken/Iowa/13542-2/2015 (A/H5N2) segment 7 (MP) 1814.5 0.000000e+00 982/982 (100%)
EPI620418 A/turkey/Iowa/13541-1/2015 (A/H5N2) segment 7 (MP) 1814.5 0.000000e+00 982/982 (100%)
EPI587636 A/chicken/Iowa/04-20/2015 (A/H5N2) segment 7 (MP) 1814.5 0.000000e+00 982/982 (100%)
EPI620411 A/turkey/Iowa/11762-1/2015 (A/H5N2) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI590743 A/turkey/Minnesota/9845-4/2015 (A/H5N2) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI590736 A/chicken/Kansas/8395-3/2015 (A/H5N2) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI590729 A/turkey/Arkansas/7791-1/2015 (A/H5N2) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI590722 A/turkey/Missouri/7458-1/2015 (A/H5N2) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI590708 A/chicken/Oregon/A01819044/2015 (A/H5N2) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI590688 A/turkey/Minnesota/9892-2/2015 (A/H5N2) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI568701 A/domestic duck/Washington/61-16/2014 (A/H5N2) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI568698 A/turkey/Washington/61-22/2014 (A/H5N2) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI568697 A/chicken/Washington/61-9/2014 (A/H5N2) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI590715 A/turkey/Minnesota/7172-1/2015 (A/H5N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI586561 A/chicken/BC/FAV25/2014 (A/H5N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI586553 A/chicken/BC/FAV24/2014 (A/H5N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI586521 A/chicken/BC/FAV20/2014 (A/H5N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI586504 A/poultry/BC/FAV17/2014 (A/H5N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI585651 A/baikal teal/Korea/2416/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI585650 A/baikal teal/Korea/2414/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI585649 A/baikal teal/Korea/2406/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI585647 A/baikal teal/Korea/2402/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI585646 A/baikal teal/Korea/2399/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI585645 A/baikal teal/Korea/1458/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI585644 A/baikal teal/Korea/1457/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI585643 A/baikal teal/Korea/1456/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI585642 A/baikal teal/Korea/1454/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI585641 A/baikal teal/Korea/1452/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI585639 A/baikal teal/Korea/1448/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI585638 A/baikal teal/Korea/1447/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI585637 A/baikal teal/Korea/1446/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI585635 A/baikal teal/Korea/1441/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI585634 A/baikal teal/Korea/1437/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI585087 A/turkey/California/K1500169-1.2/2015 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI584082 A/turkey/BC/FAV14/2014 (A/H5N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI576480 A/chicken/BC/FAV9/2014 (A/H5N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI576473 A/chicken/BC/FAV8/2014 (A/H5N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI573301 A/turkey/BC/FAV10/2014 (A/H5N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI569386 A/Northern pintail/Washington/40964/2014 (A/H5N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI561700 A/spot-billed duck/Korea/H455-42/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI561693 A/common teal/Korea/H455-30/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI561684 A/tundra swan/Korea/H411/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI561677 A/bean goose/Korea/H328/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI561670 A/mallard/Korea/H297/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI561656 A/breeder chicken/Korea/H250/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI561649 A/breeder duck/Korea/H249/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI561636 A/white-fronted goose/Korea/H231/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI561629 A/mallard/Korea/H207/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI561622 A/breeder duck/Korea/H200/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI561601 A/broiler duck/Korea/H133/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI561594 A/breeder duck/Korea/H128/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI561580 A/breeder chicken/Korea/H122/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI561573 A/Baikal teal/Korea/H96/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI561566 A/Baikal teal/Korea/H84/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI561559 A/Coot/Korea/H81/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI561552 A/Baikal teal/Korea/H80/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI561532 A/Baikal teal/Korea/H66/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI561525 A/broiler duck/Korea/H65/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI561511 A/bean goose/Korea/H53/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI561351 A/broiler duck/Korea/H47/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI561344 A/Baikal teal/Korea/H41/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI561211 A/broiler duck/Korea/H31/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI561199 A/broiler duck/Korea/H29/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI561190 A/waterfowl/Korea/S005/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI553211 A/crane/Kagoshima/KU1/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI542633 A/mallard/Korea/W452/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI517164 A/Chicken/Kumamoto/1-7/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI509756 A/baikal teal/Korea/Donglim3/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI509711 A/broiler duck/Korea/Buan2/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI590695 A/chicken/Washington/3490-18/2015 (A/H5N2) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI587524 A/American wigeon/BC/050-31/2015 (A/H5N8) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI586545 A/chicken/BC/FAV23/2014 (A/H5N2) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI586537 A/chicken/BC/FAV22/2014 (A/H5N2) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI586529 A/chicken/BC/FAV21/2014 (A/H5N2) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI586513 A/poultry/BC/FAV19/2014 (A/H5N2) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI586496 A/poultry/BC/FAV15/2014 (A/H5N2) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI585652 A/baikal teal/Korea/2417/2014 (A/H5N8) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI585648 A/baikal teal/Korea/2403/2014 (A/H5N8) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI585640 A/baikal teal/Korea/1449/2014 (A/H5N8) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI585636 A/baikal teal/Korea/1445/2014 (A/H5N8) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI585095 A/pheasant/Washington/3147-2/2015 (A/H5N2) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI573289 A/American green-winged teal/Washington/195750/2014 (A/H5N1) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI573164 A/chicken/Netherlands/14015766/2014 (A/H5N8) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI569393 A/gyrfalcon/Washington/41088-6/2014 (A/H5N8) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI568702 A/guinea fowl/Oregon/41613-1/2014 (A/H5N8) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI568699 A/chicken/Oregon/41613-2/2014 (A/H5N8) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI561708 A/bean goose/Korea/H40/2014 (A/H5N8) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI561663 A/Korean native chicken/Korea/H257/2014 (A/H5N8) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI561615 A/breeder duck/Korea/H158/2014 (A/H5N8) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI561608 A/broiler duck/Korea/H145/2014 (A/H5N8) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI561545 A/Baikal teal/Korea/H68/2014 (A/H5N8) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI561518 A/Baikal teal/Korea/H62/2014 (A/H5N8) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI561363 A/broiler duck/Korea/H49/2014 (A/H5N8) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI561356 A/broiler duck/Korea/H48/2014 (A/H5N8) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI554603 A/turkey/Germany-NI/R3372/2014 (A/H5N8) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI553346 A/chicken/Miyazaki/7/2014 (A/H5N8) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI552749 A/turkey/Germany/AR2485-86-L00899/2014 (A/H5N8) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI548627 A/chicken/Netherlands/14015531/2014 (A/H5N8) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI547684 A/Chicken/Netherlands/14015526/2014 (A/H5N8) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI588979 A/duck/Taiwan/a068/2015 (A/H5N8) segment 7 (MP) 1796.1 0.000000e+00 978/981 (99%)
EPI588955 A/goose/Taiwan/a015/2015 (A/H5N8) segment 7 (MP) 1796.1 0.000000e+00 978/981 (99%)
EPI595144 A/greater white-fronted goose/Korea/K14-374-1/2014 (A/H5N8) segment 7 (MP) 1792.4 0.000000e+00 978/982 (99%)
EPI595136 A/greater white-fronted goose/Korea/K14-372-2/2014 (A/H5N8) segment 7 (MP) 1792.4 0.000000e+00 978/982 (99%)
EPI595131 A/greater white-fronted goose/Korea/K14-371-4/2014 (A/H5N8) segment 7 (MP) 1792.4 0.000000e+00 978/982 (99%)
EPI595122 A/greater white-fronted goose/Korea/K14-369-3/2014 (A/H5N8) segment 7 (MP) 1792.4 0.000000e+00 978/982 (99%)
EPI595114 A/greater white-fronted goose/Korea/K14-367-4/2014 (A/H5N8) segment 7 (MP) 1792.4 0.000000e+00 978/982 (99%)
EPI595105 A/mandarin duck/Korea/K14-367-1/2014 (A/H5N8) segment 7 (MP) 1792.4 0.000000e+00 978/982 (99%)
EPI595097 A/mandarin duck/Korea/K14-366-1/2014 (A/H5N8) segment 7 (MP) 1792.4 0.000000e+00 978/982 (99%)
EPI595085 A/mandarin duck/Korea/K14-363-1/2014 (A/H5N8) segment 7 (MP) 1792.4 0.000000e+00 978/982 (99%)
EPI595077 A/mallard/Korea/N15-99/2015 (A/H5N8) segment 7 (MP) 1792.4 0.000000e+00 978/982 (99%)
EPI573641 A/crane/Kagoshima/KU13/2014(H5N8) (A/H5N8) segment 7 (MP) 1792.4 0.000000e+00 978/982 (99%)
EPI573190 A/chicken/Netherlands/14016437/2014 (A/H5N8) segment 7 (MP) 1792.4 0.000000e+00 978/982 (99%)
EPI558012 A/duck/England/36038/14 (A/H5N8) segment 7 (MP) 1792.4 0.000000e+00 978/982 (99%)
EPI558005 A/duck/England/36226/14 (A/H5N8) segment 7 (MP) 1792.4 0.000000e+00 978/982 (99%)
EPI553365 A/environment/Kagoshima/KU-ngr-H/2014 (A/H5N8) segment 7 (MP) 1792.4 0.000000e+00 978/982 (99%)
EPI548496 A/duck/Chiba/26-372-61/2014 (A/H5N8) segment 7 (MP) 1792.4 0.000000e+00 978/982 (99%)
EPI548488 A/duck/Chiba/26-372-48/2014 (A/H5N8) segment 7 (MP) 1792.4 0.000000e+00 978/982 (99%)
EPI547676 A/duck/England/36254/14 (A/H5N8) segment 7 (MP) 1792.4 0.000000e+00 978/982 (99%)
EPI588971 A/chicken/Taiwan/a174/2015 (A/H5N3) segment 7 (MP) 1790.5 0.000000e+00 977/981 (99%)
EPI588963 A/duck/Taiwan/a043/2015 (A/H5N2) segment 7 (MP) 1790.5 0.000000e+00 977/981 (99%)
EPI555124 A/domestic duck/Germany-NI/R3468/2014 (A/H5N8) segment 7 (MP) 1790.5 0.000000e+00 975/978 (99%)
EPI553181 A/turkey/Italy/14VIR7898-10/2014 (A/H5N8) segment 7 (MP) 1790.5 0.000000e+00 975/978 (99%)
EPI548426 A/turkey/Germany-MV/R2472/2014 (A/H5N8) segment 7 (MP) 1790.5 0.000000e+00 975/978 (99%)
EPI595069 A/mallard/Korea/KU3-2/2015 (A/H5N8) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
EPI576394 A/MuteSwan/Sweden/SVA-1503130141-SZ543/2015 (A/H5N8) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
EPI576381 A/MuteSwan/Sweden/SVA-U1503110277-SZ502/2015 (A/H5N8) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
EPI573683 A/mallard duck/Kagoshima/KU116/2015(H5N8) (A/H5N8) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
EPI573675 A/mallard duck/Kagoshima/KU70/2015(H5N8) (A/H5N8) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
EPI573667 A/crane/Kagoshima/KU53/2015(H5N8) (A/H5N8) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
EPI573657 A/crane/Kagoshima/KU41/2014(H5N8) (A/H5N8) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
EPI573649 A/crane/Kagoshima/KU21/2014(H5N8) (A/H5N8) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
EPI573182 A/duck/Netherlands/14015898/2014 (A/H5N8) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
EPI573174 A/Chicken/Netherlands/14015824/2014 (A/H5N8) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
EPI542997 A/duck/Beijing/FS01/2013 (A/H5N8) segment 7 (MP) 1786.8 0.000000e+00 975/979 (99%)
EPI595061 A/common teal/Korea/KU-12/2015 (A/H5N8) segment 7 (MP) 1781.3 0.000000e+00 976/982 (99%)
EPI543005 A/duck/Beijing/FS01/2014 (A/H5N8) segment 7 (MP) 1781.3 0.000000e+00 974/979 (99%)
EPI431451 A/duck/Hebei/2/2011 (A/H5N2) segment 7 (MP) 1759.1 0.000000e+00 972/982 (98%)
EPI414241 A/duck/Jiangsu/1-15/2011 (A/H4N2) segment 7 (MP) 1753.6 0.000000e+00 971/982 (98%)
EPI398977 A/duck/Eastern China/1111/2011 (A/H5N2) segment 7 (MP) 1753.6 0.000000e+00 971/982 (98%)
EPI596292 A/eurasian wigeon/Netherlands/1/2014 (A/H5N8) segment 7 (MP) 1716.7 0.000000e+00 947/955 (99%)
EPI552763 A/eurasian wigeon/Netherlands/emc-1/2014 (A/H5N8) segment 7 (MP) 1711.1 0.000000e+00 946/955 (99%)
EPI475582 A/wild duck/Shandong/628/2011 (A/H5N1) segment 7 (MP) 1709.3 0.000000e+00 963/982 (98%)
EPI399963 A/duck/Jiangsu/m234/2012 (A/H5N2) segment 7 (MP) 1703.7 0.000000e+00 962/982 (97%)
EPI398978 A/goose/Eastern China/1112/2011 (A/H5N2) segment 7 (MP) 1703.7 0.000000e+00 962/982 (97%)
EPI328891 A/duck/Eastern China/909/2009 (A/H5N1) segment 7 (MP) 1703.7 0.000000e+00 962/982 (97%)
EPI328875 A/duck/Eastern China/031/2009 (A/H5N5) segment 7 (MP) 1703.7 0.000000e+00 962/982 (97%)
EPI328867 A/duck/Eastern China/008/2008 (A/H5N5) segment 7 (MP) 1703.7 0.000000e+00 962/982 (97%)
EPI328883 A/duck/Eastern China/108/2008 (A/H5N1) segment 7 (MP) 1698.2 0.000000e+00 961/982 (97%)
EPI590682 A/eurasian wigeon/Netherlands/1/2015 (A/H5N8) segment 7 (MP) 1692.7 0.000000e+00 928/934 (99%)
EPI585114 A/eurasian wigeon/Netherlands/1/2015 (A/H5N8) segment 7 (MP) 1692.7 0.000000e+00 928/934 (99%)
EPI442028 A/quail/Jiangsu/k0104/2010 (A/H5N5) segment 7 (MP) 1692.7 0.000000e+00 960/982 (97%)
EPI431459 A/duck/Hebei/3/2011 (A/H5N2) segment 7 (MP) 1687.1 0.000000e+00 959/982 (97%)
EPI442004 A/goose/Shandong/k1204/2009 (A/H5N5) segment 7 (MP) 1681.6 0.000000e+00 959/983 (97%)
EPI596304 A/chicken/Netherlands/emc-3/2014 (A/H5N8) segment 7 (MP) 1672.3 0.000000e+00 911/914 (99%)
EPI552779 A/chicken/Netherlands/emc-3/2014 (A/H5N8) segment 7 (MP) 1672.3 0.000000e+00 911/914 (99%)
EPI442020 A/duck/Jiangsu/k1203/2010 (A/H5N8) segment 7 (MP) 1670.5 0.000000e+00 956/982 (97%)
EPI597680 A/duck/Hunan/316/2005 (A/H5N1) segment 7 (MP) 1665.0 0.000000e+00 955/982 (97%)
EPI493836 A/duck/Guangdong/wy24/2008 (A/H5N5) segment 7 (MP) 1665.0 0.000000e+00 955/982 (97%)
EPI493820 A/duck/Guangdong/wy11/2008 (A/H5N5) segment 7 (MP) 1665.0 0.000000e+00 955/982 (97%)
EPI442012 A/goose/Guangdong/k0103/2010 (A/H5N5) segment 7 (MP) 1665.0 0.000000e+00 957/984 (97%)
EPI280107 A/Shanghai/1/2006 (A/H5N1) segment 7 (MP) 1665.0 0.000000e+00 955/982 (97%)
EPI280099 A/Guangdong/1/2006 (A/H5N1) segment 7 (MP) 1665.0 0.000000e+00 955/982 (97%)
EPI227312 A/Mallard/Huadong/lk/2005 (A/H5N1) segment 7 (MP) 1665.0 0.000000e+00 955/982 (97%)
EPI164233 A/Sichuan/2/2006 (A/H5N1) segment 7 (MP) 1665.0 0.000000e+00 955/982 (97%)
EPI164225 A/Sichuan/1/2006 (A/H5N1) segment 7 (MP) 1665.0 0.000000e+00 955/982 (97%)
EPI111857 A/chicken/Guiyang/3923/2005 (A/H5N1) segment 7 (MP) 1665.0 0.000000e+00 955/982 (97%)
EPI106032 A/China/GD01/2006 (A/H5N1) segment 7 (MP) 1665.0 0.000000e+00 955/982 (97%)
EPI596298 A/eurasian wigeon/Netherlands/2/2014 (A/H5N8) segment 7 (MP) 1661.3 0.000000e+00 907/911 (99%)
EPI552771 A/eurasian wigeon/Netherlands/emc-2/2014 (A/H5N8) segment 7 (MP) 1661.3 0.000000e+00 907/911 (99%)
EPI493828 A/duck/Guangdong/wy19/2008 (A/H5N5) segment 7 (MP) 1659.4 0.000000e+00 955/983 (97%)
EPI399889 A/duck/HuBei/03/2010 (A/H5N5) segment 7 (MP) 1659.4 0.000000e+00 954/982 (97%)
EPI276073 A/shrike/Tibet/13/2006 (A/H5N1) segment 7 (MP) 1659.4 0.000000e+00 954/982 (97%)
EPI275985 A/duck/Hubei/49/2005 (A/H5N1) segment 7 (MP) 1659.4 0.000000e+00 954/982 (97%)
EPI275389 A/Anhui/2/2005 (A/H5N1) segment 7 (MP) 1659.4 0.000000e+00 954/982 (97%)
EPI251445 A/Anhui/1/2006 (A/H5N1) segment 7 (MP) 1659.4 0.000000e+00 954/982 (97%)
EPI251423 A/Sichuan/3/2006 (A/H5N1) segment 7 (MP) 1659.4 0.000000e+00 954/982 (97%)
EPI251419 A/Zhejiang/1/2006 (A/H5N1) segment 7 (MP) 1659.4 0.000000e+00 954/982 (97%)
EPI224780 A/Shanghai/1/2006 (A/H5N1) segment 7 (MP) 1659.4 0.000000e+00 954/982 (97%)
EPI167956 A/long-tailed shrike/Hong Kong/2762/2007 (A/H5N1) segment 7 (MP) 1659.4 0.000000e+00 954/982 (97%)
EPI164241 A/Anhui/2/2005 (A/H5N1) segment 7 (MP) 1659.4 0.000000e+00 954/982 (97%)
EPI164217 A/Anhui/1/2005 (A/H5N1) segment 7 (MP) 1659.4 0.000000e+00 954/982 (97%)
EPI127390 A/wild duck/Hunan/021/2005 (A/H5N1) segment 7 (MP) 1659.4 0.000000e+00 954/982 (97%)
EPI111872 A/duck/Guiyang/1558/2006 (A/H5N1) segment 7 (MP) 1659.4 0.000000e+00 954/982 (97%)
EPI111860 A/goose/Guiyang/4030/2005 (A/H5N1) segment 7 (MP) 1659.4 0.000000e+00 954/982 (97%)
EPI111674 A/duck/Hunan/5472/2005 (A/H5N1) segment 7 (MP) 1659.4 0.000000e+00 954/982 (97%)
EPI111656 A/goose/Shantou/3265/2006 (A/H5N1) segment 7 (MP) 1659.4 0.000000e+00 954/982 (97%)
EPI111644 A/goose/Guiyang/538/2006 (A/H5N1) segment 7 (MP) 1659.4 0.000000e+00 954/982 (97%)
EPI111632 A/chicken/Guiyang/4059/2005 (A/H5N1) segment 7 (MP) 1659.4 0.000000e+00 954/982 (97%)
EPI111578 A/duck/Guangxi/4428/2005 (A/H5N1) segment 7 (MP) 1659.4 0.000000e+00 955/983 (97%)
EPI506248 A/duck/Laos/3295/2006 (A/H5N1) segment 7 (MP) 1653.9 0.000000e+00 951/979 (97%)
EPI337321 A/water/Hunan/3/2009 (A/H5N1) segment 7 (MP) 1653.9 0.000000e+00 953/982 (97%)
EPI337314 A/environment/Xinjiang/6/2009 (A/H5N1) segment 7 (MP) 1653.9 0.000000e+00 954/983 (97%)
EPI280267 A/water/Hunan/3/2009 (A/H5N1) segment 7 (MP) 1653.9 0.000000e+00 953/982 (97%)
EPI280259 A/environment/Xinjiang/6/2009 (A/H5N1) segment 7 (MP) 1653.9 0.000000e+00 954/983 (97%)
EPI275961 A/duck/Anhui/1/06 (A/H5N1) segment 7 (MP) 1653.9 0.000000e+00 953/982 (97%)
EPI275873 A/chicken/Sichuan/81/2005 (A/H5N1) segment 7 (MP) 1653.9 0.000000e+00 953/982 (97%)
EPI275769 A/chicken/Hunan/1/2009 (A/H5N1) segment 7 (MP) 1653.9 0.000000e+00 953/982 (97%)
EPI251431 A/Guangdong/1/2008 (A/H5N1) segment 7 (MP) 1653.9 0.000000e+00 953/982 (97%)
EPI251427 A/Anhui/1/2007 (A/H5N1) segment 7 (MP) 1653.9 0.000000e+00 953/982 (97%)
EPI235901 A/duck/Zhejiang/bj/2002 (A/H5N1) segment 7 (MP) 1653.9 0.000000e+00 954/983 (97%)
EPI222571 A/scaly-breasted munia/Hong Kong/2433/2007 (A/H5N1) segment 7 (MP) 1653.9 0.000000e+00 953/982 (97%)
EPI221720 A/chestnut munia/Hong Kong/2442/2007 (A/H5N1) segment 7 (MP) 1653.9 0.000000e+00 953/982 (97%)
EPI164328 A/goose/Yunnan/4985/2006 (A/H5N1) segment 7 (MP) 1653.9 0.000000e+00 954/983 (97%)
EPI164304 A/goose/Yunnan/3798/2006 (A/H5N1) segment 7 (MP) 1653.9 0.000000e+00 954/983 (97%)
EPI164280 A/duck/Yunnan/4873/2006 (A/H5N1) segment 7 (MP) 1653.9 0.000000e+00 954/983 (97%)
EPI164267 A/Jiangxi/1/2005 (A/H5N1) segment 7 (MP) 1653.9 0.000000e+00 953/982 (97%)
EPI123805 A/Chicken/Laos/Xaythiani 32/2006 (A/H5N1) segment 7 (MP) 1653.9 0.000000e+00 954/983 (97%)
EPI111884 A/duck/Hunan/1204/2006 (A/H5N1) segment 7 (MP) 1653.9 0.000000e+00 953/982 (97%)
EPI111878 A/duck/Guiyang/1722/2006 (A/H5N1) segment 7 (MP) 1653.9 0.000000e+00 953/982 (97%)
EPI111641 A/duck/Guiyang/497/2006 (A/H5N1) segment 7 (MP) 1653.9 0.000000e+00 953/982 (97%)
EPI111611 A/duck/Guangxi/288/2006 (A/H5N1) segment 7 (MP) 1653.9 0.000000e+00 954/983 (97%)
EPI111608 A/goose/Guangxi/224/2006 (A/H5N1) segment 7 (MP) 1653.9 0.000000e+00 954/983 (97%)
EPI111587 A/chicken/Guangxi/4989/2005 (A/H5N1) segment 7 (MP) 1653.9 0.000000e+00 954/983 (97%)
EPI135982 A/duck/Hunan/533/2004 (A/H5N1) segment 7 (MP) 1652.0 0.000000e+00 953/982 (97%)
EPI111659 A/goose/Shantou/3295/2006 (A/H5N1) segment 7 (MP) 1652.0 0.000000e+00 950/978 (97%)
EPI111527 A/common magpie/Hong Kong/645/2006 (A/H5N1) segment 7 (MP) 1652.0 0.000000e+00 950/978 (97%)
EPI530991 A/duck/Zhejiang/W24/2013 (A/H5N8) segment 7 (MP) 1648.3 0.000000e+00 952/982 (96%)
EPI408138 A/chicken/Hmawbi/517/2007 (A/H5N1) segment 7 (MP) 1648.3 0.000000e+00 953/983 (96%)
EPI406409 A/Muscovy duck/Ca Mau/22/2007 (A/H5N1) segment 7 (MP) 1648.3 0.000000e+00 953/983 (96%)
EPI406347 A/chicken/Hanoi/45/2007 (A/H5N1) segment 7 (MP) 1648.3 0.000000e+00 953/983 (96%)
EPI406339 A/duck/Soc Trang/31/2007 (A/H5N1) segment 7 (MP) 1648.3 0.000000e+00 953/983 (96%)
EPI361519 A/Chicken/Laos/Xaythiani 26/2006 (A/H5N1) segment 7 (MP) 1648.3 0.000000e+00 953/983 (96%)
EPI350529 A/duck/Vietnam/NCVD-013/2008 (A/H5N1) segment 7 (MP) 1648.3 0.000000e+00 952/982 (96%)
EPI280115 A/Hubei/1/2006 (A/H5N1) segment 7 (MP) 1648.3 0.000000e+00 951/982 (96%)
EPI280091 A/Hunan/1/2006 (A/H5N1) segment 7 (MP) 1648.3 0.000000e+00 953/983 (96%)
EPI276009 A/duck/Hunan/69/2004 (A/H5N1) segment 7 (MP) 1648.3 0.000000e+00 953/983 (96%)
EPI275777 A/chicken/Hunan/21/2005 (A/H5N1) segment 7 (MP) 1648.3 0.000000e+00 953/983 (96%)
EPI275465 A/Guangxi/1/2005 (A/H5N1) segment 7 (MP) 1648.3 0.000000e+00 953/983 (96%)
EPI251424 A/Guangdong/2/2006 (A/H5N1) segment 7 (MP) 1648.3 0.000000e+00 953/983 (96%)
EPI229699 A/crested eagle/Belgium/01/2004 (A/H5N1) segment 7 (MP) 1648.3 0.000000e+00 953/983 (96%)
EPI227011 A/chicken/Ninh Binh/209/2005 (A/H5N1) segment 7 (MP) 1648.3 0.000000e+00 953/983 (96%)
EPI225090 A/duck/Nam Dinh/218/2006 (A/H5) segment 7 (MP) 1648.3 0.000000e+00 953/983 (96%)
EPI180954 A/duck/Laos/25/2006 (A/H5N1) segment 7 (MP) 1648.3 0.000000e+00 953/983 (96%)
EPI174623 A/duck/Hunan/3315/2006 (A/H5N1) segment 7 (MP) 1648.3 0.000000e+00 952/982 (96%)
EPI174615 A/chicken/Hunan/1793/2007 (A/H5N1) segment 7 (MP) 1648.3 0.000000e+00 952/982 (96%)
EPI174613 A/duck/Henan/1650/2006 (A/H5N1) segment 7 (MP) 1648.3 0.000000e+00 952/982 (96%)
EPI170659 A/chicken/Vietnam/209/2005 (A/H5N1) segment 7 (MP) 1648.3 0.000000e+00 953/983 (96%)
EPI170651 A/duck/Vietnam/210/2005 (A/H5N1) segment 7 (MP) 1648.3 0.000000e+00 953/983 (96%)
EPI170644 A/Muscovy duck/Vietnam/211/2005 (A/H5N1) segment 7 (MP) 1648.3 0.000000e+00 953/983 (96%)
EPI170637 A/chicken/Vietnam/212/2005 (A/H5N1) segment 7 (MP) 1648.3 0.000000e+00 953/983 (96%)
EPI170630 A/Muscovy duck/Vietnam/213/2005 (A/H5N1) segment 7 (MP) 1648.3 0.000000e+00 953/983 (96%)
EPI170616 A/chicken/Vietnam/216/2005 (A/H5N1) segment 7 (MP) 1648.3 0.000000e+00 953/983 (96%)
EPI170608 A/Muscovy duck/Vietnam/217/2005 (A/H5N1) segment 7 (MP) 1648.3 0.000000e+00 953/983 (96%)
EPI170600 A/duck/Vietnam/218/2005 (A/H5N1) segment 7 (MP) 1648.3 0.000000e+00 953/983 (96%)
EPI170592 A/duck/Vietnam/219/2005 (A/H5N1) segment 7 (MP) 1648.3 0.000000e+00 953/983 (96%)
EPI164384 A/goose/Yunnan/6384/2006 (A/H5N1) segment 7 (MP) 1648.3 0.000000e+00 952/982 (96%)
EPI164352 A/goose/Yunnan/5599/2006 (A/H5N1) segment 7 (MP) 1648.3 0.000000e+00 952/982 (96%)
EPI164344 A/goose/Yunnan/5540/2006 (A/H5N1) segment 7 (MP) 1648.3 0.000000e+00 952/982 (96%)
EPI164320 A/goose/Yunnan/4389/2006 (A/H5N1) segment 7 (MP) 1648.3 0.000000e+00 953/983 (96%)
EPI164312 A/goose/Yunnan/4371/2006 (A/H5N1) segment 7 (MP) 1648.3 0.000000e+00 953/983 (96%)
EPI164259 A/Guangxi/1/2005 (A/H5N1) segment 7 (MP) 1648.3 0.000000e+00 953/983 (96%)
EPI126692 A/human/China/GD02/2006 (A/H5N1) segment 7 (MP) 1648.3 0.000000e+00 953/983 (96%)
EPI123811 A/Chicken/Laos/Xaythiani 37/2006 (A/H5N1) segment 7 (MP) 1648.3 0.000000e+00 953/983 (96%)
EPI123808 A/Chicken/Laos/Xaythiani 36/2006 (A/H5N1) segment 7 (MP) 1648.3 0.000000e+00 953/983 (96%)
EPI113318 A/Shenzhen/406H/2006 (A/H5N1) segment 7 (MP) 1648.3 0.000000e+00 953/983 (96%)
EPI111938 A/chicken/Fujian/12239/2005 (A/H5N1) segment 7 (MP) 1648.3 0.000000e+00 952/982 (96%)
EPI111929 A/goose/Guangxi/1898/2006 (A/H5N1) segment 7 (MP) 1648.3 0.000000e+00 953/983 (96%)
EPI111920 A/duck/Guangxi/1550/2006 (A/H5N1) segment 7 (MP) 1648.3 0.000000e+00 953/983 (96%)
EPI111917 A/goose/Guangxi/1458/2006 (A/H5N1) segment 7 (MP) 1648.3 0.000000e+00 953/983 (96%)
EPI111722 A/chicken/Fujian/584/2006 (A/H5N1) segment 7 (MP) 1648.3 0.000000e+00 952/982 (96%)
EPI111695 A/chicken/Fujian/9821/2005 (A/H5N1) segment 7 (MP) 1648.3 0.000000e+00 952/982 (96%)
EPI111692 A/duck/Fujian/9713/2005 (A/H5N1) segment 7 (MP) 1648.3 0.000000e+00 952/982 (96%)
EPI111689 A/duck/Fujian/9651/2005 (A/H5N1) segment 7 (MP) 1648.3 0.000000e+00 952/982 (96%)
EPI111671 A/duck/Hunan/5152/2005 (A/H5N1) segment 7 (MP) 1648.3 0.000000e+00 953/983 (96%)
EPI111668 A/duck/Hunan/5106/2005 (A/H5N1) segment 7 (MP) 1648.3 0.000000e+00 953/983 (96%)
EPI111647 A/duck/Shantou/13323/2005 (A/H5N1) segment 7 (MP) 1648.3 0.000000e+00 952/982 (96%)
EPI111635 A/chicken/Guiyang/29/2006 (A/H5N1) segment 7 (MP) 1648.3 0.000000e+00 953/983 (96%)
EPI111614 A/duck/Guangxi/392/2006 (A/H5N1) segment 7 (MP) 1648.3 0.000000e+00 953/983 (96%)
EPI111605 A/duck/Guangxi/150/2006 (A/H5N1) segment 7 (MP) 1648.3 0.000000e+00 953/983 (96%)
EPI111575 A/goose/Guangxi/4289/2005 (A/H5N1) segment 7 (MP) 1648.3 0.000000e+00 953/983 (96%)
EPI111533 A/chicken/Hong Kong/947/2006 (A/H5N1) segment 7 (MP) 1648.3 0.000000e+00 953/983 (96%)
EPI111530 A/little egret/Hong Kong/718/2006 (A/H5N1) segment 7 (MP) 1648.3 0.000000e+00 953/983 (96%)
EPI111515 A/magpie robin/Hong Kong/75/2006 (A/H5N1) segment 7 (MP) 1648.3 0.000000e+00 953/983 (96%)
EPI136001 A/duck/Hunan/733/2004 (A/H5N1) segment 7 (MP) 1646.5 0.000000e+00 952/982 (96%)
EPI111716 A/chicken/Fujian/11933/2005 (A/H5N1) segment 7 (MP) 1646.5 0.000000e+00 947/975 (97%)
EPI111638 A/duck/Guiyang/293/2006 (A/H5N1) segment 7 (MP) 1646.5 0.000000e+00 947/975 (97%)
EPI583875 A/duck/Shaoxing/5240/2013 (A/H0) segment 7 (MP) 1642.8 0.000000e+00 951/982 (96%)
EPI530992 A/duck/Zhejiang/6D18/2013 (A/H5N8) segment 7 (MP) 1642.8 0.000000e+00 951/982 (96%)
EPI500905 A/Chicken/Hunan/S3003/2009 (A/H6N6) segment 7 (MP) 1642.8 0.000000e+00 952/983 (96%)
EPI438178 A/chicken/Thailand/l1nk/2004 (A/H5N1) segment 7 (MP) 1642.8 0.000000e+00 952/983 (96%)
EPI408139 A/quail/Thanatpin/2283/2007 (A/H5N1) segment 7 (MP) 1642.8 0.000000e+00 952/983 (96%)
EPI337266 A/duck feces/Hebei/5/2009 (A/H5N1) segment 7 (MP) 1642.8 0.000000e+00 951/982 (96%)
EPI337258 A/water/Hebei/3/2009 (A/H5N1) segment 7 (MP) 1642.8 0.000000e+00 951/982 (96%)
EPI337250 A/water/Hebei/2/2009 (A/H5N1) segment 7 (MP) 1642.8 0.000000e+00 951/982 (96%)
EPI337242 A/water/Hebei/1/2009 (A/H5N1) segment 7 (MP) 1642.8 0.000000e+00 951/982 (96%)
EPI327186 A/openbill stork/Thailand/VSMU-12-BKK/2003 (A/H5N1) segment 7 (MP) 1642.8 0.000000e+00 952/983 (96%)
EPI327183 A/openbill stork/Thailand/VSMU-5-NSN/2004 (A/H5N1) segment 7 (MP) 1642.8 0.000000e+00 952/983 (96%)
EPI327182 A/openbill stork/Thailand/VSMU-4-NSN/2004 (A/H5N1) segment 7 (MP) 1642.8 0.000000e+00 952/983 (96%)
EPI280211 A/duck feces/Hebei/5/2009 (A/H5N1) segment 7 (MP) 1642.8 0.000000e+00 951/982 (96%)
EPI280203 A/water/Hebei/3/2009 (A/H5N1) segment 7 (MP) 1642.8 0.000000e+00 951/982 (96%)
EPI280195 A/water/Hebei/2/2009 (A/H5N1) segment 7 (MP) 1642.8 0.000000e+00 951/982 (96%)
EPI280187 A/water/Hebei/1/2009 (A/H5N1) segment 7 (MP) 1642.8 0.000000e+00 951/982 (96%)
EPI280147 A/Jiangsu/2/2007 (A/H5N1) segment 7 (MP) 1642.8 0.000000e+00 951/982 (96%)
EPI280139 A/Jiangsu/1/2007 (A/H5N1) segment 7 (MP) 1642.8 0.000000e+00 951/982 (96%)
EPI275673 A/Thailand/WRAIR1724H/2004 (A/H5N1) segment 7 (MP) 1642.8 0.000000e+00 952/983 (96%)
EPI275665 A/Thailand/WRAIR1723H/2004 (A/H5N1) segment 7 (MP) 1642.8 0.000000e+00 952/983 (96%)
EPI275657 A/Thailand/WRAIR1722H/2004 (A/H5N1) segment 7 (MP) 1642.8 0.000000e+00 952/983 (96%)
EPI275649 A/Thailand/WRAIR1721H/2004 (A/H5N1) segment 7 (MP) 1642.8 0.000000e+00 952/983 (96%)
EPI270191 A/Vietnam/UT30850/2005 (A/H5N1) segment 7 (MP) 1642.8 0.000000e+00 950/980 (96%)
EPI251437 A/Shandong/1/2009 (A/H5N1) segment 7 (MP) 1642.8 0.000000e+00 951/982 (96%)
EPI251428 A/Hunan/1/2008 (A/H5N1) segment 7 (MP) 1642.8 0.000000e+00 951/982 (96%)
EPI229664 A/duck/Ang Thong/71 (A/H5N1) segment 7 (MP) 1642.8 0.000000e+00 952/983 (96%)
EPI228352 A/open-bill stork/Thailand/VSMU-9-BKK/2004 (A/H5N1) segment 7 (MP) 1642.8 0.000000e+00 952/983 (96%)
EPI222587 A/scaly-breasted munia/Hong Kong/45/2007 (A/H5N1) segment 7 (MP) 1642.8 0.000000e+00 951/982 (96%)
EPI222005 A/environment/Hunan/1-8/2007 (A/H5N1) segment 7 (MP) 1642.8 0.000000e+00 951/982 (96%)
EPI220533 A/environment/Hunan/6-69/2008 (A/H5N1) segment 7 (MP) 1642.8 0.000000e+00 951/982 (96%)
EPI180930 A/chicken/Laos/33/2008 (A/H5N1) segment 7 (MP) 1642.8 0.000000e+00 951/982 (96%)
EPI180906 A/chicken/Laos/13/2008 (A/H5N1) segment 7 (MP) 1642.8 0.000000e+00 951/982 (96%)
EPI180858 A/chicken/Laos/A0464/2007 (A/H5N1) segment 7 (MP) 1642.8 0.000000e+00 952/983 (96%)
EPI180819 A/chicken/Laos/P0072/2007 (A/H5N1) segment 7 (MP) 1642.8 0.000000e+00 952/983 (96%)
EPI180808 A/chicken/Laos/P0001/2007 (A/H5N1) segment 7 (MP) 1642.8 0.000000e+00 952/983 (96%)
EPI174624 A/duck/Hunan/3340/2006 (A/H5N1) segment 7 (MP) 1642.8 0.000000e+00 951/982 (96%)
EPI174617 A/duck/Hunan/1964/2007 (A/H5N1) segment 7 (MP) 1642.8 0.000000e+00 951/982 (96%)
EPI174616 A/duck/Hunan/1930/2007 (A/H5N1) segment 7 (MP) 1642.8 0.000000e+00 951/982 (96%)
EPI174611 A/chicken/Henan/1362/2006 (A/H5N1) segment 7 (MP) 1642.8 0.000000e+00 951/982 (96%)
EPI174610 A/chicken/Anhui/1089/2007 (A/H5N1) segment 7 (MP) 1642.8 0.000000e+00 951/982 (96%)
EPI174609 A/duck/Hunan/689/2006 (A/H5N1) segment 7 (MP) 1642.8 0.000000e+00 951/982 (96%)
EPI170715 A/chicken/Vietnam/202/2005 (A/H5N1) segment 7 (MP) 1642.8 0.000000e+00 952/983 (96%)
EPI170691 A/duck/Vietnam/205/2005 (A/H5N1) segment 7 (MP) 1642.8 0.000000e+00 952/983 (96%)
EPI170675 A/duck/Vietnam/207/2005 (A/H5N1) segment 7 (MP) 1642.8 0.000000e+00 952/983 (96%)
EPI170667 A/duck/Vietnam/208/2005 (A/H5N1) segment 7 (MP) 1642.8 0.000000e+00 952/983 (96%)
EPI170623 A/duck/Vietnam/215/2005 (A/H5N1) segment 7 (MP) 1642.8 0.000000e+00 952/983 (96%)
EPI168003 A/little egret/Hong Kong/8863/2007 (A/H5N1) segment 7 (MP) 1642.8 0.000000e+00 952/983 (96%)
EPI167206 A/chicken/Suphanburi/NIAH108192/2005 (A/H5N1) segment 7 (MP) 1642.8 0.000000e+00 952/983 (96%)
EPI164376 A/goose/Yunnan/6193/2006 (A/H5N1) segment 7 (MP) 1642.8 0.000000e+00 952/983 (96%)
EPI164368 A/goose/Yunnan/5979/2006 (A/H5N1) segment 7 (MP) 1642.8 0.000000e+00 951/982 (96%)
EPI164360 A/goose/Yunnan/5769/2006 (A/H5N1) segment 7 (MP) 1642.8 0.000000e+00 951/982 (96%)
EPI164336 A/goose/Yunnan/5141/2006 (A/H5N1) segment 7 (MP) 1642.8 0.000000e+00 952/983 (96%)
EPI164288 A/duck/Yunnan/5310/2006 (A/H5N1) segment 7 (MP) 1642.8 0.000000e+00 951/982 (96%)
EPI141280 A/Jiangsu/1/2007 (A/H5N1) segment 7 (MP) 1642.8 0.000000e+00 951/982 (96%)
EPI141272 A/Jiangsu/2/2007 (A/H5N1) segment 7 (MP) 1642.8 0.000000e+00 951/982 (96%)
EPI139583 A/Ck/HK/YU22/2002 (A/H5N1) segment 7 (MP) 1642.8 0.000000e+00 952/983 (96%)
EPI119147 A/duck/Hunan/15/2004 (A/H5N1) segment 7 (MP) 1642.8 0.000000e+00 952/983 (96%)
EPI116590 A/Thailand/SP83/2004 (A/H5N1) segment 7 (MP) 1642.8 0.000000e+00 952/983 (96%)
EPI114698 A/golden pheasant/Thailand/VSMU-21-SPB/2005 (A/H5N1) segment 7 (MP) 1642.8 0.000000e+00 952/983 (96%)
EPI111935 A/duck/Guangxi/2143/2006 (A/H5N1) segment 7 (MP) 1642.8 0.000000e+00 952/983 (96%)
EPI111923 A/goose/Guangxi/1633/2006 (A/H5N1) segment 7 (MP) 1642.8 0.000000e+00 952/983 (96%)
EPI111908 A/chicken/Guangxi/1212/2006 (A/H5N1) segment 7 (MP) 1642.8 0.000000e+00 952/983 (96%)
EPI111890 A/duck/Guiyang/1081/2006 (A/H5N1) segment 7 (MP) 1642.8 0.000000e+00 952/983 (96%)
EPI111887 A/goose/Guiyang/765/2006 (A/H5N1) segment 7 (MP) 1642.8 0.000000e+00 952/983 (96%)
EPI111875 A/goose/Guiyang/1636/2006 (A/H5N1) segment 7 (MP) 1642.8 0.000000e+00 952/983 (96%)
EPI111869 A/goose/Guiyang/1461/2006 (A/H5N1) segment 7 (MP) 1642.8 0.000000e+00 952/983 (96%)
EPI111863 A/duck/Fujian/10160/2005 (A/H5N1) segment 7 (MP) 1642.8 0.000000e+00 951/982 (96%)
EPI111731 A/duck/Fujian/720/2006 (A/H5N1) segment 7 (MP) 1642.8 0.000000e+00 951/982 (96%)
EPI111725 A/duck/Fujian/668/2006 (A/H5N1) segment 7 (MP) 1642.8 0.000000e+00 951/982 (96%)
EPI111719 A/duck/Fujian/12032/2005 (A/H5N1) segment 7 (MP) 1642.8 0.000000e+00 951/982 (96%)
EPI111710 A/duck/Fujian/11094/2005 (A/H5N1) segment 7 (MP) 1642.8 0.000000e+00 951/982 (96%)
EPI111521 A/magpie robin/Hong Kong/366/2006 (A/H5N1) segment 7 (MP) 1642.8 0.000000e+00 952/983 (96%)
EPI102697 A/little grebe/Thailand/Phichit-01/2004 (A/H5N1) segment 7 (MP) 1642.8 0.000000e+00 952/983 (96%)
EPI100590 A/duck/Hunan/149/2005 (A/H5N1) segment 7 (MP) 1642.8 0.000000e+00 952/983 (96%)
EPI26407 A/Chicken/Henan/16/2004 (A/H5N1) segment 7 (MP) 1642.8 0.000000e+00 952/983 (96%)
EPI26395 A/chicken/Henan/01/2004 (A/H5N1) segment 7 (MP) 1642.8 0.000000e+00 952/983 (96%)
EPI20568 A/Ck/HK/61.9/02 (A/H5N1) segment 7 (MP) 1642.8 0.000000e+00 952/983 (96%)
EPI135640 A/silky chicken/Shantou/4071/2002 (A/H5N1) segment 7 (MP) 1640.9 0.000000e+00 951/982 (96%)
EPI135621 A/chicken/Shantou/4059/2002 (A/H5N1) segment 7 (MP) 1640.9 0.000000e+00 951/982 (96%)
EPI135583 A/quail/Shantou/3846/2002 (A/H5N1) segment 7 (MP) 1640.9 0.000000e+00 951/982 (96%)
EPI111524 A/crested myna/Hong Kong/540/2006 (A/H5N1) segment 7 (MP) 1640.9 0.000000e+00 946/975 (97%)
EPI22975 A/Dk/HN/5806/2003 (A/H5N1) segment 7 (MP) 1640.9 0.000000e+00 951/982 (96%)
EPI22879 A/Gs/Thailand/79/2004 (A/H5N1) segment 7 (MP) 1640.9 0.000000e+00 951/982 (96%)
EPI22876 A/Dk/Thailand/71.1/2004 (A/H5N1) segment 7 (MP) 1640.9 0.000000e+00 951/982 (96%)
EPI22867 A/Ck/Thailand/9.1/2004 (A/H5N1) segment 7 (MP) 1640.9 0.000000e+00 951/982 (96%)
EPI167775 A/Muscovy duck/Vietnam/NCVD-46/2007 (A/H5N1) segment 7 (MP) 1639.1 0.000000e+00 948/978 (96%)
EPI167769 A/chicken/Vietnam/NCVD-45/2007 (A/H5N1) segment 7 (MP) 1639.1 0.000000e+00 948/978 (96%)
EPI123802 A/Chicken/Laos/Xaythiani 26/2006 (A/H5N1) segment 7 (MP) 1639.1 0.000000e+00 951/983 (96%)
EPI561504 A/Baikal teal/Korea/H52/2014 (A/H5N8) segment 7 (MP) 1637.3 0.000000e+00 950/982 (96%)
EPI509701 A/breeder duck/Korea/Gochang1/2014 (A/H5N8) segment 7 (MP) 1637.3 0.000000e+00 950/982 (96%)
EPI448902 A/chicken/Bangladesh/3012/2011 (A/H5N1) segment 7 (MP) 1637.3 0.000000e+00 951/983 (96%)
EPI406387 A/chicken/Ha Tay/44/2007 (A/H5N1) segment 7 (MP) 1637.3 0.000000e+00 951/983 (96%)
EPI368257 A/chicken/Thailand/TS02/2006 (A/H5N1) segment 7 (MP) 1637.3 0.000000e+00 951/983 (96%)
EPI368249 A/duck/Thailand/TS01/2006 (A/H5N1) segment 7 (MP) 1637.3 0.000000e+00 951/983 (96%)
EPI351431 A/muscovy duck/Vietnam/NCVD-079/2008 (A/H5N1) segment 7 (MP) 1637.3 0.000000e+00 951/983 (96%)
EPI337306 A/water/Xinjiang/3/2009 (A/H5N1) segment 7 (MP) 1637.3 0.000000e+00 951/983 (96%)
EPI337274 A/environment/Guizhou/2/2009 (A/H5N1) segment 7 (MP) 1637.3 0.000000e+00 951/983 (96%)
EPI327185 A/openbill stork/Thailand/VSMU-8-BKK/2004 (A/H5N1) segment 7 (MP) 1637.3 0.000000e+00 951/983 (96%)
EPI327184 A/openbill stork/Thailand/VSMU-6-BKK/2004 (A/H5N1) segment 7 (MP) 1637.3 0.000000e+00 952/984 (96%)
EPI327181 A/chicken/Thailand/ICRC-7372/2010 (A/H5N1) segment 7 (MP) 1637.3 0.000000e+00 952/984 (96%)
EPI327180 A/chicken/Thailand/ICRC-7356/2010 (A/H5N1) segment 7 (MP) 1637.3 0.000000e+00 952/984 (96%)
EPI314323 A/pigeon/Thailand/VSMU-7-NPT/2004 (A/H5N1) segment 7 (MP) 1637.3 0.000000e+00 952/984 (96%)
EPI286282 A/duck/Mong Cai/07-58/2007 (A/H5N1) segment 7 (MP) 1637.3 0.000000e+00 950/982 (96%)
EPI280251 A/water/Xinjiang/3/2009 (A/H5N1) segment 7 (MP) 1637.3 0.000000e+00 951/983 (96%)
EPI280155 A/Beijing/1/2009 (A/H5N1) segment 7 (MP) 1637.3 0.000000e+00 950/982 (96%)
EPI276025 A/duck/Jiangxi/80/2005 (A/H5N1) segment 7 (MP) 1637.3 0.000000e+00 950/982 (96%)
EPI275641 A/Thailand/WRAIR1720H/2004 (A/H5N1) segment 7 (MP) 1637.3 0.000000e+00 951/983 (96%)
EPI251438 A/Xinjiang/1/2009 (A/H5N1) segment 7 (MP) 1637.3 0.000000e+00 951/983 (96%)
EPI235899 A/duck/Shanghai/xj/2002 (A/H5N1) segment 7 (MP) 1637.3 0.000000e+00 951/983 (96%)
EPI228709 A/duck/Chonburi/Thailand/CU-5/04 (A/H5N1) segment 7 (MP) 1637.3 0.000000e+00 952/984 (96%)
EPI226906 A/brown-headed gull/VSMU-28-SPK/2005 (A/H5N1) segment 7 (MP) 1637.3 0.000000e+00 952/984 (96%)
EPI222876 A/tree sparrow/Jiangsu/1/2008 (A/H5N1) segment 7 (MP) 1637.3 0.000000e+00 950/982 (96%)
EPI221900 A/duck/Hunan/3/2007 (A/H5N1) segment 7 (MP) 1637.3 0.000000e+00 951/983 (96%)
EPI220372 A/chicken/Thailand/ST-351/2008 (A/H5N1) segment 7 (MP) 1637.3 0.000000e+00 952/984 (96%)
EPI180946 A/chicken/Laos/37/2008 (A/H5N1) segment 7 (MP) 1637.3 0.000000e+00 950/982 (96%)
EPI180938 A/chicken/Laos/35/2008 (A/H5N1) segment 7 (MP) 1637.3 0.000000e+00 950/982 (96%)
EPI180834 A/duck/Laos/P0117/2007 (A/H5N1) segment 7 (MP) 1637.3 0.000000e+00 951/983 (96%)
EPI175653 A/duck/Hubei/Hangmei01/2006 (A/H5N1) segment 7 (MP) 1637.3 0.000000e+00 950/982 (96%)
EPI174622 A/chicken/Hunan/3157/2006 (A/H5N1) segment 7 (MP) 1637.3 0.000000e+00 950/982 (96%)
EPI174621 A/chicken/Hubei/3002/2007 (A/H5N1) segment 7 (MP) 1637.3 0.000000e+00 950/982 (96%)
EPI174619 A/chicken/Hubei/2856/2007 (A/H5N1) segment 7 (MP) 1637.3 0.000000e+00 950/982 (96%)
EPI174618 A/duck/Hunan/1994/2007 (A/H5N1) segment 7 (MP) 1637.3 0.000000e+00 950/982 (96%)
EPI168019 A/common buzzard/Hong Kong/9213/2007 (A/H5N1) segment 7 (MP) 1637.3 0.000000e+00 951/983 (96%)
EPI167211 A/pigeon/Thailand/VSMU-11-KRI/2005 (A/H5N1) segment 7 (MP) 1637.3 0.000000e+00 951/983 (96%)
EPI167204 A/chicken/Suphanburi/NIAH7540/2004 (A/H5N1) segment 7 (MP) 1637.3 0.000000e+00 951/983 (96%)
EPI167201 A/chicken/Kohn Kaen/NIAH330/2004 (A/H5N1) segment 7 (MP) 1637.3 0.000000e+00 952/984 (96%)
EPI164296 A/duck/Yunnan/6490/2006 (A/H5N1) segment 7 (MP) 1637.3 0.000000e+00 951/983 (96%)
EPI154810 A/Kalij pheasant/Thailand/vsmu-1/2008 (A/H5N1) segment 7 (MP) 1637.3 0.000000e+00 952/984 (96%)
EPI152383 A/Thailand/16/2004 (A/H5N1) segment 7 (MP) 1637.3 0.000000e+00 952/984 (96%)
EPI131998 A/chicken/Vietnam/15/2004 (A/H5N1) segment 7 (MP) 1637.3 0.000000e+00 951/983 (96%)
EPI126168 A/chicken/Thailand/ICRC-V143/2007 (A/H5N1) segment 7 (MP) 1637.3 0.000000e+00 952/984 (96%)
EPI117932 A/chicken/Thailand/vsmu-3-BKK/2004 (A/H5N1) segment 7 (MP) 1637.3 0.000000e+00 952/984 (96%)
EPI116605 A/chicken/Laos/7191/2004 (A/H5N1) segment 7 (MP) 1637.3 0.000000e+00 951/983 (96%)
EPI116602 A/chicken/Viet Nam/1/2004 (A/H5N1) segment 7 (MP) 1637.3 0.000000e+00 951/983 (96%)
EPI116599 A/Thailand/16/2004 (A/H5N1) segment 7 (MP) 1637.3 0.000000e+00 952/984 (96%)
EPI116596 A/Thailand/Chaiyaphum/622/2004 (A/H5N1) segment 7 (MP) 1637.3 0.000000e+00 952/984 (96%)
EPI115362 A/chicken/Thailand/2/04 (A/H5N1) segment 7 (MP) 1637.3 0.000000e+00 952/984 (96%)
EPI114712 A/Tiger/Thailand/VSMU-1-SPB/2004 (A/H5N1) segment 7 (MP) 1637.3 0.000000e+00 952/984 (96%)
EPI111914 A/duck/Guangxi/1436/2006 (A/H5N1) segment 7 (MP) 1637.3 0.000000e+00 951/983 (96%)
EPI111899 A/chicken/Guiyang/1655/2006 (A/H5N1) segment 7 (MP) 1637.3 0.000000e+00 950/982 (96%)
EPI111881 A/goose/Guiyang/1794/2006 (A/H5N1) segment 7 (MP) 1637.3 0.000000e+00 951/983 (96%)
EPI111866 A/duck/Fujian/10389/2005 (A/H5N1) segment 7 (MP) 1637.3 0.000000e+00 950/982 (96%)
EPI111704 A/chicken/Fujian/10567/2005 (A/H5N1) segment 7 (MP) 1637.3 0.000000e+00 950/982 (96%)
EPI111662 A/chicken/Shantou/3840/2006 (A/H5N1) segment 7 (MP) 1637.3 0.000000e+00 950/982 (96%)
EPI111653 A/chicken/Shantou/1233/2006 (A/H5N1) segment 7 (MP) 1637.3 0.000000e+00 950/982 (96%)
EPI111599 A/goose/Guangxi/5414/2005 (A/H5N1) segment 7 (MP) 1637.3 0.000000e+00 951/983 (96%)
EPI111545 A/duck/Guangxi/89/2006 (A/H5N1) segment 7 (MP) 1637.3 0.000000e+00 951/983 (96%)
EPI111536 A/duck/Guiyang/2231/2005 (A/H5N1) segment 7 (MP) 1637.3 0.000000e+00 951/983 (96%)
EPI111488 A/Japanese white-eye/Hong Kong/1038/2006 (A/H5N1) segment 7 (MP) 1637.3 0.000000e+00 951/983 (96%)
EPI108730 A/chicken/Jiangsu/cz1/2002 (A/H5N1) segment 7 (MP) 1637.3 0.000000e+00 951/983 (96%)
EPI107205 A/open-billed stork/Nakhonsawan/BBD0404F/2004 (A/H5N1) segment 7 (MP) 1637.3 0.000000e+00 951/983 (96%)
EPI107186 A/open-billed stork/Nakhonsawan/BBD0104F/2004 (A/H5N1) segment 7 (MP) 1637.3 0.000000e+00 951/983 (96%)
EPI105558 A/human/Zhejiang/16/2006 (A/H5N1) segment 7 (MP) 1637.3 0.000000e+00 950/982 (96%)
EPI101759 A/Thailand/676/2005 (A/H5N1) segment 7 (MP) 1637.3 0.000000e+00 951/983 (96%)
EPI100636 A/chicken/Hong Kong/86.3/2002 (A/H5N1) segment 7 (MP) 1637.3 0.000000e+00 952/984 (96%)
EPI97075 A/quail/Viet Nam/TG-007B/2004 (A/H5N1) segment 7 (MP) 1637.3 0.000000e+00 951/983 (96%)
EPI25617 A/quail/Vietnam/36/04 (A/H5N1) segment 7 (MP) 1637.3 0.000000e+00 951/983 (96%)
EPI25307 A/chicken/Hubei/489/2004 (A/H5N1) segment 7 (MP) 1637.3 0.000000e+00 951/983 (96%)
EPI24695 A/chicken/Hubei/327/2004 (A/H5N1) segment 7 (MP) 1637.3 0.000000e+00 951/983 (96%)
EPI22978 A/Dk/ST/4003/2003 (A/H5N1) segment 7 (MP) 1637.3 0.000000e+00 949/980 (96%)
EPI22870 A/Qa/Thailand/57/2004 (A/H5N1) segment 7 (MP) 1637.3 0.000000e+00 951/983 (96%)
EPI21943 A/Thailand/2(SP-33)/2004 (A/H5N1) segment 7 (MP) 1637.3 0.000000e+00 952/984 (96%)
EPI20570 A/Ck/HK/YU777/02 (A/H5N1) segment 7 (MP) 1637.3 0.000000e+00 951/983 (96%)
EPI136153 A/chicken/Yunnan/1083/2003 (A/H5N1) segment 7 (MP) 1635.4 0.000000e+00 950/982 (96%)
EPI136134 A/duck/Yunnan/662/2003 (A/H5N1) segment 7 (MP) 1635.4 0.000000e+00 950/982 (96%)
EPI136115 A/chicken/Yunnan/564/2003 (A/H5N1) segment 7 (MP) 1635.4 0.000000e+00 950/982 (96%)
EPI136096 A/duck/Yunnan/215/2003 (A/H5N1) segment 7 (MP) 1635.4 0.000000e+00 950/982 (96%)
EPI136077 A/duck/Yunnan/119/2003 (A/H5N1) segment 7 (MP) 1635.4 0.000000e+00 950/982 (96%)
EPI136058 A/chicken/Yunnan/1215/2002 (A/H5N1) segment 7 (MP) 1635.4 0.000000e+00 950/982 (96%)
EPI135944 A/duck/Hunan/782/2003 (A/H5N1) segment 7 (MP) 1635.4 0.000000e+00 950/982 (96%)
EPI135868 A/duck/Hunan/795/2002 (A/H5N1) segment 7 (MP) 1635.4 0.000000e+00 950/982 (96%)
EPI135849 A/chicken/Hunan/23/2002 (A/H5N1) segment 7 (MP) 1635.4 0.000000e+00 950/982 (96%)
EPI135811 A/chukar/Shantou/4690/2003 (A/H5N1) segment 7 (MP) 1635.4 0.000000e+00 949/981 (96%)
EPI135602 A/chicken/Shantou/3900/2002 (A/H5N1) segment 7 (MP) 1635.4 0.000000e+00 950/982 (96%)
EPI135564 A/quail/Shantou/3071/2002 (A/H5N1) segment 7 (MP) 1635.4 0.000000e+00 950/982 (96%)
EPI135545 A/quail/Shantou/3054/2002 (A/H5N1) segment 7 (MP) 1635.4 0.000000e+00 950/982 (96%)
EPI135526 A/partridge/Shantou/1075/2002 (A/H5N1) segment 7 (MP) 1635.4 0.000000e+00 950/982 (96%)
EPI111728 A/duck/Fujian/671/2006 (A/H5N1) segment 7 (MP) 1635.4 0.000000e+00 947/978 (96%)
EPI111698 A/chicken/Fujian/10039/2005 (A/H5N1) segment 7 (MP) 1635.4 0.000000e+00 945/975 (96%)
EPI103735 A/chicken/Vietnam/53/2004 (A/H5N1) segment 7 (MP) 1635.4 0.000000e+00 950/982 (96%)
EPI103699 A/chicken/Vietnam/52/2004 (A/H5N1) segment 7 (MP) 1635.4 0.000000e+00 950/982 (96%)
EPI103621 A/duck/Vietnam/17/2003 (A/H5N1) segment 7 (MP) 1635.4 0.000000e+00 950/982 (96%)
EPI103618 A/mallard/Vietnam/16/2003 (A/H5N1) segment 7 (MP) 1635.4 0.000000e+00 950/982 (96%)
EPI100602 A/chicken/Hunan/999/2005 (A/H5N1) segment 7 (MP) 1635.4 0.000000e+00 950/982 (96%)
EPI22900 A/Ck/Viet Nam/36/2004 (A/H5N1) segment 7 (MP) 1635.4 0.000000e+00 950/982 (96%)
EPI22873 A/bird/Thailand/3.1/2004 (A/H5N1) segment 7 (MP) 1635.4 0.000000e+00 951/983 (96%)
EPI135355 A/duck/Shantou/5526/2001 (A/H5N1) segment 7 (MP) 1633.6 0.000000e+00 949/981 (96%)
EPI22996 A/Dk/HN/303/2004 (A/H5N1) segment 7 (MP) 1633.6 0.000000e+00 949/981 (96%)
EPI463686 A/swine/Jiangsu/2/2009 (A/H5N1) segment 7 (MP) 1631.7 0.000000e+00 949/982 (96%)
EPI438231 A/rosybilled pochard/Hong Kong/821/2002 (A/H5N1) segment 7 (MP) 1631.7 0.000000e+00 950/983 (96%)
EPI408140 A/village chicken/Kyaing Tong/2433/2007 (A/H5N1) segment 7 (MP) 1631.7 0.000000e+00 950/983 (96%)
EPI384251 A/parrot/Guangdong/C99/2005 (A/H5N1) segment 7 (MP) 1631.7 0.000000e+00 950/983 (96%)
EPI383217 A/chicken/Yangon/254/2010 (A/H5N1) segment 7 (MP) 1631.7 0.000000e+00 950/983 (96%)
EPI356526 A/chicken/East Java/BL-IPA/2003 (A/H5N1) segment 7 (MP) 1631.7 0.000000e+00 950/983 (96%)
EPI351438 A/muscovy duck/Vietnam/NCVD-082/2008 (A/H5N1) segment 7 (MP) 1631.7 0.000000e+00 950/983 (96%)
EPI351336 A/muscovy duck/Vietnam/NCVD-034/2008 (A/H5N1) segment 7 (MP) 1631.7 0.000000e+00 950/983 (96%)
EPI350690 A/duck/Vietnam/NCVD-116/2007 (A/H5N1) segment 7 (MP) 1631.7 0.000000e+00 950/983 (96%)
EPI349938 A/chicken/Vietnam/NCVD-083/2008 (A/H5N1) segment 7 (MP) 1631.7 0.000000e+00 950/983 (96%)
EPI349850 A/chicken/Vietnam/NCVD-035/2008 (A/H5N1) segment 7 (MP) 1631.7 0.000000e+00 950/983 (96%)
EPI280219 A/environment/Guizhou/2/2009 (A/H5N1) segment 7 (MP) 1631.7 0.000000e+00 950/983 (96%)
EPI280131 A/Fujian/1/2007 (A/H5N1) segment 7 (MP) 1631.7 0.000000e+00 950/983 (96%)
EPI276049 A/goose/Hubei/65/2005 (A/H5N1) segment 7 (MP) 1631.7 0.000000e+00 949/982 (96%)
EPI276001 A/duck/Hunan/29/2006 (A/H5N1) segment 7 (MP) 1631.7 0.000000e+00 950/983 (96%)
EPI275969 A/duck/Anhui/56/2005 (A/H5N1) segment 7 (MP) 1631.7 0.000000e+00 950/983 (96%)
EPI275841 A/chicken/Shandong/A-1/2009 (A/H5N1) segment 7 (MP) 1631.7 0.000000e+00 949/982 (96%)
EPI275381 A/Anhui/1/2005 (A/H5N1) segment 7 (MP) 1631.7 0.000000e+00 950/983 (96%)
EPI235175 A/goose/Jilin/hb/2003 (A/H5N1) segment 7 (MP) 1631.7 0.000000e+00 950/983 (96%)
EPI235136 A/duck/Hubei/wq/2003 (A/H5N1) segment 7 (MP) 1631.7 0.000000e+00 950/983 (96%)
EPI235135 A/duck/Hubei/wp/2003 (A/H5N1) segment 7 (MP) 1631.7 0.000000e+00 950/983 (96%)
EPI229542 A/pigeon/Thailand/1B/2004 (A/H5N1) segment 7 (MP) 1631.7 0.000000e+00 951/984 (96%)
EPI229534 A/environment/Viet Nam/1203/2004 (A/H5N1) segment 7 (MP) 1631.7 0.000000e+00 950/983 (96%)
EPI228869 A/swine/Henan/wy/2004 (A/H5N1) segment 7 (MP) 1631.7 0.000000e+00 950/983 (96%)
EPI228797 A/Vietnam/CL02/2004 (A/H5N1) segment 7 (MP) 1631.7 0.000000e+00 950/983 (96%)
EPI228353 A/open-bill stork/Thailand/VSMU-20-AYA/2004 (A/H5N1) segment 7 (MP) 1631.7 0.000000e+00 950/983 (96%)
EPI227296 A/Mallard/Huadong/S/2005 (A/H5N1) segment 7 (MP) 1631.7 0.000000e+00 950/983 (96%)
EPI226987 A/chicken/Lang Son/200/2005 (A/H5N1) segment 7 (MP) 1631.7 0.000000e+00 950/983 (96%)
EPI222029 A/environment/Hunan/5-25/2007 (A/H5N1) segment 7 (MP) 1631.7 0.000000e+00 950/983 (96%)
EPI221747 A/chicken/Hunan/3/2007 (A/H5N1) segment 7 (MP) 1631.7 0.000000e+00 950/983 (96%)
EPI221583 A/Daurian starling/Hong Kong/1532/2007 (A/H5N1) segment 7 (MP) 1631.7 0.000000e+00 950/983 (96%)

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Wed Oct 14, 2015 11:55 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
EPI620455 A/chicken/Iowa/14589-1/2015 (A/H5N2) segment 1 (PB2) 4211.5 0.000000e+00 2280/2280 (100%)
EPI620427 A/turkey/Iowa/14318-1/2015 (A/H5N2) segment 1 (PB2) 4211.5 0.000000e+00 2280/2280 (100%)
EPI620420 A/chicken/Iowa/13542-2/2015 (A/H5N2) segment 1 (PB2) 4211.5 0.000000e+00 2280/2280 (100%)
EPI620413 A/turkey/Iowa/13541-1/2015 (A/H5N2) segment 1 (PB2) 4211.5 0.000000e+00 2280/2280 (100%)
EPI587630 A/chicken/Iowa/04-20/2015 (A/H5N2) segment 1 (PB2) 4211.5 0.000000e+00 2280/2280 (100%)
EPI620448 A/chicken/Iowa/14399-4/2015 (A/H5N2) segment 1 (PB2) 4205.9 0.000000e+00 2279/2280 (99%)
EPI620441 A/chicken/Iowa/14322-6/2015 (A/H5N2) segment 1 (PB2) 4205.9 0.000000e+00 2279/2280 (99%)
EPI620434 A/turkey/Iowa/14319-1/2015 (A/H5N2) segment 1 (PB2) 4205.9 0.000000e+00 2279/2280 (99%)
EPI590738 A/turkey/Minnesota/9845-4/2015 (A/H5N2) segment 1 (PB2) 4205.9 0.000000e+00 2279/2280 (99%)
EPI620406 A/turkey/Iowa/11762-1/2015 (A/H5N2) segment 1 (PB2) 4194.9 0.000000e+00 2277/2280 (99%)
EPI590724 A/turkey/Arkansas/7791-1/2015 (A/H5N2) segment 1 (PB2) 4194.9 0.000000e+00 2277/2280 (99%)
EPI590683 A/turkey/Minnesota/9892-2/2015 (A/H5N2) segment 1 (PB2) 4194.9 0.000000e+00 2277/2280 (99%)
EPI586531 A/chicken/BC/FAV22/2014 (A/H5N2) segment 1 (PB2) 4194.9 0.000000e+00 2277/2280 (99%)
EPI586498 A/poultry/BC/FAV17/2014 (A/H5N2) segment 1 (PB2) 4194.9 0.000000e+00 2277/2280 (99%)
EPI586490 A/poultry/BC/FAV15/2014 (A/H5N2) segment 1 (PB2) 4194.9 0.000000e+00 2277/2280 (99%)
EPI573296 A/turkey/BC/FAV10/2014 (A/H5N2) segment 1 (PB2) 4194.9 0.000000e+00 2277/2280 (99%)
EPI573279 A/turkey/Washington/61-22/2014 (A/H5N2) segment 1 (PB2) 4194.9 0.000000e+00 2277/2280 (99%)
EPI573274 A/domestic duck/Washington/61-16/2014 (A/H5N2) segment 1 (PB2) 4194.9 0.000000e+00 2277/2280 (99%)
EPI590731 A/chicken/Kansas/8395-3/2015 (A/H5N2) segment 1 (PB2) 4189.3 0.000000e+00 2276/2280 (99%)
EPI590717 A/turkey/Missouri/7458-1/2015 (A/H5N2) segment 1 (PB2) 4189.3 0.000000e+00 2276/2280 (99%)
EPI586555 A/chicken/BC/FAV25/2014 (A/H5N2) segment 1 (PB2) 4189.3 0.000000e+00 2276/2280 (99%)
EPI586547 A/chicken/BC/FAV24/2014 (A/H5N2) segment 1 (PB2) 4189.3 0.000000e+00 2276/2280 (99%)
EPI586539 A/chicken/BC/FAV23/2014 (A/H5N2) segment 1 (PB2) 4189.3 0.000000e+00 2276/2280 (99%)
EPI586523 A/chicken/BC/FAV21/2014 (A/H5N2) segment 1 (PB2) 4189.3 0.000000e+00 2276/2280 (99%)
EPI585089 A/pheasant/Washington/3147-2/2015 (A/H5N2) segment 1 (PB2) 4189.3 0.000000e+00 2276/2280 (99%)
EPI584076 A/turkey/BC/FAV14/2014 (A/H5N2) segment 1 (PB2) 4189.3 0.000000e+00 2276/2280 (99%)
EPI576475 A/chicken/BC/FAV9/2014 (A/H5N2) segment 1 (PB2) 4189.3 0.000000e+00 2276/2280 (99%)
EPI576468 A/chicken/BC/FAV8/2014 (A/H5N2) segment 1 (PB2) 4189.3 0.000000e+00 2276/2280 (99%)
EPI573269 A/chicken/Washington/61-9/2014 (A/H5N2) segment 1 (PB2) 4189.3 0.000000e+00 2276/2280 (99%)
EPI569380 A/gyrfalcon/Washington/41088-6/2014 (A/H5N8) segment 1 (PB2) 4189.3 0.000000e+00 2276/2280 (99%)
EPI569379 A/Northern pintail/Washington/40964/2014 (A/H5N2) segment 1 (PB2) 4189.3 0.000000e+00 2276/2280 (99%)
EPI590710 A/turkey/Minnesota/7172-1/2015 (A/H5N2) segment 1 (PB2) 4183.8 0.000000e+00 2275/2280 (99%)
EPI590697 A/chicken/Oregon/A01819044/2015 (A/H5N2) segment 1 (PB2) 4183.8 0.000000e+00 2275/2280 (99%)
EPI586515 A/chicken/BC/FAV20/2014 (A/H5N2) segment 1 (PB2) 4183.8 0.000000e+00 2275/2280 (99%)
EPI585081 A/turkey/California/K1500169-1.2/2015 (A/H5N8) segment 1 (PB2) 4183.8 0.000000e+00 2275/2280 (99%)
EPI569369 A/guinea fowl/Oregon/41613-1/2014 (A/H5N8) segment 1 (PB2) 4183.8 0.000000e+00 2275/2280 (99%)
EPI569367 A/chicken/Oregon/41613-2/2014 (A/H5N8) segment 1 (PB2) 4183.8 0.000000e+00 2275/2280 (99%)
EPI586506 A/poultry/BC/FAV19/2014 (A/H5N2) segment 1 (PB2) 4180.1 0.000000e+00 2274/2280 (99%)
EPI590690 A/chicken/Washington/3490-18/2015 (A/H5N2) segment 1 (PB2) 4178.2 0.000000e+00 2274/2280 (99%)
EPI587519 A/American wigeon/BC/050-31/2015 (A/H5N8) segment 1 (PB2) 4178.2 0.000000e+00 2274/2280 (99%)
EPI573283 A/American green-winged teal/Washington/195750/2014 (A/H5N1) segment 1 (PB2) 4172.7 0.000000e+00 2273/2280 (99%)
EPI588949 A/goose/Taiwan/a015/2015 (A/H5N8) segment 1 (PB2) 4145.0 0.000000e+00 2268/2280 (99%)
EPI553205 A/crane/Kagoshima/KU1/2014 (A/H5N8) segment 1 (PB2) 4145.0 0.000000e+00 2268/2280 (99%)
EPI585557 A/baikal teal/Korea/2417/2014 (A/H5N8) segment 1 (PB2) 4139.5 0.000000e+00 2267/2280 (99%)
EPI585556 A/baikal teal/Korea/2416/2014 (A/H5N8) segment 1 (PB2) 4139.5 0.000000e+00 2267/2280 (99%)
EPI585553 A/baikal teal/Korea/2403/2014 (A/H5N8) segment 1 (PB2) 4139.5 0.000000e+00 2267/2280 (99%)
EPI585543 A/baikal teal/Korea/1447/2014 (A/H5N8) segment 1 (PB2) 4139.5 0.000000e+00 2267/2280 (99%)
EPI585541 A/baikal teal/Korea/1445/2014 (A/H5N8) segment 1 (PB2) 4139.5 0.000000e+00 2267/2280 (99%)
EPI561702 A/bean goose/Korea/H40/2014 (A/H5N8) segment 1 (PB2) 4139.5 0.000000e+00 2267/2280 (99%)
EPI561672 A/bean goose/Korea/H328/2014 (A/H5N8) segment 1 (PB2) 4139.5 0.000000e+00 2267/2280 (99%)
EPI561631 A/white-fronted goose/Korea/H231/2014 (A/H5N8) segment 1 (PB2) 4139.5 0.000000e+00 2267/2280 (99%)
EPI561624 A/mallard/Korea/H207/2014 (A/H5N8) segment 1 (PB2) 4139.5 0.000000e+00 2267/2280 (99%)
EPI561568 A/Baikal teal/Korea/H96/2014 (A/H5N8) segment 1 (PB2) 4139.5 0.000000e+00 2267/2280 (99%)
EPI561540 A/Baikal teal/Korea/H68/2014 (A/H5N8) segment 1 (PB2) 4139.5 0.000000e+00 2267/2280 (99%)
EPI561527 A/Baikal teal/Korea/H66/2014 (A/H5N8) segment 1 (PB2) 4139.5 0.000000e+00 2267/2280 (99%)
EPI561506 A/bean goose/Korea/H53/2014 (A/H5N8) segment 1 (PB2) 4139.5 0.000000e+00 2267/2280 (99%)
EPI561358 A/broiler duck/Korea/H49/2014 (A/H5N8) segment 1 (PB2) 4139.5 0.000000e+00 2267/2280 (99%)
EPI585554 A/baikal teal/Korea/2406/2014 (A/H5N8) segment 1 (PB2) 4133.9 0.000000e+00 2266/2280 (99%)
EPI585551 A/baikal teal/Korea/2399/2014 (A/H5N8) segment 1 (PB2) 4133.9 0.000000e+00 2266/2280 (99%)
EPI585550 A/baikal teal/Korea/1458/2014 (A/H5N8) segment 1 (PB2) 4133.9 0.000000e+00 2266/2280 (99%)
EPI585548 A/baikal teal/Korea/1456/2014 (A/H5N8) segment 1 (PB2) 4133.9 0.000000e+00 2266/2280 (99%)
EPI585546 A/baikal teal/Korea/1452/2014 (A/H5N8) segment 1 (PB2) 4133.9 0.000000e+00 2266/2280 (99%)
EPI585545 A/baikal teal/Korea/1449/2014 (A/H5N8) segment 1 (PB2) 4133.9 0.000000e+00 2266/2280 (99%)
EPI585544 A/baikal teal/Korea/1448/2014 (A/H5N8) segment 1 (PB2) 4133.9 0.000000e+00 2266/2280 (99%)
EPI585539 A/baikal teal/Korea/1437/2014 (A/H5N8) segment 1 (PB2) 4133.9 0.000000e+00 2266/2280 (99%)
EPI561610 A/breeder duck/Korea/H158/2014 (A/H5N8) segment 1 (PB2) 4133.9 0.000000e+00 2266/2280 (99%)
EPI561603 A/broiler duck/Korea/H145/2014 (A/H5N8) segment 1 (PB2) 4133.9 0.000000e+00 2266/2280 (99%)
EPI561575 A/breeder chicken/Korea/H122/2014 (A/H5N8) segment 1 (PB2) 4133.9 0.000000e+00 2266/2280 (99%)
EPI561561 A/Baikal teal/Korea/H84/2014 (A/H5N8) segment 1 (PB2) 4133.9 0.000000e+00 2266/2280 (99%)
EPI561513 A/Baikal teal/Korea/H62/2014 (A/H5N8) segment 1 (PB2) 4133.9 0.000000e+00 2266/2280 (99%)
EPI561353 A/broiler duck/Korea/H48/2014 (A/H5N8) segment 1 (PB2) 4133.9 0.000000e+00 2266/2280 (99%)
EPI561339 A/Baikal teal/Korea/H41/2014 (A/H5N8) segment 1 (PB2) 4133.9 0.000000e+00 2266/2280 (99%)
EPI585555 A/baikal teal/Korea/2414/2014 (A/H5N8) segment 1 (PB2) 4128.4 0.000000e+00 2265/2280 (99%)
EPI585549 A/baikal teal/Korea/1457/2014 (A/H5N8) segment 1 (PB2) 4128.4 0.000000e+00 2265/2280 (99%)
EPI585542 A/baikal teal/Korea/1446/2014 (A/H5N8) segment 1 (PB2) 4128.4 0.000000e+00 2265/2280 (99%)
EPI585540 A/baikal teal/Korea/1441/2014 (A/H5N8) segment 1 (PB2) 4128.4 0.000000e+00 2265/2280 (99%)
EPI573635 A/crane/Kagoshima/KU13/2014(H5N8) (A/H5N8) segment 1 (PB2) 4128.4 0.000000e+00 2265/2280 (99%)
EPI561679 A/tundra swan/Korea/H411/2014 (A/H5N8) segment 1 (PB2) 4128.4 0.000000e+00 2265/2280 (99%)
EPI561665 A/mallard/Korea/H297/2014 (A/H5N8) segment 1 (PB2) 4128.4 0.000000e+00 2265/2280 (99%)
EPI561651 A/breeder chicken/Korea/H250/2014 (A/H5N8) segment 1 (PB2) 4128.4 0.000000e+00 2265/2280 (99%)
EPI561644 A/breeder duck/Korea/H249/2014 (A/H5N8) segment 1 (PB2) 4128.4 0.000000e+00 2265/2280 (99%)
EPI561596 A/broiler duck/Korea/H133/2014 (A/H5N8) segment 1 (PB2) 4128.4 0.000000e+00 2265/2280 (99%)
EPI561589 A/breeder duck/Korea/H128/2014 (A/H5N8) segment 1 (PB2) 4128.4 0.000000e+00 2265/2280 (99%)
EPI561554 A/Coot/Korea/H81/2014 (A/H5N8) segment 1 (PB2) 4128.4 0.000000e+00 2265/2280 (99%)
EPI561547 A/Baikal teal/Korea/H80/2014 (A/H5N8) segment 1 (PB2) 4128.4 0.000000e+00 2265/2280 (99%)
EPI561520 A/broiler duck/Korea/H65/2014 (A/H5N8) segment 1 (PB2) 4128.4 0.000000e+00 2265/2280 (99%)
EPI561346 A/broiler duck/Korea/H47/2014 (A/H5N8) segment 1 (PB2) 4128.4 0.000000e+00 2265/2280 (99%)
EPI561201 A/broiler duck/Korea/H31/2014 (A/H5N8) segment 1 (PB2) 4128.4 0.000000e+00 2265/2280 (99%)
EPI561194 A/broiler duck/Korea/H29/2014 (A/H5N8) segment 1 (PB2) 4128.4 0.000000e+00 2265/2280 (99%)
EPI561185 A/waterfowl/Korea/S005/2014 (A/H5N8) segment 1 (PB2) 4128.4 0.000000e+00 2265/2280 (99%)
EPI542630 A/mallard/Korea/W452/2014 (A/H5N8) segment 1 (PB2) 4128.4 0.000000e+00 2265/2280 (99%)
EPI509707 A/baikal teal/Korea/Donglim3/2014 (A/H5N8) segment 1 (PB2) 4128.4 0.000000e+00 2265/2280 (99%)
EPI509702 A/broiler duck/Korea/Buan2/2014 (A/H5N8) segment 1 (PB2) 4128.4 0.000000e+00 2265/2280 (99%)
EPI585547 A/baikal teal/Korea/1454/2014 (A/H5N8) segment 1 (PB2) 4122.8 0.000000e+00 2264/2280 (99%)
EPI561695 A/spot-billed duck/Korea/H455-42/2014 (A/H5N8) segment 1 (PB2) 4122.8 0.000000e+00 2264/2280 (99%)
EPI561658 A/Korean native chicken/Korea/H257/2014 (A/H5N8) segment 1 (PB2) 4122.8 0.000000e+00 2264/2280 (99%)
EPI561617 A/breeder duck/Korea/H200/2014 (A/H5N8) segment 1 (PB2) 4122.8 0.000000e+00 2264/2280 (99%)
EPI517158 A/Chicken/Kumamoto/1-7/2014 (A/H5N8) segment 1 (PB2) 4122.8 0.000000e+00 2264/2280 (99%)
EPI561688 A/common teal/Korea/H455-30/2014 (A/H5N8) segment 1 (PB2) 4117.3 0.000000e+00 2263/2280 (99%)
EPI547679 A/Chicken/Netherlands/14015526/2014 (A/H5N8) segment 1 (PB2) 4100.7 0.000000e+00 2260/2280 (99%)
EPI595139 A/greater white-fronted goose/Korea/K14-374-1/2014 (A/H5N8) segment 1 (PB2) 4095.1 0.000000e+00 2259/2280 (99%)
EPI595125 A/greater white-fronted goose/Korea/K14-371-4/2014 (A/H5N8) segment 1 (PB2) 4095.1 0.000000e+00 2259/2280 (99%)
EPI595117 A/greater white-fronted goose/Korea/K14-369-3/2014 (A/H5N8) segment 1 (PB2) 4095.1 0.000000e+00 2259/2280 (99%)
EPI595109 A/greater white-fronted goose/Korea/K14-367-4/2014 (A/H5N8) segment 1 (PB2) 4095.1 0.000000e+00 2259/2280 (99%)
EPI595099 A/mandarin duck/Korea/K14-367-1/2014 (A/H5N8) segment 1 (PB2) 4095.1 0.000000e+00 2259/2280 (99%)
EPI595090 A/mandarin duck/Korea/K14-366-1/2014 (A/H5N8) segment 1 (PB2) 4095.1 0.000000e+00 2259/2280 (99%)
EPI595088 A/mandarin duck/Korea/K14-363-1/2014 (A/H5N8) segment 1 (PB2) 4095.1 0.000000e+00 2259/2280 (99%)
EPI595056 A/common teal/Korea/KU-12/2015 (A/H5N8) segment 1 (PB2) 4095.1 0.000000e+00 2259/2280 (99%)
EPI548620 A/chicken/Netherlands/14015531/2014 (A/H5N8) segment 1 (PB2) 4095.1 0.000000e+00 2259/2280 (99%)
EPI573176 A/duck/Netherlands/14015898/2014 (A/H5N8) segment 1 (PB2) 4089.6 0.000000e+00 2258/2280 (99%)
EPI573169 A/Chicken/Netherlands/14015824/2014 (A/H5N8) segment 1 (PB2) 4089.6 0.000000e+00 2258/2280 (99%)
EPI553340 A/chicken/Miyazaki/7/2014 (A/H5N8) segment 1 (PB2) 4089.6 0.000000e+00 2258/2280 (99%)
EPI573185 A/chicken/Netherlands/14016437/2014 (A/H5N8) segment 1 (PB2) 4084.1 0.000000e+00 2257/2280 (98%)
EPI552743 A/turkey/Germany/AR2485-86-L00899/2014 (A/H5N8) segment 1 (PB2) 4084.1 0.000000e+00 2257/2280 (98%)
EPI547670 A/duck/England/36254/14 (A/H5N8) segment 1 (PB2) 4084.1 0.000000e+00 2257/2280 (98%)
EPI595063 A/mallard/Korea/KU3-2/2015 (A/H5N8) segment 1 (PB2) 4078.5 0.000000e+00 2256/2280 (98%)
EPI573651 A/crane/Kagoshima/KU41/2014(H5N8) (A/H5N8) segment 1 (PB2) 4078.5 0.000000e+00 2256/2280 (98%)
EPI573643 A/crane/Kagoshima/KU21/2014(H5N8) (A/H5N8) segment 1 (PB2) 4078.5 0.000000e+00 2256/2280 (98%)
EPI573160 A/chicken/Netherlands/14015766/2014 (A/H5N8) segment 1 (PB2) 4078.5 0.000000e+00 2256/2280 (98%)
EPI558008 A/duck/England/36038/14 (A/H5N8) segment 1 (PB2) 4078.5 0.000000e+00 2256/2280 (98%)
EPI558001 A/duck/England/36226/14 (A/H5N8) segment 1 (PB2) 4078.5 0.000000e+00 2256/2280 (98%)
EPI548490 A/duck/Chiba/26-372-61/2014 (A/H5N8) segment 1 (PB2) 4078.5 0.000000e+00 2256/2280 (98%)
EPI548482 A/duck/Chiba/26-372-48/2014 (A/H5N8) segment 1 (PB2) 4078.5 0.000000e+00 2256/2280 (98%)
EPI543007 A/duck/Beijing/CT01/2014 (A/H5N8) segment 1 (PB2) 4074.8 0.000000e+00 2252/2277 (98%)
EPI585552 A/baikal teal/Korea/2402/2014 (A/H5N8) segment 1 (PB2) 4073.0 0.000000e+00 2255/2280 (98%)
EPI573669 A/mallard duck/Kagoshima/KU70/2015(H5N8) (A/H5N8) segment 1 (PB2) 4073.0 0.000000e+00 2255/2280 (98%)
EPI573661 A/crane/Kagoshima/KU53/2015(H5N8) (A/H5N8) segment 1 (PB2) 4073.0 0.000000e+00 2255/2280 (98%)
EPI576396 A/MuteSwan/Sweden/SVA-1503130141-SZ543/2015 (A/H5N8) segment 1 (PB2) 4069.3 0.000000e+00 2254/2280 (98%)
EPI576387 A/MuteSwan/Sweden/SVA-U1503110277-SZ502/2015 (A/H5N8) segment 1 (PB2) 4069.3 0.000000e+00 2254/2280 (98%)
EPI573677 A/mallard duck/Kagoshima/KU116/2015(H5N8) (A/H5N8) segment 1 (PB2) 4067.4 0.000000e+00 2253/2279 (98%)
EPI542999 A/duck/Beijing/FS01/2014 (A/H5N8) segment 1 (PB2) 4065.6 0.000000e+00 2249/2277 (98%)
EPI595072 A/mallard/Korea/N15-99/2015 (A/H5N8) segment 1 (PB2) 4063.7 0.000000e+00 2253/2280 (98%)
EPI553359 A/environment/Kagoshima/KU-ngr-H/2014 (A/H5N8) segment 1 (PB2) 4061.9 0.000000e+00 2253/2280 (98%)
EPI596299 A/chicken/Netherlands/emc-3/2014 (A/H5N8) segment 1 (PB2) 4034.2 0.000000e+00 2232/2256 (98%)
EPI552773 A/chicken/Netherlands/emc-3/2014 (A/H5N8) segment 1 (PB2) 4034.2 0.000000e+00 2232/2256 (98%)
EPI553186 A/turkey/Italy/14VIR7898-10/2014 (A/H5N8) segment 1 (PB2) 4028.7 0.000000e+00 2232/2258 (98%)
EPI596293 A/eurasian wigeon/Netherlands/2/2014 (A/H5N8) segment 1 (PB2) 3986.2 0.000000e+00 2202/2224 (99%)
EPI590677 A/eurasian wigeon/Netherlands/1/2015 (A/H5N8) segment 1 (PB2) 3986.2 0.000000e+00 2211/2238 (98%)
EPI585108 A/eurasian wigeon/Netherlands/1/2015 (A/H5N8) segment 1 (PB2) 3986.2 0.000000e+00 2211/2238 (98%)
EPI552765 A/eurasian wigeon/Netherlands/emc-2/2014 (A/H5N8) segment 1 (PB2) 3986.2 0.000000e+00 2202/2224 (99%)
EPI475576 A/wild duck/Shandong/628/2011 (A/H5N1) segment 1 (PB2) 3984.3 0.000000e+00 2239/2280 (98%)
EPI596287 A/eurasian wigeon/Netherlands/1/2014 (A/H5N8) segment 1 (PB2) 3977.0 0.000000e+00 2201/2225 (98%)
EPI552757 A/eurasian wigeon/Netherlands/emc-1/2014 (A/H5N8) segment 1 (PB2) 3977.0 0.000000e+00 2201/2225 (98%)
EPI442014 A/duck/Jiangsu/k1203/2010 (A/H5N8) segment 1 (PB2) 3967.7 0.000000e+00 2226/2265 (98%)
EPI399957 A/duck/Jiangsu/m234/2012 (A/H5N2) segment 1 (PB2) 3951.1 0.000000e+00 2233/2280 (97%)
EPI544889 A/duck/Shandong/Q1/2013 (A/H5N8) segment 1 (PB2) 3949.3 0.000000e+00 2232/2279 (97%)
EPI493814 A/duck/Guangdong/wy11/2008 (A/H5N5) segment 1 (PB2) 3868.0 0.000000e+00 2219/2281 (97%)
EPI493822 A/duck/Guangdong/wy19/2008 (A/H5N5) segment 1 (PB2) 3856.9 0.000000e+00 2216/2280 (97%)
EPI493830 A/duck/Guangdong/wy24/2008 (A/H5N5) segment 1 (PB2) 3784.9 0.000000e+00 2203/2280 (96%)
EPI548431 A/turkey/Germany-MV/R2472/2014 (A/H5N8) segment 1 (PB2) 3779.4 0.000000e+00 2089/2111 (98%)
EPI328897 A/duck/Eastern China/909/2009 (A/H5N1) segment 1 (PB2) 3729.5 0.000000e+00 2193/2280 (96%)
EPI328889 A/duck/Eastern China/108/2008 (A/H5N1) segment 1 (PB2) 3724.0 0.000000e+00 2192/2280 (96%)
EPI328881 A/duck/Eastern China/031/2009 (A/H5N5) segment 1 (PB2) 3724.0 0.000000e+00 2192/2280 (96%)
EPI328873 A/duck/Eastern China/008/2008 (A/H5N5) segment 1 (PB2) 3724.0 0.000000e+00 2192/2280 (96%)
EPI441998 A/goose/Shandong/k1204/2009 (A/H5N5) segment 1 (PB2) 3690.7 0.000000e+00 2187/2281 (95%)
EPI442006 A/goose/Guangdong/k0103/2010 (A/H5N5) segment 1 (PB2) 3685.2 0.000000e+00 2185/2280 (95%)
EPI398954 A/goose/Eastern China/1112/2011 (A/H5N2) segment 1 (PB2) 3646.4 0.000000e+00 2179/2281 (95%)
EPI431453 A/duck/Hebei/3/2011 (A/H5N2) segment 1 (PB2) 3629.8 0.000000e+00 2177/2282 (95%)
EPI431445 A/duck/Hebei/2/2011 (A/H5N2) segment 1 (PB2) 3629.8 0.000000e+00 2176/2281 (95%)
EPI414235 A/duck/Jiangsu/1-15/2011 (A/H4N2) segment 1 (PB2) 3629.8 0.000000e+00 2177/2282 (95%)
EPI398953 A/duck/Eastern China/1111/2011 (A/H5N2) segment 1 (PB2) 3596.5 0.000000e+00 2171/2282 (95%)
EPI326731 A/environment/Korea/CSM3/2002 (A/H3N6) segment 1 (PB2) 3596.5 0.000000e+00 2166/2275 (95%)
EPI387471 A/canvasback/Mongolia/2-69/2007 (A/H10) segment 1 (PB2) 3581.8 0.000000e+00 2167/2280 (95%)
EPI387371 A/whooper swan/Mongolia/1-14/2007 (A/H3N8) segment 1 (PB2) 3581.8 0.000000e+00 2167/2280 (95%)
EPI387468 A/ruddy shelduck/Mongolia/2-29/2007 (A/H3N2) segment 1 (PB2) 3576.2 0.000000e+00 2166/2280 (95%)
EPI387467 A/pintail/Mongolia/2-11/2007 (A/H4N2) segment 1 (PB2) 3568.8 0.000000e+00 2164/2279 (94%)
EPI387473 A/pintail/Mongolia/2-80/2007 (A/H4N6) segment 1 (PB2) 3567.0 0.000000e+00 2161/2275 (94%)
EPI527592 A/ruddy shelduck/Mongolia/961V/2009 (A/H3N8) segment 1 (PB2) 3557.8 0.000000e+00 2165/2283 (94%)
EPI272278 A/duck/Korea/A14/2008 (A/H5N2) segment 1 (PB2) 3557.8 0.000000e+00 2164/2282 (94%)
EPI387375 A/whooper swan/Mongolia/1-25/2007 (A/H3N8) segment 1 (PB2) 3552.2 0.000000e+00 2162/2280 (94%)
EPI469140 A/duck/Guangdong/4323/2007 (A/H11N9) segment 1 (PB2) 3550.4 0.000000e+00 2162/2282 (94%)
EPI527543 A/ruddy shelduck/Mongolia/590C2/2009 (A/H11N2) segment 1 (PB2) 3541.1 0.000000e+00 2161/2282 (94%)
EPI231142 A/spot-billed duck/Korea/527/2008 (A/H6N1) segment 1 (PB2) 3541.1 0.000000e+00 2161/2282 (94%)
EPI231150 A/spot-billed duck/Korea/528/2008 (A/H6N8) segment 1 (PB2) 3537.5 0.000000e+00 2157/2277 (94%)
EPI401351 A/wild duck/Korea/SH5-60/2008 (A/H4N6) segment 1 (PB2) 3535.6 0.000000e+00 2161/2283 (94%)
EPI231182 A/spot-billed duck/Korea/540/2008 (A/H6N1) segment 1 (PB2) 3531.9 0.000000e+00 2152/2271 (94%)
EPI508023 A/wild duck/Korea/SH20-27/2008 (A/H7N9) segment 1 (PB2) 3530.1 0.000000e+00 2160/2283 (94%)
EPI387376 A/ruddy shelduck/Mongolia/1-26/2007 (A/H3N8) segment 1 (PB2) 3528.2 0.000000e+00 2138/2251 (94%)
EPI231190 A/spot-billed duck/Korea/545/2008 (A/H6N1) segment 1 (PB2) 3526.4 0.000000e+00 2151/2271 (94%)
EPI231174 A/spot-billed duck/Korea/537/2008 (A/H6N1) segment 1 (PB2) 3526.4 0.000000e+00 2151/2271 (94%)
EPI586240 A/muskrat/Russia/63/2014 (A/H2N2) segment 1 (PB2) 3524.5 0.000000e+00 2156/2279 (94%)
EPI508024 A/wild duck/Korea/CSM27-12/2009 (A/H7N6) segment 1 (PB2) 3524.5 0.000000e+00 2158/2282 (94%)
EPI503958 A/wild duck/SH17-1/2008 (A/H2N3) segment 1 (PB2) 3524.5 0.000000e+00 2159/2283 (94%)
EPI341923 A/chicken/Korea/KNUWSJ09/2009 (A/H9N2) segment 1 (PB2) 3524.5 0.000000e+00 2158/2282 (94%)
EPI272279 A/duck/Korea/A93/2008 (A/H5N2) segment 1 (PB2) 3524.5 0.000000e+00 2158/2282 (94%)
EPI272276 A/chicken/Korea/A170/2009 (A/H9N2) segment 1 (PB2) 3524.5 0.000000e+00 2158/2282 (94%)
EPI231206 A/spot-billed duck/Korea/619/2008 (A/H6N2) segment 1 (PB2) 3524.5 0.000000e+00 2158/2282 (94%)
EPI21386 A/duck/Zhejiang/11/2000 (A/H5N1) segment 1 (PB2) 3524.5 0.000000e+00 2157/2281 (94%)
EPI387374 A/whooper swan/Mongolia/1-23/2007 (A/H3N8) segment 1 (PB2) 3520.8 0.000000e+00 2157/2281 (94%)
EPI387907 A/wild bird/Korea/A323/2009 (A/H10N1) segment 1 (PB2) 3519.0 0.000000e+00 2157/2282 (94%)
EPI227118 A/duck/Beijing/61/05 (A/H3N8) segment 1 (PB2) 3519.0 0.000000e+00 2157/2282 (94%)
EPI641767 A/duck/Thailand/CU-11655T/2011 (A/H4N6) segment 1 (PB2) 3513.4 0.000000e+00 2156/2282 (94%)
EPI527548 A/northern shoveler/ Mongolia/973/2009 (A/H3N8) segment 1 (PB2) 3513.4 0.000000e+00 2156/2282 (94%)
EPI469202 A/duck/Jiangxi/3286/2009 (A/H7N9) segment 1 (PB2) 3513.4 0.000000e+00 2156/2282 (94%)
EPI469201 A/duck/Jiangxi/3230/2009 (A/H7N9) segment 1 (PB2) 3513.4 0.000000e+00 2156/2282 (94%)
EPI469200 A/duck/Jiangxi/3214/2009 (A/H7N9) segment 1 (PB2) 3513.4 0.000000e+00 2156/2282 (94%)
EPI469199 A/duck/Jiangxi/3190/2009 (A/H7N9) segment 1 (PB2) 3513.4 0.000000e+00 2156/2282 (94%)
EPI469198 A/duck/Jiangxi/3169/2009 (A/H7N9) segment 1 (PB2) 3513.4 0.000000e+00 2156/2282 (94%)
EPI469197 A/duck/Jiangxi/3141/2009 (A/H7N9) segment 1 (PB2) 3513.4 0.000000e+00 2156/2282 (94%)
EPI469196 A/duck/Jiangxi/3096/2009 (A/H7N9) segment 1 (PB2) 3513.4 0.000000e+00 2156/2282 (94%)
EPI469142 A/duck/Jiangxi/3257/2009 (A/H7N9) segment 1 (PB2) 3513.4 0.000000e+00 2156/2282 (94%)
EPI469141 A/duck/Jiangxi/3152/2009 (A/H7N9) segment 1 (PB2) 3513.4 0.000000e+00 2156/2282 (94%)
EPI469135 A/duck/Jiangxi/3283/2009 (A/H7N9) segment 1 (PB2) 3513.4 0.000000e+00 2156/2282 (94%)
EPI341883 A/duck/Korea/KNUDPJ09/2009 (A/H9N2) segment 1 (PB2) 3513.4 0.000000e+00 2156/2282 (94%)
EPI229247 A/duck/Beijing/40/04 (A/H3N8) segment 1 (PB2) 3513.4 0.000000e+00 2156/2282 (94%)
EPI118429 A/migratory duck/Hong Kong/MP206/2004 (A/H5N2) segment 1 (PB2) 3511.6 0.000000e+00 2124/2234 (95%)
EPI527568 A/mallard /Mongolia/1551/2010 (A/H3N1) segment 1 (PB2) 3507.9 0.000000e+00 2155/2282 (94%)
EPI527560 A/ruddy shelduck/Mongolia/963V/2009 (A/H3N8) segment 1 (PB2) 3507.9 0.000000e+00 2156/2283 (94%)
EPI341891 A/chicken/Korea/KNUSWR09/2009 (A/H9N2) segment 1 (PB2) 3507.9 0.000000e+00 2155/2282 (94%)
EPI272275 A/chicken/Korea/A146/2009 (A/H9N2) segment 1 (PB2) 3507.9 0.000000e+00 2155/2282 (94%)
EPI269178 A/duck/Hunan/491/2005 (A/H6N2) segment 1 (PB2) 3507.9 0.000000e+00 2156/2283 (94%)
EPI231158 A/spot-billed duck/Korea/534/2008 (A/H6N1) segment 1 (PB2) 3507.9 0.000000e+00 2155/2282 (94%)
EPI231134 A/mallard/Korea/L08-8/2008 (A/H6N1) segment 1 (PB2) 3507.9 0.000000e+00 2154/2280 (94%)
EPI231166 A/spot-billed duck/Korea/536/2008 (A/H6N1) segment 1 (PB2) 3504.2 0.000000e+00 2139/2259 (94%)
EPI432530 r8 (A/H5N1) segment 1 (PB2) 3502.4 0.000000e+00 2154/2282 (94%)
EPI432522 r78 (A/H5N1) segment 1 (PB2) 3502.4 0.000000e+00 2154/2282 (94%)
EPI432514 r7 (A/H5N1) segment 1 (PB2) 3502.4 0.000000e+00 2154/2282 (94%)
EPI432506 r68 (A/H5N1) segment 1 (PB2) 3502.4 0.000000e+00 2154/2282 (94%)
EPI432498 r678 (A/H5N1) segment 1 (PB2) 3502.4 0.000000e+00 2154/2282 (94%)
EPI432490 r67 (A/H5N1) segment 1 (PB2) 3502.4 0.000000e+00 2154/2282 (94%)
EPI432482 r6 (A/H5N1) segment 1 (PB2) 3502.4 0.000000e+00 2154/2282 (94%)
EPI432474 r58 (A/H5N1) segment 1 (PB2) 3502.4 0.000000e+00 2154/2282 (94%)
EPI432466 r578 (A/H5N1) segment 1 (PB2) 3502.4 0.000000e+00 2154/2282 (94%)
EPI432458 r57 (A/H5N1) segment 1 (PB2) 3502.4 0.000000e+00 2154/2282 (94%)
EPI432450 r568 (A/H5N1) segment 1 (PB2) 3502.4 0.000000e+00 2154/2282 (94%)
EPI432442 r5678 (A/H5N1) segment 1 (PB2) 3502.4 0.000000e+00 2154/2282 (94%)
EPI432434 r567 (A/H5N1) segment 1 (PB2) 3502.4 0.000000e+00 2154/2282 (94%)
EPI432426 r56 (A/H5N1) segment 1 (PB2) 3502.4 0.000000e+00 2154/2282 (94%)
EPI432418 r5 (A/H5N1) segment 1 (PB2) 3502.4 0.000000e+00 2154/2282 (94%)
EPI432410 r38 (A/H5N1) segment 1 (PB2) 3502.4 0.000000e+00 2154/2282 (94%)
EPI432402 r378 (A/H5N1) segment 1 (PB2) 3502.4 0.000000e+00 2154/2282 (94%)
EPI432394 r37 (A/H5N1) segment 1 (PB2) 3502.4 0.000000e+00 2154/2282 (94%)
EPI432386 r368 (A/H5N1) segment 1 (PB2) 3502.4 0.000000e+00 2154/2282 (94%)
EPI432378 r3678 (A/H5N1) segment 1 (PB2) 3502.4 0.000000e+00 2154/2282 (94%)
EPI432370 r367 (A/H5N1) segment 1 (PB2) 3502.4 0.000000e+00 2154/2282 (94%)
EPI432362 r36 (A/H5N1) segment 1 (PB2) 3502.4 0.000000e+00 2154/2282 (94%)
EPI432354 r358 (A/H5N1) segment 1 (PB2) 3502.4 0.000000e+00 2154/2282 (94%)
EPI432346 r3578 (A/H5N1) segment 1 (PB2) 3502.4 0.000000e+00 2154/2282 (94%)
EPI432338 r357 (A/H5N1) segment 1 (PB2) 3502.4 0.000000e+00 2154/2282 (94%)
EPI432330 r3568 (A/H5N1) segment 1 (PB2) 3502.4 0.000000e+00 2154/2282 (94%)
EPI432322 r35678 (A/H5N1) segment 1 (PB2) 3502.4 0.000000e+00 2154/2282 (94%)
EPI432314 r3567 (A/H5N1) segment 1 (PB2) 3502.4 0.000000e+00 2154/2282 (94%)
EPI432306 r356 (A/H5N1) segment 1 (PB2) 3502.4 0.000000e+00 2154/2282 (94%)
EPI432298 r35 (A/H5N1) segment 1 (PB2) 3502.4 0.000000e+00 2154/2282 (94%)
EPI432290 r3 (A/H5N1) segment 1 (PB2) 3502.4 0.000000e+00 2154/2282 (94%)
EPI432282 r28 (A/H5N1) segment 1 (PB2) 3502.4 0.000000e+00 2154/2282 (94%)
EPI432274 r278 (A/H5N1) segment 1 (PB2) 3502.4 0.000000e+00 2154/2282 (94%)
EPI432266 r27 (A/H5N1) segment 1 (PB2) 3502.4 0.000000e+00 2154/2282 (94%)
EPI432258 r268 (A/H5N1) segment 1 (PB2) 3502.4 0.000000e+00 2154/2282 (94%)
EPI432250 r2678 (A/H5N1) segment 1 (PB2) 3502.4 0.000000e+00 2154/2282 (94%)
EPI432242 r267 (A/H5N1) segment 1 (PB2) 3502.4 0.000000e+00 2154/2282 (94%)
EPI432234 r26 (A/H5N1) segment 1 (PB2) 3502.4 0.000000e+00 2154/2282 (94%)
EPI432226 r258 (A/H5N1) segment 1 (PB2) 3502.4 0.000000e+00 2154/2282 (94%)
EPI432218 r2578 (A/H5N1) segment 1 (PB2) 3502.4 0.000000e+00 2154/2282 (94%)
EPI432210 r257 (A/H5N1) segment 1 (PB2) 3502.4 0.000000e+00 2154/2282 (94%)
EPI432202 r2568 (A/H5N1) segment 1 (PB2) 3502.4 0.000000e+00 2154/2282 (94%)
EPI432194 r25678 (A/H5N1) segment 1 (PB2) 3502.4 0.000000e+00 2154/2282 (94%)
EPI432186 r2567 (A/H5N1) segment 1 (PB2) 3502.4 0.000000e+00 2154/2282 (94%)
EPI432178 r256 (A/H5N1) segment 1 (PB2) 3502.4 0.000000e+00 2154/2282 (94%)
EPI432170 r25 (A/H5N1) segment 1 (PB2) 3502.4 0.000000e+00 2154/2282 (94%)
EPI432162 r238 (A/H5N1) segment 1 (PB2) 3502.4 0.000000e+00 2154/2282 (94%)
EPI432154 r2378 (A/H5N1) segment 1 (PB2) 3502.4 0.000000e+00 2154/2282 (94%)
EPI432146 r237 (A/H5N1) segment 1 (PB2) 3502.4 0.000000e+00 2154/2282 (94%)
EPI432138 r2368 (A/H5N1) segment 1 (PB2) 3502.4 0.000000e+00 2154/2282 (94%)
EPI432130 r23678 (A/H5N1) segment 1 (PB2) 3502.4 0.000000e+00 2154/2282 (94%)
EPI432122 r2367 (A/H5N1) segment 1 (PB2) 3502.4 0.000000e+00 2154/2282 (94%)
EPI432114 r236 (A/H5N1) segment 1 (PB2) 3502.4 0.000000e+00 2154/2282 (94%)
EPI432106 r2358 (A/H5N1) segment 1 (PB2) 3502.4 0.000000e+00 2154/2282 (94%)
EPI432098 r23578 (A/H5N1) segment 1 (PB2) 3502.4 0.000000e+00 2154/2282 (94%)
EPI432090 r2357 (A/H5N1) segment 1 (PB2) 3502.4 0.000000e+00 2154/2282 (94%)
EPI432082 r23568 (A/H5N1) segment 1 (PB2) 3502.4 0.000000e+00 2154/2282 (94%)
EPI432074 r235678 (A/H5N1) segment 1 (PB2) 3502.4 0.000000e+00 2154/2282 (94%)
EPI432066 r23567 (A/H5N1) segment 1 (PB2) 3502.4 0.000000e+00 2154/2282 (94%)
EPI432058 r2356 (A/H5N1) segment 1 (PB2) 3502.4 0.000000e+00 2154/2282 (94%)
EPI432050 r235 (A/H5N1) segment 1 (PB2) 3502.4 0.000000e+00 2154/2282 (94%)
EPI432042 r23 (A/H5N1) segment 1 (PB2) 3502.4 0.000000e+00 2154/2282 (94%)
EPI432034 r2 (A/H5N1) segment 1 (PB2) 3502.4 0.000000e+00 2154/2282 (94%)
EPI363928 A/duck/Guizhou/1560/2007 (A/H6N8) segment 1 (PB2) 3502.4 0.000000e+00 2155/2283 (94%)
EPI345513 A/duck/Eastern China/50/2002 (A/H6N8) segment 1 (PB2) 3502.4 0.000000e+00 2155/2283 (94%)
EPI341932 A/duck/Nanjing/20/2010 (A/H1N3) segment 1 (PB2) 3502.4 0.000000e+00 2153/2281 (94%)
EPI306420 A/mallard/Korea/KNU YP09/2009 (A/H1N1) segment 1 (PB2) 3502.4 0.000000e+00 2149/2275 (94%)
EPI284618 A/duck/Hunan/8-19/2009 (A/H4N2) segment 1 (PB2) 3502.4 0.000000e+00 2153/2281 (94%)
EPI21370 A/duck/Guangxi/35/2001 (A/H5N1) segment 1 (PB2) 3502.4 0.000000e+00 2154/2282 (94%)
EPI272277 A/duck/Korea/A174/2009 (A/H9N2) segment 1 (PB2) 3498.7 0.000000e+00 2147/2272 (94%)
EPI469148 A/duck/Jiangxi/3292/2009 (A/H7N9) segment 1 (PB2) 3496.8 0.000000e+00 2145/2270 (94%)
EPI401301 A/wild duck/Korea/CSM20-5/2009 (A/H4N6) segment 1 (PB2) 3496.8 0.000000e+00 2153/2282 (94%)
EPI341939 A/duck/Nanjing/19/2010 (A/H1N3) segment 1 (PB2) 3496.8 0.000000e+00 2153/2282 (94%)
EPI296674 A/chicken/Korea/SH0902/2009 (A/H9N2) segment 1 (PB2) 3496.8 0.000000e+00 2153/2282 (94%)
EPI269267 A/duck/Shantou/4534/2001 (A/H6N2) segment 1 (PB2) 3496.8 0.000000e+00 2153/2282 (94%)
EPI222161 A/mallard/Altai/1208/2007 (A/H3N6) segment 1 (PB2) 3496.8 0.000000e+00 2153/2282 (94%)
EPI222076 A/gadwall/Altai/1328/2007 (A/H3N8) segment 1 (PB2) 3496.8 0.000000e+00 2153/2282 (94%)
EPI219337 A/mallard/Hokkaido/24/2009 (A/H5N1) segment 1 (PB2) 3496.8 0.000000e+00 2155/2284 (94%)
EPI21378 A/duck/Shanghai/13/2001 (A/H5N1) segment 1 (PB2) 3496.8 0.000000e+00 2153/2282 (94%)
EPI296687 A/duck/Korea/SH0915/2009 (A/H9N2) segment 1 (PB2) 3495.0 0.000000e+00 2152/2281 (94%)
EPI296685 A/chicken/Korea/SH0913/2009 (A/H9N2) segment 1 (PB2) 3495.0 0.000000e+00 2152/2281 (94%)
EPI527582 A/red-crested pochard/Mongolia/463V/2009 (A/H3N1) segment 1 (PB2) 3491.3 0.000000e+00 2152/2282 (94%)
EPI527580 A/velvet scoter/Mongolia/969V/2009 (A/H3N8) segment 1 (PB2) 3491.3 0.000000e+00 2153/2283 (94%)
EPI527562 A/mallard/Mongolia/651/2010 (A/H2N3) segment 1 (PB2) 3491.3 0.000000e+00 2152/2282 (94%)
EPI469230 A/duck/Jiangxi/22041/2008 (A/H4N9) segment 1 (PB2) 3491.3 0.000000e+00 2153/2283 (94%)
EPI461800 A/environment/Hunan/S4304/2011 (A/H3N2) segment 1 (PB2) 3491.3 0.000000e+00 2152/2282 (94%)
EPI296686 A/chicken/Korea/SH0914/2009 (A/H9N2) segment 1 (PB2) 3491.3 0.000000e+00 2152/2282 (94%)
EPI236709 A/goose/Hong Kong/668.1/2001 (A/H5N1) segment 1 (PB2) 3491.3 0.000000e+00 2152/2282 (94%)
EPI236668 A/duck/Guangxi/xa/2001 (A/H5N1) segment 1 (PB2) 3491.3 0.000000e+00 2152/2282 (94%)
EPI222092 A/garganey/Altai/1216/2007 (A/H3N6) segment 1 (PB2) 3491.3 0.000000e+00 2152/2282 (94%)
EPI222068 A/gadwall/Altai/1326/2007 (A/H3N8) segment 1 (PB2) 3491.3 0.000000e+00 2152/2282 (94%)
EPI222052 A/gadwall/Altai/1324/2007 (A/H3N8) segment 1 (PB2) 3491.3 0.000000e+00 2152/2282 (94%)
EPI1644 A/duck/Hokkaido/Vac-1/04 (A/H5N1) segment 1 (PB2) 3491.3 0.000000e+00 2152/2282 (94%)
EPI17806 A/Chicken/HongKong/YU822.2/01 (A/H5N1) segment 1 (PB2) 3489.4 0.000000e+00 2151/2281 (94%)
EPI416366 A/wild duck/Korea/SNU50-5/2009 (A/H5N1) segment 1 (PB2) 3485.7 0.000000e+00 2151/2282 (94%)
EPI416360 A/wild duck/Korea/SNU50-5/2009 (A/H5N1) segment 1 (PB2) 3485.7 0.000000e+00 2151/2282 (94%)
EPI363556 A/duck/Jiangxi/5748/2006 (A/H6N2) segment 1 (PB2) 3485.7 0.000000e+00 2153/2284 (94%)
EPI243254 A/R(duck/Mongolia/54/01-duck/Mongolia/47/01) (A/H5N1) segment 1 (PB2) 3485.7 0.000000e+00 2151/2282 (94%)
EPI237967 A/duck/Hong Kong/2986.1-2/2000 (A/H5N1) segment 1 (PB2) 3485.7 0.000000e+00 2152/2283 (94%)
EPI236935 A/waterfowl/Hong Kong/378.5/2001 (A/H5N1) segment 1 (PB2) 3485.7 0.000000e+00 2151/2282 (94%)
EPI236555 A/Duck/Hong Kong/380.5/2001 (A/H5N1) segment 1 (PB2) 3485.7 0.000000e+00 2151/2282 (94%)
EPI3405 A/duck/Mongolia/54/01 (A/H5N2) segment 1 (PB2) 3485.7 0.000000e+00 2151/2282 (94%)
EPI584050 A/environment/Kagoshima/KU-ngr-D/2012(H4N6) (A/H4N6) segment 1 (PB2) 3480.2 0.000000e+00 2149/2281 (94%)
EPI542394 A/muscovy duck/Vietnam/LBM687/2014 (A/H4N6) segment 1 (PB2) 3480.2 0.000000e+00 2149/2281 (94%)
EPI527559 A/mallard/Mongolia/1581/2010 (A/H3N8) segment 1 (PB2) 3480.2 0.000000e+00 2152/2284 (94%)
EPI406486 A/baikal teal/Xianghai/421/2011 (A/H9N2) segment 1 (PB2) 3480.2 0.000000e+00 2151/2283 (94%)
EPI375120 A/wild bird/Korea/A72/10 (A/H7N7) segment 1 (PB2) 3480.2 0.000000e+00 2150/2282 (94%)
EPI228863 A/swine/Henan/wy/2004 (A/H5N1) segment 1 (PB2) 3480.2 0.000000e+00 2150/2282 (94%)
EPI89224 A/duck/Nanchang/1749/1992 (A/H11N2) segment 1 (PB2) 3480.2 0.000000e+00 2150/2282 (94%)
EPI26498 A/Chicken/Henan/16/2004 (A/H5N1) segment 1 (PB2) 3480.2 0.000000e+00 2150/2282 (94%)
EPI500923 A/Chicken/Hunan/S4495/2010 (A/H6N6) segment 1 (PB2) 3474.7 0.000000e+00 2150/2283 (94%)
EPI438431 A/duck/Vietnam/LBM81/2012 (A/H11N9) segment 1 (PB2) 3474.7 0.000000e+00 2149/2282 (94%)
EPI438278 A/duck/Vietnam/LBM300/2012 (A/H10N2) segment 1 (PB2) 3474.7 0.000000e+00 2151/2284 (94%)
EPI335318 A/Korean native chicken/Korea/K040110/2010 (A/H9N2) segment 1 (PB2) 3474.7 0.000000e+00 2149/2282 (94%)
EPI108735 A/chicken/Jiangsu/cz1/2002 (A/H5N1) segment 1 (PB2) 3474.7 0.000000e+00 2150/2283 (94%)
EPI89095 A/Chicken/Nanchang/2-0527/2000 (A/H4N6) segment 1 (PB2) 3474.7 0.000000e+00 2149/2282 (94%)
EPI375122 A/mandarin duck/Korea/468/11 (A/H7N3) segment 1 (PB2) 3472.8 0.000000e+00 2146/2278 (94%)
EPI314196 A/wild duck/Taiwan/WB1162/2006 (A/H4N6) segment 1 (PB2) 3472.8 0.000000e+00 2114/2230 (94%)
EPI600849 A/duck/Jiangxi/22960/2008 (A/H10N8) segment 1 (PB2) 3469.1 0.000000e+00 2149/2283 (94%)
EPI544764 A/environment/Shanghai/LPM1/2013 (A/H3N2) segment 1 (PB2) 3469.1 0.000000e+00 2147/2281 (94%)
EPI508021 A/mallard/Korea/NHG187/2008 (A/H7N7) segment 1 (PB2) 3469.1 0.000000e+00 2148/2282 (94%)
EPI506533 A/duck/Thailand/CU-11869C/2011 (A/H1N9) segment 1 (PB2) 3469.1 0.000000e+00 2148/2282 (94%)
EPI461544 A/duck/Hunan/S11090/2012 (A/H4N6) segment 1 (PB2) 3469.1 0.000000e+00 2148/2282 (94%)
EPI387908 A/mallard/Korea/1203/2010 (A/H10N8) segment 1 (PB2) 3469.1 0.000000e+00 2148/2282 (94%)
EPI296688 A/chicken/Korea/HC0410/2009 (A/H9N2) segment 1 (PB2) 3469.1 0.000000e+00 2145/2277 (94%)
EPI237905 A/Goose/Hong Kong/3014.5/2000 (A/H5N1) segment 1 (PB2) 3469.1 0.000000e+00 2148/2282 (94%)
EPI236725 A/goose/Viet Nam/324/2001 (A/H5N1) segment 1 (PB2) 3469.1 0.000000e+00 2148/2282 (94%)
EPI236717 A/goose/Viet Nam/113/2001 (A/H5N1) segment 1 (PB2) 3469.1 0.000000e+00 2148/2282 (94%)
EPI135190 A/duck/Shantou/1930/2001 (A/H5N1) segment 1 (PB2) 3469.1 0.000000e+00 2147/2281 (94%)
EPI135133 A/chicken/Shantou/904/2001 (A/H5N1) segment 1 (PB2) 3469.1 0.000000e+00 2148/2282 (94%)
EPI89120 A/Duck/Nanchang/4-165/2000 (A/H4N6) segment 1 (PB2) 3469.1 0.000000e+00 2148/2282 (94%)
EPI26502 A/swan/Guangxi/307/2004 (A/H5N1) segment 1 (PB2) 3469.1 0.000000e+00 2148/2282 (94%)
EPI26496 A/Chicken/Henan/13/2004 (A/H5N1) segment 1 (PB2) 3469.1 0.000000e+00 2148/2282 (94%)
EPI26494 A/Chicken/Henan/12/2004 (A/H5N1) segment 1 (PB2) 3469.1 0.000000e+00 2148/2282 (94%)
EPI26491 A/chicken/Henan/01/2004 (A/H5N1) segment 1 (PB2) 3469.1 0.000000e+00 2148/2282 (94%)
EPI25322 A/chicken/Hubei/489/2004 (A/H5N1) segment 1 (PB2) 3469.1 0.000000e+00 2149/2283 (94%)
EPI24683 A/chicken/Hubei/327/2004 (A/H5N1) segment 1 (PB2) 3469.1 0.000000e+00 2150/2284 (94%)
EPI508030 A/wild duck/Korea/MHC40-28/2010 (A/H7N7) segment 1 (PB2) 3467.3 0.000000e+00 2146/2280 (94%)
EPI17798 A/Chicken/HongKong/FY150/01 (A/H5N1) segment 1 (PB2) 3467.3 0.000000e+00 2146/2280 (94%)
EPI17794 A/Chicken/HongKong/NT873.3/01 (A/H5N1) segment 1 (PB2) 3467.3 0.000000e+00 2147/2281 (94%)
EPI17792 A/Chicken/HongKong/NT873.3/01 (A/H5N1) segment 1 (PB2) 3467.3 0.000000e+00 2147/2281 (94%)
EPI469168 A/northern shoveler/Hong Kong/MPE2984/2008 (A/H10N9) segment 1 (PB2) 3463.6 0.000000e+00 2148/2283 (94%)
EPI461552 A/duck/Hunan/S11200/2012 (A/H4N6) segment 1 (PB2) 3463.6 0.000000e+00 2147/2282 (94%)
EPI441049 A/muscovy duck/Vietnam/LBM198/2012 (A/H6N2) segment 1 (PB2) 3463.6 0.000000e+00 2147/2282 (94%)
EPI418268 A/muscovy duck/Vietnam/LBM189/2012 (A/H3N2) segment 1 (PB2) 3463.6 0.000000e+00 2147/2282 (94%)
EPI367586 A/mallard/Czech Republic/15008-11K/2009 (A/H5N3) segment 1 (PB2) 3463.6 0.000000e+00 2147/2282 (94%)
EPI276133 A/pintail/Aomori/1130/2008 (A/H1N3) segment 1 (PB2) 3463.6 0.000000e+00 2146/2281 (94%)
EPI236568 A/Hong Kong/378.1/2001 (A/H5N1) segment 1 (PB2) 3463.6 0.000000e+00 2148/2283 (94%)
EPI139856 A/Ck/HK/YU22/2002 (A/H5N1) segment 1 (PB2) 3463.6 0.000000e+00 2147/2282 (94%)
EPI21372 A/duck/Guangxi/50/2001 (A/H5N1) segment 1 (PB2) 3463.6 0.000000e+00 2147/2282 (94%)
EPI14800 A/Duck/Hong Kong/2986.1/2000 (A/H5N1) segment 1 (PB2) 3463.6 0.000000e+00 2147/2281 (94%)
EPI17804 A/Chicken/HongKong/YU822.2/01 (A/H5N1) segment 1 (PB2) 3461.7 0.000000e+00 2147/2282 (94%)
EPI476580 A/duck/Thailand/CU-8319T/2010 (A/H9N7) segment 1 (PB2) 3459.9 0.000000e+00 2140/2272 (94%)
EPI231198 A/spot-billed duck/Korea/546/2008 (A/H6N1) segment 1 (PB2) 3459.9 0.000000e+00 2115/2235 (94%)
EPI527585 A/ruddy shelduck/Mongolia/974/2010 (A/H10N7) segment 1 (PB2) 3458.0 0.000000e+00 2147/2283 (94%)
EPI508020 A/Northern shoveler/Korea/SD175/2008 (A/H7N3) segment 1 (PB2) 3458.0 0.000000e+00 2147/2283 (94%)
EPI503959 A/wild duck/SH17-34/2008 (A/H2N3) segment 1 (PB2) 3458.0 0.000000e+00 2147/2283 (94%)
EPI441045 A/duck/Vietnam/LBM185/2012 (A/H6N6) segment 1 (PB2) 3458.0 0.000000e+00 2146/2282 (94%)
EPI235191 A/Mallard/Huadong/Y/2003 (A/H5N1) segment 1 (PB2) 3458.0 0.000000e+00 2146/2282 (94%)
EPI229556 A/magpie/Korea/Y:S-M1/2004 (A/H5N1) segment 1 (PB2) 3458.0 0.000000e+00 2145/2281 (94%)
EPI89277 A/duck/Hong Kong/7/1975 (A/H3N2) segment 1 (PB2) 3458.0 0.000000e+00 2146/2282 (94%)
EPI21356 A/duck/Guangdong/01/2001 (A/H5N1) segment 1 (PB2) 3458.0 0.000000e+00 2146/2282 (94%)
EPI14808 A/Goose/Hong Kong/3014.8/2000 (A/H5N1) segment 1 (PB2) 3458.0 0.000000e+00 2144/2279 (94%)
EPI457918 A/duck/Guangxi/GXd-2/2012 (A/H1N2) segment 1 (PB2) 3452.5 0.000000e+00 2145/2282 (93%)
EPI457910 A/duck/Guangxi/GXd-4/2011 (A/H1N2) segment 1 (PB2) 3452.5 0.000000e+00 2146/2283 (93%)
EPI314930 A/ostrich/Suzhou/097/2003 (A/H5N1) segment 1 (PB2) 3452.5 0.000000e+00 2147/2284 (94%)
EPI236701 A/goose/Guangdong/xb/2001 (A/H5N1) segment 1 (PB2) 3452.5 0.000000e+00 2146/2283 (93%)
EPI235893 A/duck/Shanghai/xj/2002 (A/H5N1) segment 1 (PB2) 3452.5 0.000000e+00 2145/2282 (93%)
EPI235813 A/chicken/Jilin/he/2002 (A/H5N1) segment 1 (PB2) 3452.5 0.000000e+00 2145/2282 (93%)
EPI127412 A/wild duck/Hunan/211/2005 (A/H5N1) segment 1 (PB2) 3452.5 0.000000e+00 2146/2283 (93%)
EPI314220 A/wild duck/Taiwan/WB2/1998 (A/H4N6) segment 1 (PB2) 3450.7 0.000000e+00 2111/2231 (94%)
EPI296684 A/duck/Korea/SH0912/2009 (A/H9N2) segment 1 (PB2) 3450.7 0.000000e+00 2128/2257 (94%)
EPI296679 A/chicken/Korea/SH0907/2009 (A/H9N2) segment 1 (PB2) 3450.7 0.000000e+00 2128/2257 (94%)
EPI17796 A/Chicken/HongKong/FY150/01 (A/H5N1) segment 1 (PB2) 3450.7 0.000000e+00 2144/2281 (93%)
EPI375121 A/wild bird/Korea/A9/11 (A/H7N9) segment 1 (PB2) 3448.8 0.000000e+00 2139/2273 (94%)
EPI135171 A/duck/Shantou/1437/2001 (A/H5N1) segment 1 (PB2) 3448.8 0.000000e+00 2128/2258 (94%)
EPI502504 A/wild waterfowl/Dongting/C3109 /2011 (A/H9N2) segment 1 (PB2) 3447.0 0.000000e+00 2144/2282 (93%)
EPI500931 A/Duck/Fujian/S4081/2008 (A/H6N2) segment 1 (PB2) 3447.0 0.000000e+00 2146/2284 (93%)
EPI500883 A/Chicken/Guangdong/S2346/2009 (A/H6N2) segment 1 (PB2) 3447.0 0.000000e+00 2146/2284 (93%)
EPI469182 A/common teal/Hong Kong/MPL1075/2011 (A/H11N9) segment 1 (PB2) 3447.0 0.000000e+00 2145/2283 (93%)
EPI469174 A/wild waterfowl/Hong Kong/MPL1060/2011 (A/H11N9) segment 1 (PB2) 3447.0 0.000000e+00 2145/2283 (93%)
EPI439803 A/domestic green-winged teal/Hunan/2036/2007 (A/H3N6) segment 1 (PB2) 3447.0 0.000000e+00 2144/2282 (93%)
EPI401285 A/duck/Korea/DY97/2007 (A/H4N3) segment 1 (PB2) 3447.0 0.000000e+00 2145/2283 (93%)
EPI384004 A/duck/Thailand/CU-9744C /2010 (A/H7N4) segment 1 (PB2) 3447.0 0.000000e+00 2144/2282 (93%)
EPI383958 A/duck/Thailand/CU-9754C/2010 (A/H7N4) segment 1 (PB2) 3447.0 0.000000e+00 2144/2282 (93%)
EPI363920 A/duck/Guizhou/1088/2007 (A/H6N2) segment 1 (PB2) 3447.0 0.000000e+00 2146/2284 (93%)
EPI345497 A/duck/Eastern China/1/2008 (A/H6N1) segment 1 (PB2) 3447.0 0.000000e+00 2145/2283 (93%)
EPI235102 A/chicken/Korea/ES/03 (A/H5N1) segment 1 (PB2) 3447.0 0.000000e+00 2144/2282 (93%)
EPI229678 A/chicken/Yamaguchi/7/2004 (A/H5N1) segment 1 (PB2) 3447.0 0.000000e+00 2144/2282 (93%)
EPI168531 A/mute swan/Aktau/1460/2006 (A/H5N1) segment 1 (PB2) 3447.0 0.000000e+00 2143/2281 (93%)
EPI135798 A/chukar/Shantou/4690/2003 (A/H5N1) segment 1 (PB2) 3447.0 0.000000e+00 2145/2283 (93%)
EPI101699 A/chicken/Hebei/718/2001 (A/H5N1) segment 1 (PB2) 3447.0 0.000000e+00 2144/2282 (93%)
EPI89502 A/duck/Hong Kong/562/1979 (A/H10N9) segment 1 (PB2) 3447.0 0.000000e+00 2144/2282 (93%)
EPI24609 A/duck/Korea/ESD1/03 (A/H5N1) segment 1 (PB2) 3447.0 0.000000e+00 2144/2282 (93%)
EPI21368 A/duck/Guangxi/22/2001 (A/H5N1) segment 1 (PB2) 3447.0 0.000000e+00 2144/2282 (93%)
EPI1057 A/chicken/Yamaguchi/7/2004 (A/H5N1) segment 1 (PB2) 3447.0 0.000000e+00 2144/2282 (93%)
EPI596387 A/muscovy duck/Vietnam/LBM201/2012 (A/H3N2) segment 1 (PB2) 3445.1 0.000000e+00 2142/2282 (93%)
EPI296681 A/duck/Korea/SH0909/2009 (A/H9N2) segment 1 (PB2) 3445.1 0.000000e+00 2127/2257 (94%)
EPI502621 A/wild waterfowl/Dongting/C4429/2012 (A/H9N2) segment 1 (PB2) 3441.4 0.000000e+00 2143/2282 (93%)
EPI502497 A/wild waterfowl/Dongting/C2203/2011 (A/H9N2) segment 1 (PB2) 3441.4 0.000000e+00 2143/2282 (93%)
EPI502483 A/wild waterfowl/Dongting/C2149/2011 (A/H9N2) segment 1 (PB2) 3441.4 0.000000e+00 2143/2282 (93%)
EPI502460 A/wild waterfowl/Dongting/C2148/2011 (A/H9N2) segment 1 (PB2) 3441.4 0.000000e+00 2143/2282 (93%)
EPI502452 A/wild waterfowl/Dongting/2123/2011 (A/H9N2) segment 1 (PB2) 3441.4 0.000000e+00 2143/2282 (93%)
EPI501075 A/Duck/Hubei/S4170/2008 (A/H6N2) segment 1 (PB2) 3441.4 0.000000e+00 2145/2284 (93%)
EPI469223 A/chicken/Jiangxi/2369/2010 (A/H7N7) segment 1 (PB2) 3441.4 0.000000e+00 2143/2282 (93%)
EPI439146 A/duck/Nanjing/1102/2010 (A/H4N8) segment 1 (PB2) 3441.4 0.000000e+00 2144/2283 (93%)
EPI356360 A/wild duck/Korea/CSM4-12/2009 (A/H5N1) segment 1 (PB2) 3441.4 0.000000e+00 2117/2243 (94%)
EPI135646 A/pheasant/Shantou/4567/2002 (A/H5N1) segment 1 (PB2) 3441.4 0.000000e+00 2143/2282 (93%)
EPI21352 A/duck/Fujian/17/2001 (A/H5N1) segment 1 (PB2) 3441.4 0.000000e+00 2144/2283 (93%)
EPI1129 A/crow/Osaka/102/2004 (A/H5N1) segment 1 (PB2) 3441.4 0.000000e+00 2142/2281 (93%)
EPI1093 A/chicken/Kyoto/3/2004 (A/H5N1) segment 1 (PB2) 3441.4 0.000000e+00 2143/2282 (93%)
EPI1075 A/chicken/Oita/8/2004 (A/H5N1) segment 1 (PB2) 3441.4 0.000000e+00 2143/2282 (93%)
EPI296683 A/chicken/Korea/SH0911/2009 (A/H9N2) segment 1 (PB2) 3439.6 0.000000e+00 2126/2257 (94%)
EPI296680 A/duck/Korea/SH0908/2009 (A/H9N2) segment 1 (PB2) 3439.6 0.000000e+00 2126/2257 (94%)
EPI296678 A/chicken/Korea/SH0906/2009 (A/H9N2) segment 1 (PB2) 3439.6 0.000000e+00 2126/2257 (94%)
EPI140274 A/migratory duck/Hong Kong/MPS180/2003 (A/H4N6) segment 1 (PB2) 3439.6 0.000000e+00 2129/2261 (94%)
EPI17808 A/Chicken/HongKong/YU562/01 (A/H5N1) segment 1 (PB2) 3439.6 0.000000e+00 2143/2282 (93%)
EPI590056 A/muscovy duck/Vietnam/LBM728/2014 (A/H3N2) segment 1 (PB2) 3435.9 0.000000e+00 2141/2281 (93%)
EPI534735 A/duck/Zhejiang/4812/2013 (A/H3N8) segment 1 (PB2) 3435.9 0.000000e+00 2129/2263 (94%)
EPI527552 A/mallard/Mongolia/1402/2011 (A/H4N6) segment 1 (PB2) 3435.9 0.000000e+00 2142/2282 (93%)
EPI502562 A/wild waterfowl/Dongting/PC2560/2012 (A/H9N2) segment 1 (PB2) 3435.9 0.000000e+00 2142/2282 (93%)
EPI502490 A/wild waterfowl/Dongting/C2150/2011 (A/H9N2) segment 1 (PB2) 3435.9 0.000000e+00 2142/2282 (93%)
EPI469160 A/northern shoveler/Hong Kong/MPE2531/2008 (A/H10N9) segment 1 (PB2) 3435.9 0.000000e+00 2144/2284 (93%)
EPI457894 A/duck/Guangxi/GXd-1/2011 (A/H1N2) segment 1 (PB2) 3435.9 0.000000e+00 2143/2283 (93%)
EPI389756 A/canine/Korea/01/2007 (A/H3N2) segment 1 (PB2) 3435.9 0.000000e+00 2143/2283 (93%)
EPI387472 A/ruddy shelduck/Mongolia/2-79/2007 (A/H3N8) segment 1 (PB2) 3435.9 0.000000e+00 2139/2277 (93%)
EPI384247 A/parrot/Guangdong/C99/2005 (A/H5N1) segment 1 (PB2) 3435.9 0.000000e+00 2142/2282 (93%)
EPI284212 A/canine/Guangdong/1/2006 (A/H3N2) segment 1 (PB2) 3435.9 0.000000e+00 2143/2283 (93%)
EPI262690 A/aquatic bird/Korea/w193/2007 (A/H5N2) segment 1 (PB2) 3435.9 0.000000e+00 2143/2283 (93%)
EPI235908 A/duck/Zhejiang/bj/2002 (A/H5N1) segment 1 (PB2) 3435.9 0.000000e+00 2143/2283 (93%)
EPI222894 A/canine/Korea/GCVP01/2007 (A/H3N2) segment 1 (PB2) 3435.9 0.000000e+00 2143/2283 (93%)
EPI1111 A/crow/Kyoto/53/2004 (A/H5N1) segment 1 (PB2) 3435.9 0.000000e+00 2143/2283 (93%)
EPI313952 A/duck/Taiwan/4262/2007 (A/H4N6) segment 1 (PB2) 3434.0 0.000000e+00 2109/2232 (94%)
EPI275132 A/common murre/Alaska/44089-066/2006 (A/H10N2) segment 1 (PB2) 3434.0 0.000000e+00 2125/2258 (94%)
EPI580822 A/northern pintail/Alaska/2011-0703/2011 (A/H9N2) segment 1 (PB2) 3430.3 0.000000e+00 2141/2282 (93%)
EPI579971 A/emperor goose/Alaska/2011-0713/2011 (A/H9N2) segment 1 (PB2) 3430.3 0.000000e+00 2141/2282 (93%)
EPI544897 A/canine/Korea/VC378/2012 (A/H3N2) segment 1 (PB2) 3430.3 0.000000e+00 2142/2283 (93%)
EPI527542 A/common shelduck/Mongolia/2157/2011 (A/H3N3) segment 1 (PB2) 3430.3 0.000000e+00 2141/2282 (93%)
EPI502451 A/wild waterfowl/Dongting/C2032/2011 (A/H9N2) segment 1 (PB2) 3430.3 0.000000e+00 2141/2282 (93%)
EPI315128 A/duck/Vietnam/G30/2008 (A/H11N9) segment 1 (PB2) 3430.3 0.000000e+00 2142/2283 (93%)
EPI284237 A/canine/Guangdong/1/2007 (A/H3N2) segment 1 (PB2) 3430.3 0.000000e+00 2141/2282 (93%)
EPI284229 A/canine/Guangdong/2/2007 (A/H3N2) segment 1 (PB2) 3430.3 0.000000e+00 2141/2282 (93%)
EPI269154 A/mallard/Jiangxi/10071/2005 (A/H6N1) segment 1 (PB2) 3430.3 0.000000e+00 2142/2283 (93%)
EPI235804 A/chicken/Jilin/hd/2002 (A/H5N1) segment 1 (PB2) 3430.3 0.000000e+00 2141/2282 (93%)
EPI235182 A/goose/Jilin/hb/2003 (A/H5N1) segment 1 (PB2) 3430.3 0.000000e+00 2141/2282 (93%)
EPI235143 A/duck/Hubei/wq/2003 (A/H5N1) segment 1 (PB2) 3430.3 0.000000e+00 2141/2282 (93%)
EPI135741 A/partridge/Shantou/2886/2003 (A/H5N1) segment 1 (PB2) 3430.3 0.000000e+00 2140/2281 (93%)
EPI135456 A/partridge/Shantou/478/2002 (A/H5N1) segment 1 (PB2) 3430.3 0.000000e+00 2141/2282 (93%)
EPI23732 A/chicken/Jilin/9/2004 (A/H5N1) segment 1 (PB2) 3430.3 0.000000e+00 2141/2282 (93%)
EPI527750 A/mallard/San Jiang/275/2007 (A/H6N1) segment 1 (PB2) 3428.5 0.000000e+00 2141/2283 (93%)
EPI598951 A/duck/Wuxi/2/2013 (A/H2N2) segment 1 (PB2) 3424.8 0.000000e+00 2142/2284 (93%)
EPI596631 A/duck/Quang Ninh/14/2013 (A/H3N6) segment 1 (PB2) 3424.8 0.000000e+00 2140/2282 (93%)
EPI589346 A/duck/Vietnam/LBM211/2012 (A/H3N8) segment 1 (PB2) 3424.8 0.000000e+00 2140/2282 (93%)
EPI527538 A/wild bird/Mongolia/2066/2011 (A/H5N3) segment 1 (PB2) 3424.8 0.000000e+00 2140/2282 (93%)
EPI502607 A/wild waterfowl/Dongting/PC2562/2012 (A/H9N2) segment 1 (PB2) 3424.8 0.000000e+00 2140/2282 (93%)
EPI461737 A/duck/Hunan/S4137/2011 (A/H11N9) segment 1 (PB2) 3424.8 0.000000e+00 2140/2282 (93%)
EPI461668 A/duck/Hunan/S4013/2011 (A/H11N9) segment 1 (PB2) 3424.8 0.000000e+00 2140/2282 (93%)
EPI438249 A/duck/Vietnam/G18-1/2011 (A/H3N8) segment 1 (PB2) 3424.8 0.000000e+00 2141/2283 (93%)
EPI387469 A/pintail/Mongolia/2-65/2007 (A/H3N8) segment 1 (PB2) 3424.8 0.000000e+00 2140/2281 (93%)
EPI363951 A/duck/Guizhou/5482/2007 (A/H6N2) segment 1 (PB2) 3424.8 0.000000e+00 2142/2284 (93%)
EPI345926 A/whistling swan/Shimane/580/2002 (A/H5N3) segment 1 (PB2) 3424.8 0.000000e+00 2140/2282 (93%)
EPI284221 A/canine/Guangdong/2/2006 (A/H3N2) segment 1 (PB2) 3424.8 0.000000e+00 2141/2283 (93%)
EPI275779 A/chicken/Hunan/41/2004 (A/H5N1) segment 1 (PB2) 3424.8 0.000000e+00 2140/2282 (93%)
EPI275140 A/common murre/Alaska/44085-165/2006 (A/H11N9) segment 1 (PB2) 3424.8 0.000000e+00 2113/2242 (94%)
EPI275136 A/thick-billed murre/Alaska/44085-108/2006 (A/H1N9) segment 1 (PB2) 3424.8 0.000000e+00 2113/2242 (94%)
EPI269287 A/duck/Shantou/728/2001 (A/H6N2) segment 1 (PB2) 3424.8 0.000000e+00 2141/2283 (93%)
EPI239818 A/softbill/California/33445-136/1992 (A/H7N1) segment 1 (PB2) 3424.8 0.000000e+00 2139/2281 (93%)
EPI235951 A/goose/Hong Kong/739.2/2002 (A/H5N1) segment 1 (PB2) 3424.8 0.000000e+00 2140/2282 (93%)
EPI235916 A/egret/Hong Kong/757.2/2002 (A/H5N1) segment 1 (PB2) 3424.8 0.000000e+00 2140/2282 (93%)
EPI235763 A/chicken/Hong Kong/409.1/2002 (A/H5N1) segment 1 (PB2) 3424.8 0.000000e+00 2140/2282 (93%)
EPI235134 A/duck/Hubei/wp/2003 (A/H5N1) segment 1 (PB2) 3424.8 0.000000e+00 2140/2282 (93%)
EPI139548 A/Ck/HK/96.1/02 (A/H5N1) segment 1 (PB2) 3424.8 0.000000e+00 2138/2279 (93%)
EPI136368 A/chicken/Yunnan/6797/2003 (A/H5N1) segment 1 (PB2) 3424.8 0.000000e+00 2141/2283 (93%)
EPI136273 A/duck/Yunnan/5169/2003 (A/H5N1) segment 1 (PB2) 3424.8 0.000000e+00 2140/2282 (93%)
EPI136254 A/duck/Yunnan/5090/2003 (A/H5N1) segment 1 (PB2) 3424.8 0.000000e+00 2140/2282 (93%)
EPI136216 A/duck/Yunnan/4072/2003 (A/H5N1) segment 1 (PB2) 3424.8 0.000000e+00 2140/2282 (93%)
EPI135684 A/chicken/Shantou/133/2003 (A/H5N1) segment 1 (PB2) 3424.8 0.000000e+00 2122/2255 (94%)
EPI106113 A/black bulbul/Fujian/439/04 (A/H5N1) segment 1 (PB2) 3424.8 0.000000e+00 2140/2282 (93%)
EPI24605 A/egret/Hong Kong/757.2/03 (A/H5N1) segment 1 (PB2) 3424.8 0.000000e+00 2140/2282 (93%)
EPI24603 A/duck/Hong Kong/821/2002 (A/H5N1) segment 1 (PB2) 3424.8 0.000000e+00 2140/2282 (93%)
EPI508025 A/common teal/Korea/MHC5-8/2009 (A/H7N7) segment 1 (PB2) 3423.0 0.000000e+00 2128/2264 (93%)
EPI17802 A/Pheasant/Hong Kong/FY155/01 (A/H5N1) segment 1 (PB2) 3423.0 0.000000e+00 2140/2282 (93%)
EPI515027 A/muscovy duck/Vietnam/LBM455/2013 (A/H6N2) segment 1 (PB2) 3419.3 0.000000e+00 2139/2282 (93%)
EPI460102 A/canine/Korea/MV1/2012 (A/H3N2) segment 1 (PB2) 3419.3 0.000000e+00 2140/2283 (93%)
EPI442022 A/quail/Jiangsu/k0104/2010 (A/H5N5) segment 1 (PB2) 3419.3 0.000000e+00 2140/2283 (93%)
EPI439065 A/domestic green-winged teal/Hunan/3450/2006 (A/H5N1) segment 1 (PB2) 3419.3 0.000000e+00 2140/2283 (93%)

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Wed Oct 14, 2015 11:58 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
EPI620456 A/chicken/Iowa/14589-1/2015 (A/H5N2) segment 2 (PB1) 4189.3 0.000000e+00 2272/2274 (99%)
EPI620435 A/turkey/Iowa/14319-1/2015 (A/H5N2) segment 2 (PB1) 4189.3 0.000000e+00 2272/2274 (99%)
EPI620428 A/turkey/Iowa/14318-1/2015 (A/H5N2) segment 2 (PB1) 4189.3 0.000000e+00 2272/2274 (99%)
EPI620421 A/chicken/Iowa/13542-2/2015 (A/H5N2) segment 2 (PB1) 4189.3 0.000000e+00 2272/2274 (99%)
EPI620414 A/turkey/Iowa/13541-1/2015 (A/H5N2) segment 2 (PB1) 4189.3 0.000000e+00 2272/2274 (99%)
EPI587631 A/chicken/Iowa/04-20/2015 (A/H5N2) segment 2 (PB1) 4189.3 0.000000e+00 2272/2274 (99%)
EPI620442 A/chicken/Iowa/14322-6/2015 (A/H5N2) segment 2 (PB1) 4183.8 0.000000e+00 2271/2274 (99%)
EPI590739 A/turkey/Minnesota/9845-4/2015 (A/H5N2) segment 2 (PB1) 4167.2 0.000000e+00 2268/2274 (99%)
EPI620449 A/chicken/Iowa/14399-4/2015 (A/H5N2) segment 2 (PB1) 4161.6 0.000000e+00 2267/2274 (99%)
EPI620407 A/turkey/Iowa/11762-1/2015 (A/H5N2) segment 2 (PB1) 4161.6 0.000000e+00 2267/2274 (99%)
EPI590698 A/chicken/Oregon/A01819044/2015 (A/H5N2) segment 2 (PB1) 4156.1 0.000000e+00 2266/2274 (99%)
EPI590684 A/turkey/Minnesota/9892-2/2015 (A/H5N2) segment 2 (PB1) 4156.1 0.000000e+00 2266/2274 (99%)
EPI586556 A/chicken/BC/FAV25/2014 (A/H5N2) segment 2 (PB1) 4156.1 0.000000e+00 2266/2274 (99%)
EPI586540 A/chicken/BC/FAV23/2014 (A/H5N2) segment 2 (PB1) 4156.1 0.000000e+00 2266/2274 (99%)
EPI586507 A/poultry/BC/FAV19/2014 (A/H5N2) segment 2 (PB1) 4156.1 0.000000e+00 2266/2274 (99%)
EPI584077 A/turkey/BC/FAV14/2014 (A/H5N2) segment 2 (PB1) 4156.1 0.000000e+00 2266/2274 (99%)
EPI573275 A/domestic duck/Washington/61-16/2014 (A/H5N2) segment 2 (PB1) 4156.1 0.000000e+00 2266/2274 (99%)
EPI573270 A/chicken/Washington/61-9/2014 (A/H5N2) segment 2 (PB1) 4156.1 0.000000e+00 2266/2274 (99%)
EPI569364 A/turkey/Washington/61-22/2014 (A/H5N2) segment 2 (PB1) 4156.1 0.000000e+00 2266/2274 (99%)
EPI590718 A/turkey/Missouri/7458-1/2015 (A/H5N2) segment 2 (PB1) 4150.5 0.000000e+00 2265/2274 (99%)
EPI590711 A/turkey/Minnesota/7172-1/2015 (A/H5N2) segment 2 (PB1) 4150.5 0.000000e+00 2265/2274 (99%)
EPI590691 A/chicken/Washington/3490-18/2015 (A/H5N2) segment 2 (PB1) 4150.5 0.000000e+00 2265/2274 (99%)
EPI586516 A/chicken/BC/FAV20/2014 (A/H5N2) segment 2 (PB1) 4150.5 0.000000e+00 2265/2274 (99%)
EPI586499 A/poultry/BC/FAV17/2014 (A/H5N2) segment 2 (PB1) 4150.5 0.000000e+00 2265/2274 (99%)
EPI586491 A/poultry/BC/FAV15/2014 (A/H5N2) segment 2 (PB1) 4150.5 0.000000e+00 2265/2274 (99%)
EPI585090 A/pheasant/Washington/3147-2/2015 (A/H5N2) segment 2 (PB1) 4150.5 0.000000e+00 2265/2274 (99%)
EPI576469 A/chicken/BC/FAV8/2014 (A/H5N2) segment 2 (PB1) 4150.5 0.000000e+00 2265/2274 (99%)
EPI569381 A/Northern pintail/Washington/40964/2014 (A/H5N2) segment 2 (PB1) 4150.5 0.000000e+00 2265/2274 (99%)
EPI586548 A/chicken/BC/FAV24/2014 (A/H5N2) segment 2 (PB1) 4145.0 0.000000e+00 2264/2274 (99%)
EPI586532 A/chicken/BC/FAV22/2014 (A/H5N2) segment 2 (PB1) 4145.0 0.000000e+00 2264/2274 (99%)
EPI586524 A/chicken/BC/FAV21/2014 (A/H5N2) segment 2 (PB1) 4145.0 0.000000e+00 2264/2274 (99%)
EPI576476 A/chicken/BC/FAV9/2014 (A/H5N2) segment 2 (PB1) 4145.0 0.000000e+00 2264/2274 (99%)
EPI573297 A/turkey/BC/FAV10/2014 (A/H5N2) segment 2 (PB1) 4145.0 0.000000e+00 2264/2274 (99%)
EPI590732 A/chicken/Kansas/8395-3/2015 (A/H5N2) segment 2 (PB1) 4139.5 0.000000e+00 2263/2274 (99%)
EPI590725 A/turkey/Arkansas/7791-1/2015 (A/H5N2) segment 2 (PB1) 4139.5 0.000000e+00 2263/2274 (99%)
EPI420193 A/bufflehead/California/3118/2011 (A/H4N8) segment 2 (PB1) 4045.3 0.000000e+00 2246/2274 (98%)
EPI418616 A/American green-winged teal/Mississippi/11OS98/2011 (A/H0) segment 2 (PB1) 4034.2 0.000000e+00 2244/2274 (98%)
EPI512660 A/wood duck/Wisconsin/11OS3443/2011 (A/H11N9) segment 2 (PB1) 4023.1 0.000000e+00 2242/2274 (98%)
EPI512230 A/mallard/Arkansas/12OS179/2012 (A/H1N1) segment 2 (PB1) 4023.1 0.000000e+00 2242/2274 (98%)
EPI436582 A/American green-winged teal/Interior Alaska/10BM05376R0/2010 (A/H3N8) segment 2 (PB1) 4023.1 0.000000e+00 2242/2274 (98%)
EPI418963 A/American green-winged teal/Wisconsin/10OS3127/2010 (A/H5N2) segment 2 (PB1) 4023.1 0.000000e+00 2242/2274 (98%)
EPI453910 A/northern pintail/Interior Alaska/10BM10298R0/2010 (A/H3N8) segment 2 (PB1) 4017.6 0.000000e+00 2241/2274 (98%)
EPI436612 A/northern shoveler/Interior Alaska/10BM05487R0/2010 (A/H3N8) segment 2 (PB1) 4017.6 0.000000e+00 2241/2274 (98%)
EPI436589 A/northern shoveler/Interior Alaska/10BM05382R0/2010 (A/H3N8) segment 2 (PB1) 4017.6 0.000000e+00 2241/2274 (98%)
EPI419953 A/mallard/California/2559P/2011 (A/H5N8) segment 2 (PB1) 4017.6 0.000000e+00 2241/2274 (98%)
EPI419909 A/mallard/California/2552V/2011 (A/H4N8) segment 2 (PB1) 4017.6 0.000000e+00 2241/2274 (98%)
EPI419869 A/mallard/California/2542V/2011 (A/H5N1) segment 2 (PB1) 4017.6 0.000000e+00 2241/2274 (98%)
EPI419842 A/mallard/California/2536P/2011 (A/H5N1) segment 2 (PB1) 4017.6 0.000000e+00 2241/2274 (98%)
EPI419835 A/mallard/California/2535V/2011 (A/H5N1) segment 2 (PB1) 4017.6 0.000000e+00 2241/2274 (98%)
EPI419828 A/mallard/California/2535P/2011 (A/H5N1) segment 2 (PB1) 4017.6 0.000000e+00 2241/2274 (98%)
EPI387181 A/mallard/California/2396/2010 (A/H5N2) segment 2 (PB1) 4017.6 0.000000e+00 2241/2274 (98%)
EPI512474 A/blue-winged teal/Missouri/11OS2563/2011 (A/H12N4) segment 2 (PB1) 4012.0 0.000000e+00 2240/2274 (98%)
EPI452523 A/northern pintail/Interior Alaska/10BM12413R0/2010 (A/H8N4) segment 2 (PB1) 4012.0 0.000000e+00 2240/2274 (98%)
EPI451651 A/mallard/Interior Alaska/10BM07575R0/2010 (A/H7N3) segment 2 (PB1) 4012.0 0.000000e+00 2240/2274 (98%)
EPI436619 A/northern shoveler/Interior Alaska/10BM05491R0/2010 (A/H3N8) segment 2 (PB1) 4012.0 0.000000e+00 2240/2274 (98%)
EPI433197 A/mallard/Interior Alaska/10BM04564R1/2010 (A/H7N3) segment 2 (PB1) 4012.0 0.000000e+00 2240/2274 (98%)
EPI420142 A/mallard/California/2595V/2011 (A/H12N5) segment 2 (PB1) 4012.0 0.000000e+00 2240/2274 (98%)
EPI420135 A/mallard/California/2595P/2011 (A/H12N5) segment 2 (PB1) 4012.0 0.000000e+00 2240/2274 (98%)
EPI420114 A/mallard/California/2590V/2011 (A/H4N6) segment 2 (PB1) 4012.0 0.000000e+00 2240/2274 (98%)
EPI420087 A/mallard/California/2584V/2011 (A/H4N9) segment 2 (PB1) 4012.0 0.000000e+00 2240/2274 (98%)
EPI420080 A/mallard/California/2584P/2011 (A/H4N9) segment 2 (PB1) 4012.0 0.000000e+00 2240/2274 (98%)
EPI419939 A/mallard/California/2555V/2011 (A/H11N9) segment 2 (PB1) 4012.0 0.000000e+00 2240/2274 (98%)
EPI419916 A/mallard/California/2555P/2011 (A/H11N9) segment 2 (PB1) 4012.0 0.000000e+00 2240/2274 (98%)
EPI419807 A/mallard/California/2531V/2011 (A/H5N1) segment 2 (PB1) 4012.0 0.000000e+00 2240/2274 (98%)
EPI419794 A/mallard/California/2531P/2011 (A/H5N1) segment 2 (PB1) 4012.0 0.000000e+00 2240/2274 (98%)
EPI419786 A/mallard/California/2527V/2011 (A/H5N1) segment 2 (PB1) 4012.0 0.000000e+00 2240/2274 (98%)
EPI420128 A/mallard/California/2594V/2011 (A/H4N6) segment 2 (PB1) 4006.5 0.000000e+00 2239/2274 (98%)
EPI420121 A/mallard/California/2594P/2011 (A/H4N6) segment 2 (PB1) 4006.5 0.000000e+00 2239/2274 (98%)
EPI420101 A/mallard/California/2589V/2011 (A/H4N1) segment 2 (PB1) 4006.5 0.000000e+00 2239/2274 (98%)
EPI420094 A/mallard/California/2589P/2011 (A/H4N1) segment 2 (PB1) 4006.5 0.000000e+00 2239/2274 (98%)
EPI420073 A/mallard/California/2578V/2011 (A/H0) segment 2 (PB1) 4006.5 0.000000e+00 2239/2274 (98%)
EPI419855 A/mallard/California/2536V/2011 (A/H5N1) segment 2 (PB1) 4006.5 0.000000e+00 2239/2274 (98%)
EPI419821 A/mallard/California/2533V/2011 (A/H4N6) segment 2 (PB1) 4006.5 0.000000e+00 2239/2274 (98%)
EPI419779 A/mallard/California/2525P/2011 (A/H4N6) segment 2 (PB1) 4006.5 0.000000e+00 2239/2274 (98%)
EPI418440 A/mallard/California/2525V/2011 (A/H0) segment 2 (PB1) 4006.5 0.000000e+00 2239/2274 (98%)
EPI398563 A/chicken/Jalisco/12283/2012 (A/H7N3) segment 2 (PB1) 4006.5 0.000000e+00 2239/2274 (98%)
EPI616068 A/northern shoveler/Ohio/12OS3173/2012 (A/H12N5) segment 2 (PB1) 4001.0 0.000000e+00 2238/2274 (98%)
EPI513088 A/mallard/Wisconsin/11OS4104/2011 (A/H1N2) segment 2 (PB1) 4001.0 0.000000e+00 2238/2274 (98%)
EPI512676 A/mallard/Wisconsin/11OS3468/2011 (A/H2N3) segment 2 (PB1) 4001.0 0.000000e+00 2238/2274 (98%)
EPI419981 A/mallard/California/2566P/2011 (A/H4N8) segment 2 (PB1) 4001.0 0.000000e+00 2238/2274 (98%)
EPI419974 A/mallard/California/2563V/2011 (A/H4N6) segment 2 (PB1) 4001.0 0.000000e+00 2238/2274 (98%)
EPI419967 A/mallard/California/2563P/2011 (A/H4N6) segment 2 (PB1) 4001.0 0.000000e+00 2238/2274 (98%)
EPI387271 A/northern shoveler/California/3628/2011 (A/H10) segment 2 (PB1) 4001.0 0.000000e+00 2238/2274 (98%)
EPI527489 A/blue-winged teal/TX/AI13-1028/2013 (A/H14N5) segment 2 (PB1) 3995.4 0.000000e+00 2237/2274 (98%)
EPI616276 A/mallard/Ohio/12OS2351/2012 (A/H3N6) segment 2 (PB1) 3989.9 0.000000e+00 2236/2274 (98%)
EPI616160 A/American green-winged teal/Ohio/12OS2128/2012 (A/H6N5) segment 2 (PB1) 3989.9 0.000000e+00 2236/2274 (98%)
EPI531395 A/blue-winged teal/Guatemala/CIP049H105-15/2011 (A/H14N3) segment 2 (PB1) 3989.9 0.000000e+00 2236/2274 (98%)
EPI531387 A/blue-winged teal/Guatemala/CIP049H106-62/2011 (A/H14N6) segment 2 (PB1) 3989.9 0.000000e+00 2236/2274 (98%)
EPI513151 A/northern shoveler/Wisconsin/11OS4631/2011 (A/H0) segment 2 (PB1) 3989.9 0.000000e+00 2236/2274 (98%)
EPI512252 A/northern shoveler/Mississippi/12OS231/2012 (A/H0) segment 2 (PB1) 3989.9 0.000000e+00 2236/2274 (98%)
EPI449635 A/mallard/Minnesota/Sg-01034/2008 (A/H11N2) segment 2 (PB1) 3989.9 0.000000e+00 2236/2274 (98%)
EPI420214 A/green-winged teal/California/123/2012 (A/H1N1) segment 2 (PB1) 3989.9 0.000000e+00 2236/2274 (98%)
EPI614841 A/mallard/Ohio/12OS5400/2013 (A/H0) segment 2 (PB1) 3984.3 0.000000e+00 2235/2274 (98%)
EPI549555 A/blue-winged teal/TX/AI13-1009/2013 (A/H11N3) segment 2 (PB1) 3984.3 0.000000e+00 2235/2274 (98%)
EPI512871 A/northern pintail/Wisconsin/11OS3299/2011 (A/H4N6) segment 2 (PB1) 3984.3 0.000000e+00 2235/2274 (98%)
EPI512587 A/American green-winged teal/Mississippi/11OS5869/2011 (A/H4N6) segment 2 (PB1) 3984.3 0.000000e+00 2235/2274 (98%)
EPI333682 A/mallard/Ohio/1695/2009 (A/H4N6) segment 2 (PB1) 3984.3 0.000000e+00 2235/2274 (98%)
EPI617004 A/mallard/Alberta/192/2010 (A/H7N3) segment 2 (PB1) 3978.8 0.000000e+00 2234/2274 (98%)
EPI616992 A/mallard/Alberta/167/2010 (A/H7N3) segment 2 (PB1) 3978.8 0.000000e+00 2234/2274 (98%)
EPI616341 A/mallard/Missouri/12OS5759/2012 (A/H11N9) segment 2 (PB1) 3978.8 0.000000e+00 2234/2274 (98%)
EPI616122 A/American green-winged teal/Ohio/12OS2161/2012 (A/H11N2) segment 2 (PB1) 3978.8 0.000000e+00 2234/2274 (98%)
EPI512355 A/mallard/Illinois/11OS4420/2011 (A/H2N3) segment 2 (PB1) 3978.8 0.000000e+00 2234/2274 (98%)
EPI419590 A/blue-winged teal/Missouri/10MO0011/2010 (A/H3N6) segment 2 (PB1) 3978.8 0.000000e+00 2234/2274 (98%)
EPI549523 A/blue-winged teal/LA/AI13-238/2013 (A/H7N7) segment 2 (PB1) 3975.1 0.000000e+00 2233/2274 (98%)
EPI616252 A/mallard/Ohio/12OS1418/2012 (A/H0) segment 2 (PB1) 3973.3 0.000000e+00 2233/2274 (98%)
EPI616236 A/blue-winged teal/Ohio/12OS2106/2012 (A/H4N6) segment 2 (PB1) 3973.3 0.000000e+00 2234/2275 (98%)
EPI549714 A/blue-winged teal/LA/AI13-1437/2013 (A/H7N7) segment 2 (PB1) 3973.3 0.000000e+00 2233/2274 (98%)
EPI549705 A/blue-winged teal/LA/AI13-1423/2013 (A/H7N7) segment 2 (PB1) 3973.3 0.000000e+00 2233/2274 (98%)
EPI549701 A/blue-winged teal/LA/AI13-1435/2013 (A/H7N7) segment 2 (PB1) 3973.3 0.000000e+00 2233/2274 (98%)
EPI549691 A/blue-winged teal/LA/AI13-1421/2013 (A/H7N7) segment 2 (PB1) 3973.3 0.000000e+00 2233/2274 (98%)
EPI549688 A/blue-winged teal/LA/AI13-1429/2013 (A/H7N7) segment 2 (PB1) 3973.3 0.000000e+00 2233/2274 (98%)
EPI549673 A/blue-winged teal/LA/AI13-1425/2013 (A/H7N7) segment 2 (PB1) 3973.3 0.000000e+00 2233/2274 (98%)
EPI549665 A/blue-winged teal/LA/AI13-1416/2013 (A/H7N7) segment 2 (PB1) 3973.3 0.000000e+00 2233/2274 (98%)
EPI549658 A/blue-winged teal/LA/AI13-1415/2013 (A/H7N7) segment 2 (PB1) 3973.3 0.000000e+00 2233/2274 (98%)
EPI549644 A/blue-winged teal/LA/AI13-1413/2013 (A/H7N7) segment 2 (PB1) 3973.3 0.000000e+00 2233/2274 (98%)
EPI549637 A/blue-winged teal/LA/AI13-1412/2013 (A/H7N7) segment 2 (PB1) 3973.3 0.000000e+00 2233/2274 (98%)
EPI549630 A/blue-winged teal/LA/AI13-1381/2013 (A/H7N7) segment 2 (PB1) 3973.3 0.000000e+00 2233/2274 (98%)
EPI549623 A/blue-winged teal/LA/AI13-1357/2013 (A/H7N7) segment 2 (PB1) 3973.3 0.000000e+00 2233/2274 (98%)
EPI549616 A/blue-winged teal/LA/AI13-1345/2013 (A/H7N7) segment 2 (PB1) 3973.3 0.000000e+00 2233/2274 (98%)
EPI549609 A/blue-winged teal/LA/AI13-1341/2013 (A/H7N7) segment 2 (PB1) 3973.3 0.000000e+00 2233/2274 (98%)
EPI549602 A/blue-winged teal/LA/AI13-1340/2013 (A/H7N7) segment 2 (PB1) 3973.3 0.000000e+00 2233/2274 (98%)
EPI549596 A/blue-winged teal/LA/AI13-1339/2013 (A/H7N7) segment 2 (PB1) 3973.3 0.000000e+00 2233/2274 (98%)
EPI549590 A/blue-winged teal/LA/AI13-1338/2013 (A/H7N7) segment 2 (PB1) 3973.3 0.000000e+00 2233/2274 (98%)
EPI549583 A/blue-winged teal/LA/AI13-1337/2013 (A/H7N7) segment 2 (PB1) 3973.3 0.000000e+00 2233/2274 (98%)
EPI549569 A/blue-winged teal/LA/AI13-1226/2013 (A/H7N7) segment 2 (PB1) 3973.3 0.000000e+00 2233/2274 (98%)
EPI512726 A/American green-winged teal/Wisconsin/11OS3425/2011 (A/H12N5) segment 2 (PB1) 3973.3 0.000000e+00 2233/2274 (98%)
EPI512185 A/northern shoveler/Mississippi/12OS347/2012 (A/H7N7) segment 2 (PB1) 3973.3 0.000000e+00 2233/2274 (98%)
EPI512139 A/northern pintail/Mississippi/12OS420/2012 (A/H0) segment 2 (PB1) 3973.3 0.000000e+00 2233/2274 (98%)
EPI393386 A/Mexico/InDRE7218/2012 (A/H7N3) segment 2 (PB1) 3973.3 0.000000e+00 2233/2274 (98%)
EPI549651 A/blue-winged teal/LA/AI13-1414/2013 (A/H7N7) segment 2 (PB1) 3969.6 0.000000e+00 2232/2274 (98%)
EPI549562 A/blue-winged teal/LA/AI13-1225/2013 (A/H7N7) segment 2 (PB1) 3969.6 0.000000e+00 2232/2274 (98%)
EPI549724 A/blue-winged teal/LA/AI13-1424/2013 (A/H7N7) segment 2 (PB1) 3967.7 0.000000e+00 2232/2274 (98%)
EPI549678 A/blue-winged teal/LA/AI13-1420/2013 (A/H7N7) segment 2 (PB1) 3965.9 0.000000e+00 2231/2274 (98%)
EPI549496 A/blue-winged teal/LA/AI13-178/2013 (A/H7N7) segment 2 (PB1) 3965.9 0.000000e+00 2231/2274 (98%)
EPI616313 A/northern shoveler/Illinois/12OS4951/2012 (A/H7N3) segment 2 (PB1) 3962.2 0.000000e+00 2231/2274 (98%)
EPI614578 A/American green-winged teal/Wisconsin/12OS4536/2012 (A/H11N9) segment 2 (PB1) 3962.2 0.000000e+00 2231/2274 (98%)
EPI549489 A/blue-winged teal/LA/AI13-145/2013 (A/H7N7) segment 2 (PB1) 3962.2 0.000000e+00 2230/2274 (98%)
EPI449684 A/ring-necked duck/Minnesota/Sg-01066/2008 (A/H12N8) segment 2 (PB1) 3962.2 0.000000e+00 2231/2274 (98%)
EPI299489 A/mallard/Illinois/08OS2315/2008 (A/H4N6) segment 2 (PB1) 3962.2 0.000000e+00 2231/2274 (98%)
EPI616042 A/northern shoveler/Ohio/12OS5539/2012 (A/H7N3) segment 2 (PB1) 3956.6 0.000000e+00 2230/2274 (98%)
EPI616035 A/American green-winged teal/Ohio/12OS5538/2012 (A/H7N3) segment 2 (PB1) 3956.6 0.000000e+00 2230/2274 (98%)
EPI614871 A/northern pintail/Wisconsin/12OS3076/2012 (A/H0) segment 2 (PB1) 3956.6 0.000000e+00 2228/2271 (98%)
EPI616167 A/American green-winged teal/Ohio/12OS2137/2012 (A/H4N6) segment 2 (PB1) 3951.1 0.000000e+00 2230/2275 (98%)
EPI512401 A/blue-winged teal/Missouri/11OS2585/2011 (A/H4N8) segment 2 (PB1) 3951.1 0.000000e+00 2229/2274 (98%)
EPI448650 A/blue-winged teal/North Dakota/Sg-00706/2008 (A/H4N6) segment 2 (PB1) 3951.1 0.000000e+00 2229/2274 (98%)
EPI448643 A/mallard/North Dakota/Sg-00703/2008 (A/H12N4) segment 2 (PB1) 3951.1 0.000000e+00 2229/2274 (98%)
EPI419081 A/mallard/Wisconsin/10OS3066/2010 (A/H6N2) segment 2 (PB1) 3951.1 0.000000e+00 2229/2274 (98%)
EPI418706 A/American green-winged teal/Illinois/10OS1598/2010 (A/H4N8) segment 2 (PB1) 3951.1 0.000000e+00 2229/2274 (98%)
EPI188754 A/mallard/North Dakota/Sg-00703/2008 (A/H12N4) segment 2 (PB1) 3951.1 0.000000e+00 2229/2274 (98%)
EPI616243 A/blue-winged teal/Ohio/12OS2108/2012 (A/H0) segment 2 (PB1) 3945.6 0.000000e+00 2228/2274 (97%)
EPI615996 A/redhead/Ohio/13OS0431/2013 (A/H1N2) segment 2 (PB1) 3940.0 0.000000e+00 2227/2274 (97%)
EPI614855 A/lesser scaup/Wisconsin/12OS4408/2012 (A/H1N8) segment 2 (PB1) 3940.0 0.000000e+00 2227/2274 (97%)
EPI573284 A/American green-winged teal/Washington/195750/2014 (A/H5N1) segment 2 (PB1) 3940.0 0.000000e+00 2227/2274 (97%)
EPI512297 A/mallard/Arkansas/12OS140/2012 (A/H11N3) segment 2 (PB1) 3940.0 0.000000e+00 2228/2275 (97%)
EPI512244 A/American green-winged teal/Mississippi/12OS191/2012 (A/H5N3) segment 2 (PB1) 3940.0 0.000000e+00 2228/2275 (97%)
EPI333882 A/blue-winged teal/Wisconsin/2649/2009 (A/H6N1) segment 2 (PB1) 3940.0 0.000000e+00 2227/2274 (97%)
EPI227361 A/mallard/Quebec/16566/2005 (A/H11N2) segment 2 (PB1) 3940.0 0.000000e+00 2227/2274 (97%)
EPI69001 A/environment/Maryland/763/2006 (A/H11N9) segment 2 (PB1) 3940.0 0.000000e+00 2227/2274 (97%)
EPI596209 A/mallard/Maryland/13OS3035/2014 (A/H10N7) segment 2 (PB1) 3934.5 0.000000e+00 2226/2274 (97%)
EPI595638 A/mallard/Maryland/07OS90/2007 (A/H10N7) segment 2 (PB1) 3934.5 0.000000e+00 2226/2274 (97%)
EPI595631 A/mallard/Maryland/07OS89/2007 (A/H10N7) segment 2 (PB1) 3934.5 0.000000e+00 2226/2274 (97%)
EPI595624 A/mallard/Maryland/07OS73/2007 (A/H10N7) segment 2 (PB1) 3934.5 0.000000e+00 2226/2274 (97%)
EPI595617 A/mallard/Maryland/07OS71/2007 (A/H10N7) segment 2 (PB1) 3934.5 0.000000e+00 2226/2274 (97%)
EPI595603 A/mallard/Maryland/07OS56/2007 (A/H10N7) segment 2 (PB1) 3934.5 0.000000e+00 2226/2274 (97%)
EPI595596 A/mallard/Maryland/07OS55/2007 (A/H10N7) segment 2 (PB1) 3934.5 0.000000e+00 2226/2274 (97%)
EPI594873 A/environment/Maryland/05OS1173/2005 (A/H10N7) segment 2 (PB1) 3934.5 0.000000e+00 2226/2274 (97%)
EPI542115 A/mallard/Alaska/ND0006301/2013 (A/H3N8) segment 2 (PB1) 3934.5 0.000000e+00 2226/2274 (97%)
EPI512534 A/gadwall/Mississippi/11OS6084/2011 (A/H11N2) segment 2 (PB1) 3934.5 0.000000e+00 2226/2274 (97%)
EPI512527 A/northern shoveler/Mississippi/11OS6077/2011 (A/H11N2) segment 2 (PB1) 3934.5 0.000000e+00 2226/2274 (97%)
EPI435694 A/mallard/Alberta/65/2004 (A/H10N7) segment 2 (PB1) 3934.5 0.000000e+00 2226/2274 (97%)
EPI614466 A/northern shoveler/Illinois/12OS5128/2012 (A/H2N5) segment 2 (PB1) 3928.9 0.000000e+00 2225/2274 (97%)
EPI595645 A/mallard/Maryland/07OS92/2007 (A/H10N7) segment 2 (PB1) 3928.9 0.000000e+00 2225/2274 (97%)
EPI595610 A/mallard/Maryland/07OS66/2007 (A/H10N7) segment 2 (PB1) 3928.9 0.000000e+00 2225/2274 (97%)
EPI585192 A/redhead/Ohio/13OS0376/2013 (A/H4N6) segment 2 (PB1) 3928.9 0.000000e+00 2225/2274 (97%)
EPI438118 A/mallard/Alberta/56/2004 (A/H10N7) segment 2 (PB1) 3928.9 0.000000e+00 2225/2274 (97%)
EPI435708 A/mallard/Alberta/67/2004 (A/H10N7) segment 2 (PB1) 3928.9 0.000000e+00 2225/2274 (97%)
EPI435687 A/mallard/Alberta/62/2004 (A/H10N7) segment 2 (PB1) 3928.9 0.000000e+00 2225/2274 (97%)
EPI418856 A/mallard/Wisconsin/10OS4194/2010 (A/H11N9) segment 2 (PB1) 3928.9 0.000000e+00 2225/2274 (97%)
EPI188436 A/mallard/Minnesota/Sg-00579/2008 (A/H1N1) segment 2 (PB1) 3928.9 0.000000e+00 2226/2275 (97%)
EPI645562 A/American green-winged teal/Ohio/13OS2070/2013 (A/H6N7) segment 2 (PB1) 3923.4 0.000000e+00 2224/2274 (97%)
EPI645555 A/blue-winged teal/Iowa/13OS2316/2013 (A/H7N3) segment 2 (PB1) 3923.4 0.000000e+00 2224/2274 (97%)
EPI645548 A/blue-winged teal/Ohio/13OS2055/2013 (A/H6N7) segment 2 (PB1) 3923.4 0.000000e+00 2224/2274 (97%)
EPI645485 A/American green-winged teal/Wisconsin/13OS3465/2013 (A/H6N8) segment 2 (PB1) 3923.4 0.000000e+00 2224/2274 (97%)
EPI616334 A/mallard/Missouri/12OS5756/2012 (A/H10N7) segment 2 (PB1) 3923.4 0.000000e+00 2224/2274 (97%)
EPI549482 A/blue-winged teal/TX/AI12-1043/2012 (A/H10N1) segment 2 (PB1) 3923.4 0.000000e+00 2224/2274 (97%)
EPI438125 A/mallard/Alberta/57/2004 (A/H10N7) segment 2 (PB1) 3923.4 0.000000e+00 2224/2274 (97%)
EPI435717 A/mallard/Alberta/68/2004 (A/H10N7) segment 2 (PB1) 3923.4 0.000000e+00 2224/2274 (97%)
EPI435701 A/mallard/Alberta/66/2004 (A/H10N7) segment 2 (PB1) 3923.4 0.000000e+00 2224/2274 (97%)
EPI548460 A/blue-winged teal/TX/AI12-500/2012 (A/H7N1) segment 2 (PB1) 3919.7 0.000000e+00 2222/2272 (97%)
EPI616796 A/blue-winged teal/Texas/AI12-909/2012 (A/H7N1) segment 2 (PB1) 3917.9 0.000000e+00 2223/2274 (97%)
EPI614564 A/mallard/Wisconsin/12OS4331/2012 (A/H3N8) segment 2 (PB1) 3917.9 0.000000e+00 2223/2274 (97%)
EPI595358 A/mallard/Maryland/06OS2334/2006 (A/H12N5) segment 2 (PB1) 3917.9 0.000000e+00 2223/2274 (97%)
EPI549470 A/blue-winged teal/TX/AI12-864/2012 (A/H7N1) segment 2 (PB1) 3917.9 0.000000e+00 2223/2274 (97%)
EPI526170 A/blue-winged teal/Ohio/13OS2037/2013 (A/H7N1) segment 2 (PB1) 3917.9 0.000000e+00 2223/2274 (97%)
EPI225176 A/mallard/Quebec/10969/2006 (A/H2N3) segment 2 (PB1) 3917.9 0.000000e+00 2223/2274 (97%)
EPI549506 A/blue-winged teal/LA/AI13-232/2013 (A/H7N7) segment 2 (PB1) 3914.2 0.000000e+00 2219/2274 (97%)
EPI549476 A/blue-winged teal/TX/AI12-909/2012 (A/H7N1) segment 2 (PB1) 3914.2 0.000000e+00 2221/2272 (97%)
EPI549450 A/blue-winged teal/TX/AI12-795/2012 (A/H7N1) segment 2 (PB1) 3914.2 0.000000e+00 2221/2272 (97%)
EPI616288 A/northern shoveler/Mississippi/12OS5438/2012 (A/H0) segment 2 (PB1) 3912.3 0.000000e+00 2222/2274 (97%)
EPI549431 A/blue-winged teal/TX/AI12-572/2012 (A/H7N1) segment 2 (PB1) 3912.3 0.000000e+00 2222/2274 (97%)
EPI549419 A/blue-winged teal/TX/AI12-568/2012 (A/H7N1) segment 2 (PB1) 3912.3 0.000000e+00 2222/2274 (97%)
EPI512779 A/mallard/Wisconsin/11OS3407/2011 (A/H4N9) segment 2 (PB1) 3912.3 0.000000e+00 2222/2274 (97%)
EPI225280 A/mallard/Quebec/11247/2006 (A/H3N2) segment 2 (PB1) 3912.3 0.000000e+00 2222/2274 (97%)
EPI225272 A/mallard/Quebec/11194/2006 (A/H3N2) segment 2 (PB1) 3912.3 0.000000e+00 2222/2274 (97%)
EPI549437 A/blue-winged teal/TX/AI12-590/2012 (A/H7N1) segment 2 (PB1) 3908.6 0.000000e+00 2220/2272 (97%)
EPI595561 A/environment/Maryland/07OS1640/2007 (A/H3N8) segment 2 (PB1) 3906.8 0.000000e+00 2222/2275 (97%)
EPI595547 A/environment/Maryland/07OS1637/2007 (A/H3N8) segment 2 (PB1) 3906.8 0.000000e+00 2222/2275 (97%)
EPI595533 A/environment/Maryland/07OS1634/2007 (A/H3N8) segment 2 (PB1) 3906.8 0.000000e+00 2222/2275 (97%)
EPI595526 A/environment/Maryland/07OS1633/2007 (A/H3N8) segment 2 (PB1) 3906.8 0.000000e+00 2222/2275 (97%)
EPI595519 A/environment/Maryland/07OS1632/2007 (A/H3N8) segment 2 (PB1) 3906.8 0.000000e+00 2222/2275 (97%)
EPI595442 A/environment/Maryland/07OS1613/2007 (A/H3N8) segment 2 (PB1) 3906.8 0.000000e+00 2222/2275 (97%)
EPI595428 A/environment/Maryland/07OS1606/2007 (A/H3N8) segment 2 (PB1) 3906.8 0.000000e+00 2222/2275 (97%)
EPI595421 A/environment/Maryland/07OS1605/2007 (A/H3N8) segment 2 (PB1) 3906.8 0.000000e+00 2222/2275 (97%)
EPI595414 A/environment/Maryland/07OS1603/2007 (A/H3N8) segment 2 (PB1) 3906.8 0.000000e+00 2222/2275 (97%)
EPI595393 A/environment/Maryland/07OS1592/2007 (A/H3N8) segment 2 (PB1) 3906.8 0.000000e+00 2222/2275 (97%)
EPI591029 A/environment/Maryland/07OS1618/2007 (A/H3N8) segment 2 (PB1) 3906.8 0.000000e+00 2222/2275 (97%)
EPI548453 A/blue-winged teal/TX/AI12-433/2012 (A/H7N1) segment 2 (PB1) 3904.9 0.000000e+00 2219/2272 (97%)
EPI595554 A/environment/Maryland/07OS1639/2007 (A/H3N8) segment 2 (PB1) 3901.2 0.000000e+00 2221/2275 (97%)
EPI595498 A/environment/Maryland/07OS1623/2007 (A/H3N8) segment 2 (PB1) 3901.2 0.000000e+00 2221/2275 (97%)
EPI595463 A/environment/Maryland/07OS1617/2007 (A/H3N8) segment 2 (PB1) 3901.2 0.000000e+00 2221/2275 (97%)
EPI595449 A/environment/Maryland/07OS1614/2007 (A/H3N8) segment 2 (PB1) 3901.2 0.000000e+00 2221/2275 (97%)
EPI595435 A/environment/Maryland/07OS1608/2007 (A/H3N8) segment 2 (PB1) 3901.2 0.000000e+00 2221/2275 (97%)
EPI595400 A/environment/Maryland/07OS1597/2007 (A/H3N8) segment 2 (PB1) 3901.2 0.000000e+00 2221/2275 (97%)
EPI549425 A/blue-winged teal/TX/AI12-570/2012 (A/H7N1) segment 2 (PB1) 3901.2 0.000000e+00 2216/2268 (97%)
EPI549413 A/blue-winged teal/TX/AI12-555/2012 (A/H7N1) segment 2 (PB1) 3901.2 0.000000e+00 2220/2274 (97%)
EPI595540 A/environment/Maryland/07OS1635/2007 (A/H3N8) segment 2 (PB1) 3895.7 0.000000e+00 2220/2275 (97%)
EPI595512 A/environment/Maryland/07OS1630/2007 (A/H3N8) segment 2 (PB1) 3895.7 0.000000e+00 2220/2275 (97%)
EPI595505 A/environment/Maryland/07OS1626/2007 (A/H3N8) segment 2 (PB1) 3895.7 0.000000e+00 2220/2275 (97%)
EPI595491 A/environment/Maryland/07OS1622/2007 (A/H3N8) segment 2 (PB1) 3895.7 0.000000e+00 2220/2275 (97%)
EPI595484 A/environment/Maryland/07OS1621/2007 (A/H3N8) segment 2 (PB1) 3895.7 0.000000e+00 2220/2275 (97%)
EPI595477 A/environment/Maryland/07OS1620/2007 (A/H3N8) segment 2 (PB1) 3895.7 0.000000e+00 2220/2275 (97%)
EPI595470 A/environment/Maryland/07OS1619/2007 (A/H3N8) segment 2 (PB1) 3895.7 0.000000e+00 2220/2275 (97%)
EPI595456 A/environment/Maryland/07OS1615/2007 (A/H3N8) segment 2 (PB1) 3895.7 0.000000e+00 2220/2275 (97%)
EPI595407 A/environment/Maryland/07OS1598/2007 (A/H3N8) segment 2 (PB1) 3895.7 0.000000e+00 2220/2275 (97%)
EPI280628 A/waterfowl/Colorado/476466-2/2007 (A/H5N2) segment 2 (PB1) 3895.7 0.000000e+00 2219/2274 (97%)
EPI418932 A/common goldeneye/Wisconsin/10OS4202/2010 (A/H7N6) segment 2 (PB1) 3890.2 0.000000e+00 2218/2274 (97%)
EPI333730 A/northern shovelerMissouri/196/2009 (A/H10N3) segment 2 (PB1) 3890.2 0.000000e+00 2218/2274 (97%)
EPI297962 A/blue-winged teal/Texas/Sg-00082/2007 (A/H3N8) segment 2 (PB1) 3890.2 0.000000e+00 2218/2274 (97%)
EPI616815 A/ruddy turnstone/New Jersey/AI11-891/2011 (A/H0) segment 2 (PB1) 3884.6 0.000000e+00 2217/2274 (97%)
EPI510522 A/duck/SK/4628/2010 (A/H5N3) segment 2 (PB1) 3884.6 0.000000e+00 2217/2274 (97%)
EPI449877 A/blue-winged Teal/Texas/AI09-3464/2009 (A/H4N8) segment 2 (PB1) 3884.6 0.000000e+00 2218/2275 (97%)
EPI449628 A/northern pintail/Louisiana/Sg-01033/2008 (A/H4N8) segment 2 (PB1) 3884.6 0.000000e+00 2217/2274 (97%)
EPI328240 A/mallard/California/8212/2008 (A/H6N1) segment 2 (PB1) 3884.6 0.000000e+00 2217/2274 (97%)
EPI298336 A/blue-winged teal/Louisiana/Sg-00224/2007 (A/H3N8) segment 2 (PB1) 3884.6 0.000000e+00 2217/2274 (97%)
EPI298288 A/blue-winged teal/Texas/Sg-00188/2007 (A/H4N8) segment 2 (PB1) 3884.6 0.000000e+00 2217/2274 (97%)
EPI298089 A/blue-winged teal/Texas/Sg-00159/2007 (A/H4N8) segment 2 (PB1) 3884.6 0.000000e+00 2217/2274 (97%)
EPI263170 A/blue-winged teal/Texas/Sg-00078/2007 (A/H3N8) segment 2 (PB1) 3884.6 0.000000e+00 2217/2274 (97%)
EPI159640 A/blue-winged teal/Texas/Sg-00084/2007 (A/H3N8) segment 2 (PB1) 3884.6 0.000000e+00 2209/2262 (97%)
EPI449820 A/mallard/Minnesota/AI09-3047/2009 (A/H0) segment 2 (PB1) 3879.1 0.000000e+00 2216/2274 (97%)
EPI449532 A/mallard/Minnesota/Sg-00860/2008 (A/H0) segment 2 (PB1) 3879.1 0.000000e+00 2216/2274 (97%)
EPI334115 A/mallard/Illinois/3747/2009 (A/H6N1) segment 2 (PB1) 3879.1 0.000000e+00 2216/2274 (97%)
EPI263178 A/blue-winged teal/Texas/Sg-00079/2007 (A/H3N8) segment 2 (PB1) 3879.1 0.000000e+00 2216/2274 (97%)
EPI586243 A/turkey/California/8199/2015 (A/H7N3) segment 2 (PB1) 3873.5 0.000000e+00 2215/2274 (97%)
EPI526426 A/American green-winged teal/Ohio/13OS2094/2013 (A/H6N8) segment 2 (PB1) 3873.5 0.000000e+00 2215/2274 (97%)
EPI334243 A/mallard/Missouri/350/2009 (A/H11N9) segment 2 (PB1) 3873.5 0.000000e+00 2215/2274 (97%)
EPI298240 A/blue-winged teal/Texas/Sg-00085/2007 (A/H3N6) segment 2 (PB1) 3873.5 0.000000e+00 2215/2274 (97%)
EPI455521 A/ruddy turnstone/Delaware/Sg-00538/2008 (A/H1N5) segment 2 (PB1) 3868.0 0.000000e+00 2215/2275 (97%)
EPI449569 A/mallard/Minnesota/Sg-00949/2008 (A/H3N2) segment 2 (PB1) 3868.0 0.000000e+00 2214/2274 (97%)
EPI299433 A/northern shoveler/Mississippi/09OS025/2009 (A/H12N5) segment 2 (PB1) 3868.0 0.000000e+00 2216/2276 (97%)
EPI292684 A/American green-winged teal/California/44363-002/2007 (A/H11N5) segment 2 (PB1) 3868.0 0.000000e+00 2214/2274 (97%)
EPI188343 A/ruddy turnstone/Delaware/Sg-00538/2008 (A/H1N5) segment 2 (PB1) 3868.0 0.000000e+00 2214/2274 (97%)
EPI85470 A/mallard/Alberta/149/2002 (A/H2N4) segment 2 (PB1) 3868.0 0.000000e+00 2214/2274 (97%)
EPI166158 A/blue-winged teal/Texas/Sg-00188/2007 (A/H4N8) segment 2 (PB1) 3864.3 0.000000e+00 2206/2263 (97%)
EPI448014 A/red-necked grebe/Minnesota/AI10-1948/2010 (A/H1N1) segment 2 (PB1) 3862.5 0.000000e+00 2213/2274 (97%)
EPI404506 A/mallard/Nova Scotia/02286/2007 (A/H7N4) segment 2 (PB1) 3862.5 0.000000e+00 2213/2274 (97%)
EPI188738 A/mallard/Minnesota/Sg-00698/2008 (A/H4N8) segment 2 (PB1) 3862.5 0.000000e+00 2213/2274 (97%)
EPI188710 A/blue-winged teal/Minnesota/Sg-00691/2008 (A/H4N8) segment 2 (PB1) 3862.5 0.000000e+00 2213/2274 (97%)
EPI188475 A/mallard/Minnesota/Sg-00631/2008 (A/H4N8) segment 2 (PB1) 3862.5 0.000000e+00 2213/2274 (97%)
EPI188453 A/mallard/Minnesota/Sg-00626/2008 (A/H4N8) segment 2 (PB1) 3862.5 0.000000e+00 2213/2274 (97%)
EPI166248 A/blue-winged teal/Louisiana/Sg-00224/2007 (A/H3N8) segment 2 (PB1) 3862.5 0.000000e+00 2205/2262 (97%)
EPI164435 A/blue-winged teal/Texas/Sg-00078/2007 (A/H3N8) segment 2 (PB1) 3862.5 0.000000e+00 2205/2262 (97%)
EPI166229 A/blue-winged teal/Louisiana/Sg-00218/2007 (A/H3N8) segment 2 (PB1) 3860.6 0.000000e+00 2204/2261 (97%)
EPI166099 A/blue-winged teal/Texas/Sg-00159/2007 (A/H4N8) segment 2 (PB1) 3860.6 0.000000e+00 2204/2261 (97%)
EPI177993 A/northern pintail/California/44221-692/2006 (A/H11N2) segment 2 (PB1) 3858.8 0.000000e+00 2201/2257 (97%)
EPI645415 A/American green-winged teal/Ohio/13OS1840/2013 (A/H6N8) segment 2 (PB1) 3856.9 0.000000e+00 2212/2274 (97%)
EPI526388 A/American green-winged teal/Ohio/13OS1781/2013 (A/H6N8) segment 2 (PB1) 3856.9 0.000000e+00 2212/2274 (97%)
EPI512363 A/mallard/Illinois/11OS4421/2011 (A/H0) segment 2 (PB1) 3856.9 0.000000e+00 2212/2274 (97%)
EPI451933 A/mallard/Interior Alaska/10BM11434R0/2010 (A/H7N3) segment 2 (PB1) 3856.9 0.000000e+00 2212/2274 (97%)
EPI451912 A/northern pintail/Interior Alaska/10BM10906R0/2010 (A/H7N3) segment 2 (PB1) 3856.9 0.000000e+00 2212/2274 (97%)
EPI451877 A/mallard/Interior Alaska/10BM10811R0/2010 (A/H7N3) segment 2 (PB1) 3856.9 0.000000e+00 2212/2274 (97%)
EPI451870 A/northern pintail/Interior Alaska/10BM10809R0/2010 (A/H7N3) segment 2 (PB1) 3856.9 0.000000e+00 2212/2274 (97%)
EPI451863 A/northern pintail/Interior Alaska/10BM10807R0/2010 (A/H7N3) segment 2 (PB1) 3856.9 0.000000e+00 2212/2274 (97%)
EPI451856 A/northern pintail/Interior Alaska/10BM10805R0/2010 (A/H7N3) segment 2 (PB1) 3856.9 0.000000e+00 2212/2274 (97%)
EPI451849 A/northern pintail/Interior Alaska/10BM10801R0/2010 (A/H7N3) segment 2 (PB1) 3856.9 0.000000e+00 2212/2274 (97%)
EPI451826 A/northern pintail/Interior Alaska/10BM10476R0/2010 (A/H7N3) segment 2 (PB1) 3856.9 0.000000e+00 2212/2274 (97%)
EPI451819 A/mallard/Interior Alaska/10BM10324R0/2010 (A/H7N3) segment 2 (PB1) 3856.9 0.000000e+00 2212/2274 (97%)
EPI451812 A/northern pintail/Interior Alaska/10BM10166R0/2010 (A/H7N3) segment 2 (PB1) 3856.9 0.000000e+00 2212/2274 (97%)
EPI451805 A/northern pintail/Interior Alaska/10BM09832R0/2010 (A/H7N3) segment 2 (PB1) 3856.9 0.000000e+00 2212/2274 (97%)
EPI451798 A/mallard/Interior Alaska/10BM09818R0/2010 (A/H7N3) segment 2 (PB1) 3856.9 0.000000e+00 2212/2274 (97%)
EPI451793 A/northern pintail/Interior Alaska/10BM09481R0/2010 (A/H7N3) segment 2 (PB1) 3856.9 0.000000e+00 2212/2274 (97%)
EPI451751 A/northern pintail/Interior Alaska/10BM09348R0/2010 (A/H7N3) segment 2 (PB1) 3856.9 0.000000e+00 2212/2274 (97%)
EPI451744 A/northern pintail/Interior Alaska/10BM09347R0/2010 (A/H7N3) segment 2 (PB1) 3856.9 0.000000e+00 2212/2274 (97%)
EPI451709 A/northern pintail/Interior Alaska/10BM08705R0/2010 (A/H7N3) segment 2 (PB1) 3856.9 0.000000e+00 2212/2274 (97%)
EPI451674 A/mallard/Interior Alaska/10BM08099R0/2010 (A/H0) segment 2 (PB1) 3856.9 0.000000e+00 2212/2274 (97%)
EPI451658 A/northern pintail/Interior Alaska/10BM07737R0/2010 (A/H7N3) segment 2 (PB1) 3856.9 0.000000e+00 2212/2274 (97%)
EPI451644 A/mallard/Interior Alaska/10BM07501R0/2010 (A/H7N3) segment 2 (PB1) 3856.9 0.000000e+00 2212/2274 (97%)
EPI451637 A/northern pintail/Interior Alaska/10BM07469R0/2010 (A/H7N3) segment 2 (PB1) 3856.9 0.000000e+00 2212/2274 (97%)
EPI451630 A/northern pintail/Interior Alaska/10BM07458R0/2010 (A/H7N3) segment 2 (PB1) 3856.9 0.000000e+00 2212/2274 (97%)
EPI451623 A/northern pintail/Interior Alaska/10BM07260R0/2010 (A/H0) segment 2 (PB1) 3856.9 0.000000e+00 2212/2274 (97%)
EPI451601 A/northern pintail/Interior Alaska/10BM07114R0/2010 (A/H7N3) segment 2 (PB1) 3856.9 0.000000e+00 2212/2274 (97%)
EPI451594 A/northern pintail/Interior Alaska/10BM07106R0/2010 (A/H7N3) segment 2 (PB1) 3856.9 0.000000e+00 2212/2274 (97%)
EPI451587 A/mallard/Interior Alaska/10BM07092R0/2010 (A/H7N3) segment 2 (PB1) 3856.9 0.000000e+00 2212/2274 (97%)
EPI451580 A/mallard/Interior Alaska/10BM07085R0/2010 (A/H7N3) segment 2 (PB1) 3856.9 0.000000e+00 2212/2274 (97%)
EPI451454 A/mallard/Interior Alaska/10BM09141R0/2010 (A/H0) segment 2 (PB1) 3856.9 0.000000e+00 2212/2274 (97%)
EPI449539 A/mallard/Minnesota/Sg-00868/2008 (A/H3N8) segment 2 (PB1) 3856.9 0.000000e+00 2212/2274 (97%)
EPI449346 A/mallard/Minnesota/Sg-00928/2008 (A/H0) segment 2 (PB1) 3856.9 0.000000e+00 2212/2274 (97%)
EPI449298 A/mallard/Minnesota/Sg-00767/2008 (A/H4N8) segment 2 (PB1) 3856.9 0.000000e+00 2212/2274 (97%)
EPI448021 A/red-necked grebe/Minnesota/AI10-1954/2010 (A/H1N1) segment 2 (PB1) 3856.9 0.000000e+00 2212/2274 (97%)
EPI436829 A/mallard/Interior Alaska/10BM06911R0/2010 (A/H7N3) segment 2 (PB1) 3856.9 0.000000e+00 2212/2274 (97%)
EPI436822 A/mallard/Interior Alaska/10BM06909R0/2010 (A/H7N3) segment 2 (PB1) 3856.9 0.000000e+00 2212/2274 (97%)
EPI436811 A/mallard/Interior Alaska/10BM06905R0/2010 (A/H7N3) segment 2 (PB1) 3856.9 0.000000e+00 2212/2274 (97%)
EPI436804 A/northern pintail/Interior Alaska/10BM06899R0/2010 (A/H7N3) segment 2 (PB1) 3856.9 0.000000e+00 2212/2274 (97%)
EPI436796 A/northern pintail/Interior Alaska/10BM06524R0/2010 (A/H7N3) segment 2 (PB1) 3856.9 0.000000e+00 2212/2274 (97%)
EPI436666 A/mallard/Interior Alaska/10BM05860R0/2010 (A/H7N3) segment 2 (PB1) 3856.9 0.000000e+00 2212/2274 (97%)
EPI436575 A/mallard/Interior Alaska/10BM05347R0/2010 (A/H7N3) segment 2 (PB1) 3856.9 0.000000e+00 2212/2274 (97%)
EPI432814 A/northern pintail/Interior Alaska/10BM06901R0/2010 (A/H0) segment 2 (PB1) 3856.9 0.000000e+00 2212/2274 (97%)
EPI188742 A/mallard/Minnesota/Sg-00700/2008 (A/H4N8) segment 2 (PB1) 3856.9 0.000000e+00 2212/2274 (97%)
EPI188493 A/mallard/Minnesota/Sg-00635/2008 (A/H4N8) segment 2 (PB1) 3856.9 0.000000e+00 2212/2274 (97%)
EPI188448 A/mallard/Minnesota/Sg-00625/2008 (A/H4N8) segment 2 (PB1) 3856.9 0.000000e+00 2212/2274 (97%)
EPI188443 A/mallard/Minnesota/Sg-00624/2008 (A/H4N8) segment 2 (PB1) 3856.9 0.000000e+00 2212/2274 (97%)
EPI166198 A/blue-winged teal/Texas/Sg-00205/2007 (A/H3N8) segment 2 (PB1) 3856.9 0.000000e+00 2204/2262 (97%)
EPI512594 A/northern shoveler/Mississippi/11OS5875/2011 (A/H5N2) segment 2 (PB1) 3851.4 0.000000e+00 2211/2274 (97%)
EPI453953 A/mallard/Interior Alaska/10BM11311R0/2010 (A/H3N8) segment 2 (PB1) 3851.4 0.000000e+00 2211/2274 (97%)
EPI451961 A/mallard/Interior Alaska/10BM12534R0/2010 (A/H7N3) segment 2 (PB1) 3851.4 0.000000e+00 2211/2274 (97%)
EPI451779 A/mallard/Interior Alaska/10BM09563R0/2010 (A/H7N3) segment 2 (PB1) 3851.4 0.000000e+00 2211/2274 (97%)
EPI451772 A/mallard/Interior Alaska/10BM09548R0/2010 (A/H7N3) segment 2 (PB1) 3851.4 0.000000e+00 2211/2274 (97%)
EPI451765 A/mallard/Interior Alaska/10BM09539R0/2010 (A/H7N3) segment 2 (PB1) 3851.4 0.000000e+00 2211/2274 (97%)
EPI451758 A/mallard/Interior Alaska/10BM09528R0/2010 (A/H7N3) segment 2 (PB1) 3851.4 0.000000e+00 2211/2274 (97%)
EPI451737 A/northern pintail/Interior Alaska/10BM09181R0/2010 (A/H7N3) segment 2 (PB1) 3851.4 0.000000e+00 2211/2274 (97%)
EPI451688 A/mallard/Interior Alaska/10BM08120R0/2010 (A/H7N3) segment 2 (PB1) 3851.4 0.000000e+00 2211/2274 (97%)
EPI451681 A/mallard/Interior Alaska/10BM08100R0/2010 (A/H7N3) segment 2 (PB1) 3851.4 0.000000e+00 2211/2274 (97%)
EPI451615 A/northern pintail/Interior Alaska/10BM07121R0/2010 (A/H7N3) segment 2 (PB1) 3851.4 0.000000e+00 2211/2274 (97%)
EPI451608 A/northern pintail/Interior Alaska/10BM07120R0/2010 (A/H7N3) segment 2 (PB1) 3851.4 0.000000e+00 2211/2274 (97%)
EPI451563 A/mallard/Interior Alaska/10BM07072R0/2010 (A/H7N3) segment 2 (PB1) 3851.4 0.000000e+00 2211/2274 (97%)
EPI451556 A/mallard/Interior Alaska/10BM07066R0/2010 (A/H7N3) segment 2 (PB1) 3851.4 0.000000e+00 2211/2274 (97%)
EPI451549 A/northern pintail/Interior Alaska/10BM07029R0/2010 (A/H7N3) segment 2 (PB1) 3851.4 0.000000e+00 2211/2274 (97%)
EPI451441 A/northern pintail/Interior Alaska/10BM07267R0/2010 (A/H0) segment 2 (PB1) 3851.4 0.000000e+00 2211/2274 (97%)
EPI449548 A/mallard/Minnesota/Sg-00902/2008 (A/H0) segment 2 (PB1) 3851.4 0.000000e+00 2211/2274 (97%)
EPI449382 A/mallard/Minnesota/Sg-00616/2008 (A/H4N8) segment 2 (PB1) 3851.4 0.000000e+00 2211/2274 (97%)
EPI448670 A/mallard/North Dakota/Sg-00737/2008 (A/H6N8) segment 2 (PB1) 3851.4 0.000000e+00 2212/2275 (97%)
EPI436867 A/northern pintail/Interior Alaska/10BM06720R0/2010 (A/H7N3) segment 2 (PB1) 3851.4 0.000000e+00 2211/2274 (97%)
EPI436793 A/northern pintail/Interior Alaska/10BM06895R0/2010 (A/H7N3) segment 2 (PB1) 3851.4 0.000000e+00 2211/2274 (97%)
EPI436773 A/mallard/Interior Alaska/10BM06838R0/2010 (A/H7N3) segment 2 (PB1) 3851.4 0.000000e+00 2211/2274 (97%)
EPI436679 A/northern pintail/Interior Alaska/10BM06306R0/2010 (A/H7N3) segment 2 (PB1) 3851.4 0.000000e+00 2211/2274 (97%)
EPI436665 A/northern pintail/Interior Alaska/10BM06303R0/2010 (A/H7N3) segment 2 (PB1) 3851.4 0.000000e+00 2211/2274 (97%)
EPI418548 A/mallard/Wisconsin/10OS3166/2010 (A/H0) segment 2 (PB1) 3851.4 0.000000e+00 2211/2274 (97%)
EPI272309 A/blue-winged teal/Guatemala/CIP049-02/2008 (A/H7N9) segment 2 (PB1) 3851.4 0.000000e+00 2211/2274 (97%)
EPI272301 A/blue-winged teal/Guatemala/CIP049-01/2008 (A/H7N9) segment 2 (PB1) 3851.4 0.000000e+00 2211/2274 (97%)
EPI230696 A/mallard/California/K752/2006 (A/H10N7) segment 2 (PB1) 3851.4 0.000000e+00 2211/2274 (97%)
EPI222766 A/northern shoveler/Interior Alaska/1/2007 (A/H4N6) segment 2 (PB1) 3851.4 0.000000e+00 2212/2275 (97%)
EPI596153 A/environment/Maryland/12OS1506/2012 (A/H3N6) segment 2 (PB1) 3845.8 0.000000e+00 2210/2274 (97%)
EPI596051 A/environment/Maryland/12OS1477/2012 (A/H3N6) segment 2 (PB1) 3845.8 0.000000e+00 2210/2274 (97%)
EPI595988 A/environment/Maryland/12OS1465/2012 (A/H3N6) segment 2 (PB1) 3845.8 0.000000e+00 2210/2274 (97%)
EPI512893 A/mallard/Wisconsin/11OS4238/2011 (A/H3N2) segment 2 (PB1) 3845.8 0.000000e+00 2210/2274 (97%)
EPI512562 A/mallard/Wisconsin/11OS3157/2011 (A/H3N2) segment 2 (PB1) 3845.8 0.000000e+00 2210/2274 (97%)
EPI512482 A/mallard/Wisconsin/11OS3158/2011 (A/H3N2) segment 2 (PB1) 3845.8 0.000000e+00 2210/2274 (97%)
EPI453932 A/mallard/Interior Alaska/10BM10829R0/2010 (A/H7N3) segment 2 (PB1) 3845.8 0.000000e+00 2210/2274 (97%)
EPI451919 A/northern pintail/Interior Alaska/10BM11208R0/2010 (A/H7N3) segment 2 (PB1) 3845.8 0.000000e+00 2210/2274 (97%)
EPI451905 A/mallard/Interior Alaska/10BM10876R0/2010 (A/H7N3) segment 2 (PB1) 3845.8 0.000000e+00 2210/2274 (97%)
EPI451898 A/mallard/Interior Alaska/10BM10861R0/2010 (A/H7N3) segment 2 (PB1) 3845.8 0.000000e+00 2210/2274 (97%)
EPI451891 A/mallard/Interior Alaska/10BM10859R0/2010 (A/H7N3) segment 2 (PB1) 3845.8 0.000000e+00 2210/2274 (97%)
EPI451884 A/northern pintail/Interior Alaska/10BM10853R0/2010 (A/H7N3) segment 2 (PB1) 3845.8 0.000000e+00 2210/2274 (97%)
EPI451842 A/northern pintail/Interior Alaska/10BM10790R0/2010 (A/H7N3) segment 2 (PB1) 3845.8 0.000000e+00 2210/2274 (97%)
EPI451833 A/mallard/Interior Alaska/10BM10787R0/2010 (A/H7N3) segment 2 (PB1) 3845.8 0.000000e+00 2210/2274 (97%)
EPI451730 A/mallard/Interior Alaska/10BM08884R0/2010 (A/H7N3) segment 2 (PB1) 3845.8 0.000000e+00 2210/2274 (97%)
EPI451723 A/mallard/Interior Alaska/10BM08883R0/2010 (A/H7N3) segment 2 (PB1) 3845.8 0.000000e+00 2210/2274 (97%)
EPI451716 A/mallard/Interior Alaska/10BM08874R0/2010 (A/H7N3) segment 2 (PB1) 3845.8 0.000000e+00 2210/2274 (97%)
EPI451702 A/northern pintail/Interior Alaska/10BM08586R0/2010 (A/H7N3) segment 2 (PB1) 3845.8 0.000000e+00 2211/2275 (97%)
EPI451695 A/northern pintail/Interior Alaska/10BM08400R0/2010 (A/H7N3) segment 2 (PB1) 3845.8 0.000000e+00 2210/2274 (97%)
EPI451666 A/northern pintail/Interior Alaska/10BM07821R0/2010 (A/H0) segment 2 (PB1) 3845.8 0.000000e+00 2210/2274 (97%)
EPI451525 A/mallard/Interior Alaska/10BM10831R0/2010 (A/H0) segment 2 (PB1) 3845.8 0.000000e+00 2210/2274 (97%)
EPI449649 A/mallard/Minnesota/Sg-01039/2008 (A/H4N8) segment 2 (PB1) 3845.8 0.000000e+00 2210/2274 (97%)
EPI222223 A/mallard/Interior Alaska/4/2007 (A/H4N6) segment 2 (PB1) 3845.8 0.000000e+00 2211/2275 (97%)
EPI159630 A/blue-winged teal/Texas/Sg-00079/2007 (A/H3N8) segment 2 (PB1) 3842.2 0.000000e+00 2198/2257 (97%)
EPI596167 A/environment/Maryland/12OS1510/2012 (A/H3N6) segment 2 (PB1) 3840.3 0.000000e+00 2210/2275 (97%)
EPI596030 A/environment/Maryland/12OS1474/2012 (A/H3N6) segment 2 (PB1) 3840.3 0.000000e+00 2209/2274 (97%)
EPI595995 A/environment/Maryland/12OS1466/2012 (A/H3N6) segment 2 (PB1) 3840.3 0.000000e+00 2209/2274 (97%)
EPI512961 A/mallard/Illinois/11OS5576/2011 (A/H5N3) segment 2 (PB1) 3840.3 0.000000e+00 2209/2274 (97%)
EPI451940 A/northern pintail/Interior Alaska/10BM11945R0/2010 (A/H7N3) segment 2 (PB1) 3840.3 0.000000e+00 2209/2274 (97%)
EPI418749 A/wood duck/Wisconsin/10OS2778/2010 (A/H3N8) segment 2 (PB1) 3840.3 0.000000e+00 2210/2275 (97%)
EPI418740 A/mallard/Wisconsin/10OS2773/2010 (A/H3N8) segment 2 (PB1) 3840.3 0.000000e+00 2210/2275 (97%)
EPI344228 A/blue-winged teal/Alberta/16/1997 (A/H2N9) segment 2 (PB1) 3840.3 0.000000e+00 2209/2274 (97%)
EPI300140 A/duck/Interior Alaska/7MP1550/2007 (A/H4N6) segment 2 (PB1) 3840.3 0.000000e+00 2210/2275 (97%)
EPI288905 A/mallard/Alaska/44354-830/2007 (A/H4N6) segment 2 (PB1) 3840.3 0.000000e+00 2210/2275 (97%)
EPI512213 A/American green-winged teal/Mississippi/12OS405/2012 (A/H10N7) segment 2 (PB1) 3834.8 0.000000e+00 2208/2274 (97%)
EPI418640 A/mallard/Illinois/10OS3248/2010 (A/H0) segment 2 (PB1) 3834.8 0.000000e+00 2208/2274 (97%)
EPI387153 A/mallard/California/1390/2010 (A/H7N5) segment 2 (PB1) 3834.8 0.000000e+00 2208/2274 (97%)
EPI299016 A/mallard/Interior Alaska/7MP0956/2007 (A/H0) segment 2 (PB1) 3834.8 0.000000e+00 2208/2274 (97%)
EPI85413 A/blue-winged teal/ALB/16/1997 (A/H2N9) segment 2 (PB1) 3834.8 0.000000e+00 2208/2274 (97%)
EPI419327 A/mallard/Illinois/10OS4111/2010 (A/H10N7) segment 2 (PB1) 3829.2 0.000000e+00 2207/2274 (97%)
EPI418906 A/blue-winged teal/Wisconsin/10OS2862/2010 (A/H3N2) segment 2 (PB1) 3829.2 0.000000e+00 2207/2274 (97%)
EPI288896 A/mallard/Alaska/44430-283/2008 (A/H3N6) segment 2 (PB1) 3829.2 0.000000e+00 2208/2275 (97%)
EPI270361 A/thick-billed murre/Newfoundland/031/2007 (A/H11N2) segment 2 (PB1) 3827.4 0.000000e+00 2193/2253 (97%)
EPI166168 A/mallard/Minnesota/Sg-00192/2007 (A/H3N8) segment 2 (PB1) 3827.4 0.000000e+00 2198/2261 (97%)
EPI166165 A/mallard/Minnesota/Sg-00191/2007 (A/H3N8) segment 2 (PB1) 3827.4 0.000000e+00 2198/2261 (97%)
EPI616143 A/blue-winged teal/Ohio/12OS2295/2012 (A/H4N6) segment 2 (PB1) 3823.7 0.000000e+00 2206/2274 (97%)
EPI616136 A/blue-winged teal/Ohio/12OS2294/2012 (A/H4N6) segment 2 (PB1) 3823.7 0.000000e+00 2206/2274 (97%)
EPI616129 A/blue-winged teal/Ohio/12OS2293/2012 (A/H4N6) segment 2 (PB1) 3823.7 0.000000e+00 2206/2274 (97%)
EPI512751 A/northern shoveler/Wisconsin/11OS3013/2011 (A/H4N8) segment 2 (PB1) 3823.7 0.000000e+00 2206/2274 (97%)
EPI512237 A/mallard/Arkansas/12OS184/2012 (A/H10N7) segment 2 (PB1) 3823.7 0.000000e+00 2206/2274 (97%)
EPI334168 A/mallard/Illinois/3974/2009 (A/H5N2) segment 2 (PB1) 3823.7 0.000000e+00 2206/2274 (97%)
EPI290554 A/mallard/Oregon/44221-105/2006 (A/H3N6) segment 2 (PB1) 3823.7 0.000000e+00 2206/2274 (97%)
EPI288897 A/mallard/Alaska/44430-193/2008 (A/H4N6) segment 2 (PB1) 3823.7 0.000000e+00 2207/2275 (97%)
EPI85451 A/mallard/ALB/226/1998 (A/H2N3) segment 2 (PB1) 3823.7 0.000000e+00 2206/2274 (97%)
EPI159644 A/blue-winged teal/Texas/Sg-00085/2007 (A/H3) segment 2 (PB1) 3820.0 0.000000e+00 2186/2245 (97%)
EPI512864 A/northern pintail/Wisconsin/11OS3295/2011 (A/H4N2) segment 2 (PB1) 3818.1 0.000000e+00 2205/2274 (96%)
EPI486860 A/mallard/California/3381/2012 (A/H2N3) segment 2 (PB1) 3818.1 0.000000e+00 2205/2274 (96%)
EPI486827 A/mallard/California/3223/2012 (A/H2N3) segment 2 (PB1) 3818.1 0.000000e+00 2205/2274 (96%)
EPI486664 A/mallard/California/3032/2012 (A/H2N3) segment 2 (PB1) 3818.1 0.000000e+00 2205/2274 (96%)
EPI486374 A/mallard/California/2999/2012 (A/H2N3) segment 2 (PB1) 3818.1 0.000000e+00 2205/2274 (96%)
EPI486310 A/mallard/California/2867/2012 (A/H2N3) segment 2 (PB1) 3818.1 0.000000e+00 2205/2274 (96%)
EPI486296 A/mallard/California/2840/2012 (A/H2N3) segment 2 (PB1) 3818.1 0.000000e+00 2205/2274 (96%)
EPI486289 A/mallard/California/2839/2012 (A/H2N3) segment 2 (PB1) 3818.1 0.000000e+00 2205/2274 (96%)
EPI486282 A/mallard/California/2838/2012 (A/H2N3) segment 2 (PB1) 3818.1 0.000000e+00 2205/2274 (96%)
EPI486232 A/mallard/California/2815/2012 (A/H2N3) segment 2 (PB1) 3818.1 0.000000e+00 2205/2274 (96%)
EPI486217 A/mallard/California/2801/2012 (A/H2N3) segment 2 (PB1) 3818.1 0.000000e+00 2205/2274 (96%)
EPI298193 A/blue-winged teal/Texas/Sg-00212/2007 (A/H0) segment 2 (PB1) 3818.1 0.000000e+00 2205/2274 (96%)
EPI297685 A/blue-winged teal/Texas/Sg-00074/2007 (A/H4N8) segment 2 (PB1) 3818.1 0.000000e+00 2205/2274 (96%)
EPI225348 A/pintail/Alberta/21/2006 (A/H1N1) segment 2 (PB1) 3818.1 0.000000e+00 2205/2274 (96%)
EPI68346 A/blue-winged teal/Ohio/566/2006 (A/H7N9) segment 2 (PB1) 3818.1 0.000000e+00 2205/2274 (96%)
EPI526269 A/American green-winged teal/Ohio/13OS1777/2013 (A/H7N3) segment 2 (PB1) 3812.6 0.000000e+00 2204/2274 (96%)
EPI512879 A/common goldeneye/Wisconsin/11OS5764/2011 (A/H4N8) segment 2 (PB1) 3812.6 0.000000e+00 2204/2274 (96%)
EPI512261 A/common goldeneye/Wisconsin/11OS4503/2011 (A/H4N8) segment 2 (PB1) 3812.6 0.000000e+00 2204/2274 (96%)
EPI486883 A/mallard/California/3430/2012 (A/H2N3) segment 2 (PB1) 3812.6 0.000000e+00 2204/2274 (96%)
EPI486321 A/mallard/California/2885/2012 (A/H2N3) segment 2 (PB1) 3812.6 0.000000e+00 2204/2274 (96%)
EPI486303 A/mallard/California/2841/2012 (A/H2N3) segment 2 (PB1) 3812.6 0.000000e+00 2204/2274 (96%)
EPI486264 A/mallard/California/2837/2012 (A/H2N3) segment 2 (PB1) 3812.6 0.000000e+00 2204/2274 (96%)
EPI486245 A/mallard/California/2833/2012 (A/H2N3) segment 2 (PB1) 3812.6 0.000000e+00 2204/2274 (96%)
EPI486238 A/mallard/California/2829/2012 (A/H2N3) segment 2 (PB1) 3812.6 0.000000e+00 2204/2274 (96%)
EPI486155 A/mallard/California/2745/2012 (A/H2N3) segment 2 (PB1) 3812.6 0.000000e+00 2204/2274 (96%)
EPI450076 A/red-necked grebe/Minnesota/AI10-2529/2010 (A/H0) segment 2 (PB1) 3812.6 0.000000e+00 2204/2274 (96%)
EPI449467 A/blue-winged teal/North Dakota/Sg-00759/2008 (A/H3N6) segment 2 (PB1) 3812.6 0.000000e+00 2204/2274 (96%)
EPI645359 A/American green-winged teal/Ohio/13OS1769/2013 (A/H7N2) segment 2 (PB1) 3807.1 0.000000e+00 2203/2274 (96%)
EPI645352 A/blue-winged teal/Ohio/13OS1770/2013 (A/H7N3) segment 2 (PB1) 3807.1 0.000000e+00 2203/2274 (96%)
EPI616094 A/northern shoveler/Ohio/12OS5647/2012 (A/H2N3) segment 2 (PB1) 3807.1 0.000000e+00 2204/2275 (96%)
EPI513053 A/bufflehead/Wisconsin/11OS3570/2011 (A/H4N8) segment 2 (PB1) 3807.1 0.000000e+00 2203/2274 (96%)
EPI486846 A/mallard/California/3314/2012 (A/H2N3) segment 2 (PB1) 3807.1 0.000000e+00 2203/2274 (96%)
EPI486839 A/mallard/California/3310/2012 (A/H2N3) segment 2 (PB1) 3807.1 0.000000e+00 2203/2274 (96%)
EPI486367 A/mallard/California/2997/2012 (A/H2N3) segment 2 (PB1) 3807.1 0.000000e+00 2203/2274 (96%)
EPI486095 A/mallard/California/3113/2012 (A/H3) segment 2 (PB1) 3807.1 0.000000e+00 2203/2274 (96%)
EPI468389 A/mallard/Missouri/466554-14/2007 (A/H1N1) segment 2 (PB1) 3807.1 0.000000e+00 2203/2274 (96%)
EPI419923 A/mallard/California/2556P/2011 (A/H3N8) segment 2 (PB1) 3807.1 0.000000e+00 2204/2275 (96%)
EPI344124 A/mallard/Alberta/205/1998 (A/H2N3) segment 2 (PB1) 3807.1 0.000000e+00 2203/2274 (96%)
EPI188029 A/northern pintail/Minnesota/Sg-00227/2006 (A/H1N1) segment 2 (PB1) 3807.1 0.000000e+00 2203/2274 (96%)
EPI85432 A/mallard/ALB/205/1998 (A/H2N3) segment 2 (PB1) 3807.1 0.000000e+00 2203/2274 (96%)
EPI594911 A/blue-winged teal/Maryland/06MD462/2006 (A/H12N2) segment 2 (PB1) 3801.5 0.000000e+00 2202/2274 (96%)
EPI542051 A/mallard/Idaho/ND0002644/2013 (A/H3N8) segment 2 (PB1) 3801.5 0.000000e+00 2203/2275 (96%)
EPI526456 A/blue-winged teal/Ohio/13OS1773/2013 (A/H7N3) segment 2 (PB1) 3801.5 0.000000e+00 2203/2275 (96%)
EPI486733 A/mallard/California/3148/2012 (A/H2N3) segment 2 (PB1) 3801.5 0.000000e+00 2202/2274 (96%)
EPI455139 A/mallard/Minnesota/AI06-1027/2006 (A/H0) segment 2 (PB1) 3801.5 0.000000e+00 2202/2274 (96%)
EPI280844 A/mallard/Oregon/461067-2/2006 (A/H5N2) segment 2 (PB1) 3801.5 0.000000e+00 2202/2274 (96%)
EPI280684 A/Canada goose/Wyoming/473197-10/2006 (A/H5N2) segment 2 (PB1) 3801.5 0.000000e+00 2202/2274 (96%)
EPI280676 A/Canada goose/Wyoming/473197-12/2006 (A/H5N2) segment 2 (PB1) 3801.5 0.000000e+00 2202/2274 (96%)
EPI230680 A/green-winged teal/California/K481/2006 (A/H1N3) segment 2 (PB1) 3801.5 0.000000e+00 2202/2274 (96%)
EPI188798 A/blue-winged teal/North Dakota/Sg-00717/2008 (A/H4N6) segment 2 (PB1) 3801.5 0.000000e+00 2202/2274 (96%)
EPI188034 A/green-winged teal/Minnesota/Sg-00228/2006 (A/H6N8) segment 2 (PB1) 3801.5 0.000000e+00 2202/2274 (96%)
EPI585227 A/redhead/Ohio/13OS0377/2013 (A/H0) segment 2 (PB1) 3796.0 0.000000e+00 2202/2275 (96%)
EPI512517 A/mallard/Wisconsin/11OS3177/2011 (A/H0) segment 2 (PB1) 3796.0 0.000000e+00 2201/2274 (96%)
EPI512268 A/blue-winged teal/Wisconsin/11OS2873/2011 (A/H3N2) segment 2 (PB1) 3796.0 0.000000e+00 2201/2274 (96%)
EPI435884 A/mallard/Alberta/289/2007 (A/H10N7) segment 2 (PB1) 3796.0 0.000000e+00 2201/2274 (96%)
EPI435877 A/blue-winged teal/Alberta/271/2007 (A/H10N7) segment 2 (PB1) 3796.0 0.000000e+00 2201/2274 (96%)
EPI435870 A/mallard/Alberta/182/2007 (A/H10N7) segment 2 (PB1) 3796.0 0.000000e+00 2201/2274 (96%)
EPI419930 A/mallard/California/2556V/2011 (A/H3N8) segment 2 (PB1) 3796.0 0.000000e+00 2202/2275 (96%)
EPI343689 A/mallard/Alberta/192/2004 (A/H3N1) segment 2 (PB1) 3796.0 0.000000e+00 2202/2275 (96%)
EPI292484 A/American green-winged teal/Oregon/44336-183/2007 (A/H3N8) segment 2 (PB1) 3796.0 0.000000e+00 2201/2274 (96%)
EPI263154 A/blue-winged teal/Texas/Sg-00076/2007 (A/H4N6) segment 2 (PB1) 3796.0 0.000000e+00 2201/2274 (96%)
EPI222522 A/ring necked duck/California/HKWF515/2007 (A/H6N1) segment 2 (PB1) 3796.0 0.000000e+00 2201/2274 (96%)
EPI49423 A/mallard/Alaska/708/2005 (A/H8N4) segment 2 (PB1) 3796.0 0.000000e+00 2202/2275 (96%)
EPI616842 A/mallard/Minnesota/19033/1999 (A/H7N7) segment 2 (PB1) 3790.4 0.000000e+00 2200/2274 (96%)
EPI616828 A/mallard/Minnesota/AI07-3433/2007 (A/H7N3) segment 2 (PB1) 3790.4 0.000000e+00 2200/2274 (96%)
EPI616386 A/bufflehead/Illinois/12OS4798/2012 (A/H0) segment 2 (PB1) 3790.4 0.000000e+00 2200/2274 (96%)
EPI405291 A/American black duck/New Brunswick/01989/2007 (A/H1N1) segment 2 (PB1) 3790.4 0.000000e+00 2200/2274 (96%)
EPI404571 A/mallard-black duck hybrid/Nova Scotia/02150/2007 (A/H1N1) segment 2 (PB1) 3790.4 0.000000e+00 2200/2274 (96%)
EPI404564 A/mallard/Nova Scotia/02153/2007 (A/H1N1) segment 2 (PB1) 3790.4 0.000000e+00 2200/2274 (96%)
EPI343777 A/mallard/Alberta/160/2001 (A/H3N8) segment 2 (PB1) 3790.4 0.000000e+00 2200/2274 (96%)
EPI292404 A/northern shoveler/California/44287-179/2007 (A/H7N6) segment 2 (PB1) 3790.4 0.000000e+00 2200/2274 (96%)
EPI292396 A/northern shoveler/California/27985/2007 (A/H7N6) segment 2 (PB1) 3790.4 0.000000e+00 2200/2274 (96%)
EPI290827 A/northern shoveler/California/44363-062/2007 (A/H9N2) segment 2 (PB1) 3790.4 0.000000e+00 2200/2274 (96%)
EPI230736 A/northern shoveler/California/JN587/2006 (A/H10N3) segment 2 (PB1) 3790.4 0.000000e+00 2200/2274 (96%)
EPI178820 A/northern shoveler/California/HKWF608/2007 (A/H10N7) segment 2 (PB1) 3790.4 0.000000e+00 2200/2274 (96%)
EPI178796 A/northern shoveler/California/HKWF392sm/2007 (A/H10N7) segment 2 (PB1) 3790.4 0.000000e+00 2200/2274 (96%)
EPI166216 A/blue-winged teal/Texas/Sg-00212/2007 (A/H4N6) segment 2 (PB1) 3790.4 0.000000e+00 2191/2261 (96%)
EPI510514 A/goose/MB/428/2006 (A/H5N2) segment 2 (PB1) 3784.9 0.000000e+00 2199/2274 (96%)
EPI486804 A/mallard/California/3174/2012 (A/H2N3) segment 2 (PB1) 3784.9 0.000000e+00 2199/2274 (96%)
EPI486790 A/mallard/California/3171/2012 (A/H2N3) segment 2 (PB1) 3784.9 0.000000e+00 2199/2274 (96%)
EPI486783 A/mallard/California/3167/2012 (A/H2N3) segment 2 (PB1) 3784.9 0.000000e+00 2199/2274 (96%)
EPI486769 A/mallard/California/3153/2012 (A/H2N3) segment 2 (PB1) 3784.9 0.000000e+00 2199/2274 (96%)
EPI448797 A/northern pintail/Texas/421716/2001 (A/H1N1) segment 2 (PB1) 3784.9 0.000000e+00 2199/2274 (96%)
EPI442204 A/lesser snow goose/Alaska/44301-116/2007 (A/H2N3) segment 2 (PB1) 3784.9 0.000000e+00 2200/2275 (96%)
EPI419681 A/mallard/Missouri/10MO0334/2010 (A/H0) segment 2 (PB1) 3784.9 0.000000e+00 2199/2274 (96%)
EPI404585 A/mallard/Nova Scotia/02151/2007 (A/H1N1) segment 2 (PB1) 3784.9 0.000000e+00 2199/2274 (96%)
EPI333582 A/mallard/Mississippi/413/2010 (A/H1N1) segment 2 (PB1) 3784.9 0.000000e+00 2199/2274 (96%)
EPI292468 A/cinnamon teal/California/44287-659/2007 (A/H10N3) segment 2 (PB1) 3784.9 0.000000e+00 2199/2274 (96%)
EPI238911 A/mallard/Minnesota/231/1998 (A/H9N2) segment 2 (PB1) 3784.9 0.000000e+00 2199/2274 (96%)
EPI227378 A/northern pintail/Alberta/11701/2005 (A/H3N8) segment 2 (PB1) 3784.9 0.000000e+00 2199/2274 (96%)
EPI167065 A/northern shoveler/California/HKWF216/2007 (A/H6N1) segment 2 (PB1) 3784.9 0.000000e+00 2199/2274 (96%)
EPI616348 A/American green-winged teal/Mississippi/12OS5061/2012 (A/H5N2) segment 2 (PB1) 3779.4 0.000000e+00 2198/2274 (96%)
EPI486890 A/mallard/California/3460/2012 (A/H4N6) segment 2 (PB1) 3779.4 0.000000e+00 2198/2274 (96%)
EPI485049 A/mallard/California/3078/2012 (A/H2N3) segment 2 (PB1) 3779.4 0.000000e+00 2198/2274 (96%)
EPI455146 A/mallard/Minnesota/AI06-1017/2006 (A/H10N3) segment 2 (PB1) 3779.4 0.000000e+00 2198/2274 (96%)

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Wed Oct 14, 2015 11:59 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
EPI620404 A/chicken/Iowa/14399-4/2015 (A/H5N2) segment 3 (PA) 3962.2 0.000000e+00 2149/2151 (99%)
EPI620403 A/chicken/Iowa/14322-6/2015 (A/H5N2) segment 3 (PA) 3962.2 0.000000e+00 2149/2151 (99%)
EPI620402 A/turkey/Iowa/14318-1/2015 (A/H5N2) segment 3 (PA) 3962.2 0.000000e+00 2149/2151 (99%)
EPI620401 A/turkey/Iowa/14319-1/2015 (A/H5N2) segment 3 (PA) 3962.2 0.000000e+00 2149/2151 (99%)
EPI620400 A/chicken/Iowa/13542-2/2015 (A/H5N2) segment 3 (PA) 3962.2 0.000000e+00 2149/2151 (99%)
EPI587639 A/chicken/Iowa/04-20/2015 (A/H5N2) segment 3 (PA) 3962.2 0.000000e+00 2149/2151 (99%)
EPI620399 A/turkey/Iowa/13541-1/2015 (A/H5N2) segment 3 (PA) 3951.1 0.000000e+00 2147/2151 (99%)
EPI620398 A/turkey/Iowa/11762-1/2015 (A/H5N2) segment 3 (PA) 3951.1 0.000000e+00 2147/2151 (99%)
EPI590476 A/turkey/Minnesota/9845-4/2015 (A/H5N2) segment 3 (PA) 3951.1 0.000000e+00 2147/2151 (99%)
EPI590475 A/chicken/Kansas/8395-3/2015 (A/H5N2) segment 3 (PA) 3951.1 0.000000e+00 2147/2151 (99%)
EPI590472 A/turkey/Minnesota/7172-1/2015 (A/H5N2) segment 3 (PA) 3951.1 0.000000e+00 2147/2151 (99%)
EPI590469 A/turkey/Minnesota/9892-2/2015 (A/H5N2) segment 3 (PA) 3951.1 0.000000e+00 2147/2151 (99%)
EPI590473 A/turkey/Missouri/7458-1/2015 (A/H5N2) segment 3 (PA) 3945.6 0.000000e+00 2146/2151 (99%)
EPI569362 A/domestic duck/Washington/61-16/2014 (A/H5N2) segment 3 (PA) 3940.0 0.000000e+00 2145/2151 (99%)
EPI569360 A/chicken/Washington/61-9/2014 (A/H5N2) segment 3 (PA) 3940.0 0.000000e+00 2145/2151 (99%)
EPI590471 A/chicken/Oregon/A01819044/2015 (A/H5N2) segment 3 (PA) 3934.5 0.000000e+00 2144/2151 (99%)
EPI573280 A/turkey/Washington/61-22/2014 (A/H5N2) segment 3 (PA) 3934.5 0.000000e+00 2144/2151 (99%)
EPI590474 A/turkey/Arkansas/7791-1/2015 (A/H5N2) segment 3 (PA) 3928.9 0.000000e+00 2143/2151 (99%)
EPI586557 A/chicken/BC/FAV25/2014 (A/H5N2) segment 3 (PA) 3928.9 0.000000e+00 2143/2151 (99%)
EPI586541 A/chicken/BC/FAV23/2014 (A/H5N2) segment 3 (PA) 3928.9 0.000000e+00 2143/2151 (99%)
EPI586525 A/chicken/BC/FAV21/2014 (A/H5N2) segment 3 (PA) 3928.9 0.000000e+00 2143/2151 (99%)
EPI586508 A/poultry/BC/FAV19/2014 (A/H5N2) segment 3 (PA) 3928.9 0.000000e+00 2143/2151 (99%)
EPI585107 A/pheasant/Washington/3147-2/2015 (A/H5N2) segment 3 (PA) 3928.9 0.000000e+00 2143/2151 (99%)
EPI569382 A/Northern pintail/Washington/40964/2014 (A/H5N2) segment 3 (PA) 3928.9 0.000000e+00 2143/2151 (99%)
EPI586533 A/chicken/BC/FAV22/2014 (A/H5N2) segment 3 (PA) 3923.4 0.000000e+00 2142/2151 (99%)
EPI586517 A/chicken/BC/FAV20/2014 (A/H5N2) segment 3 (PA) 3923.4 0.000000e+00 2142/2151 (99%)
EPI586500 A/poultry/BC/FAV17/2014 (A/H5N2) segment 3 (PA) 3923.4 0.000000e+00 2142/2151 (99%)
EPI584078 A/turkey/BC/FAV14/2014 (A/H5N2) segment 3 (PA) 3923.4 0.000000e+00 2142/2151 (99%)
EPI576173 A/chicken/BC/FAV8/2014 (A/H5N2) segment 3 (PA) 3923.4 0.000000e+00 2142/2151 (99%)
EPI590470 A/chicken/Washington/3490-18/2015 (A/H5N2) segment 3 (PA) 3917.9 0.000000e+00 2141/2151 (99%)
EPI586549 A/chicken/BC/FAV24/2014 (A/H5N2) segment 3 (PA) 3917.9 0.000000e+00 2141/2151 (99%)
EPI586492 A/poultry/BC/FAV15/2014 (A/H5N2) segment 3 (PA) 3917.9 0.000000e+00 2141/2151 (99%)
EPI573292 A/turkey/BC/FAV10/2014 (A/H5N2) segment 3 (PA) 3917.9 0.000000e+00 2141/2151 (99%)
EPI576174 A/chicken/BC/FAV9/2014 (A/H5N2) segment 3 (PA) 3912.3 0.000000e+00 2140/2151 (99%)
EPI587520 A/American wigeon/BC/050-31/2015 (A/H5N8) segment 3 (PA) 3906.8 0.000000e+00 2139/2151 (99%)
EPI585103 A/turkey/California/K1500169-1.2/2015 (A/H5N8) segment 3 (PA) 3901.2 0.000000e+00 2138/2151 (99%)
EPI569389 A/gyrfalcon/Washington/41088-6/2014 (A/H5N8) segment 3 (PA) 3895.7 0.000000e+00 2137/2151 (99%)
EPI569370 A/guinea fowl/Oregon/41613-1/2014 (A/H5N8) segment 3 (PA) 3895.7 0.000000e+00 2137/2151 (99%)
EPI569368 A/chicken/Oregon/41613-2/2014 (A/H5N8) segment 3 (PA) 3895.7 0.000000e+00 2137/2151 (99%)
EPI553207 A/crane/Kagoshima/KU1/2014 (A/H5N8) segment 3 (PA) 3873.5 0.000000e+00 2133/2151 (99%)
EPI588975 A/duck/Taiwan/a068/2015 (A/H5N8) segment 3 (PA) 3868.0 0.000000e+00 2130/2148 (99%)
EPI588967 A/chicken/Taiwan/a174/2015 (A/H5N3) segment 3 (PA) 3868.0 0.000000e+00 2130/2148 (99%)
EPI561686 A/common teal/Korea/H455-30/2014 (A/H5N8) segment 3 (PA) 3868.0 0.000000e+00 2132/2151 (99%)
EPI588951 A/goose/Taiwan/a015/2015 (A/H5N8) segment 3 (PA) 3862.5 0.000000e+00 2130/2149 (99%)
EPI585536 A/baikal teal/Korea/2414/2014 (A/H5N8) segment 3 (PA) 3862.5 0.000000e+00 2131/2151 (99%)
EPI585535 A/baikal teal/Korea/2406/2014 (A/H5N8) segment 3 (PA) 3862.5 0.000000e+00 2131/2151 (99%)
EPI585531 A/baikal teal/Korea/1458/2014 (A/H5N8) segment 3 (PA) 3862.5 0.000000e+00 2131/2151 (99%)
EPI585530 A/baikal teal/Korea/1457/2014 (A/H5N8) segment 3 (PA) 3862.5 0.000000e+00 2131/2151 (99%)
EPI585528 A/baikal teal/Korea/1454/2014 (A/H5N8) segment 3 (PA) 3862.5 0.000000e+00 2131/2151 (99%)
EPI585525 A/baikal teal/Korea/1448/2014 (A/H5N8) segment 3 (PA) 3862.5 0.000000e+00 2131/2151 (99%)
EPI585524 A/baikal teal/Korea/1447/2014 (A/H5N8) segment 3 (PA) 3862.5 0.000000e+00 2131/2151 (99%)
EPI585523 A/baikal teal/Korea/1446/2014 (A/H5N8) segment 3 (PA) 3862.5 0.000000e+00 2131/2151 (99%)
EPI573637 A/crane/Kagoshima/KU13/2014(H5N8) (A/H5N8) segment 3 (PA) 3862.5 0.000000e+00 2131/2151 (99%)
EPI561712 A/bean goose/Korea/H40/2014 (A/H5N8) segment 3 (PA) 3862.5 0.000000e+00 2131/2151 (99%)
EPI561643 A/tundra swan/Korea/H411/2014 (A/H5N8) segment 3 (PA) 3862.5 0.000000e+00 2131/2151 (99%)
EPI561583 A/broiler duck/Korea/H133/2014 (A/H5N8) segment 3 (PA) 3862.5 0.000000e+00 2131/2151 (99%)
EPI561537 A/Baikal teal/Korea/H84/2014 (A/H5N8) segment 3 (PA) 3862.5 0.000000e+00 2131/2151 (99%)
EPI561534 A/Baikal teal/Korea/H68/2014 (A/H5N8) segment 3 (PA) 3862.5 0.000000e+00 2131/2151 (99%)
EPI561502 A/Baikal teal/Korea/H66/2014 (A/H5N8) segment 3 (PA) 3862.5 0.000000e+00 2131/2151 (99%)
EPI561500 A/Baikal teal/Korea/H62/2014 (A/H5N8) segment 3 (PA) 3862.5 0.000000e+00 2131/2151 (99%)
EPI561338 A/broiler duck/Korea/H49/2014 (A/H5N8) segment 3 (PA) 3862.5 0.000000e+00 2131/2151 (99%)
EPI561334 A/broiler duck/Korea/H47/2014 (A/H5N8) segment 3 (PA) 3862.5 0.000000e+00 2131/2151 (99%)
EPI509694 A/baikal teal/Korea/Donglim3/2014 (A/H5N8) segment 3 (PA) 3862.5 0.000000e+00 2131/2151 (99%)
EPI509693 A/broiler duck/Korea/Buan2/2014 (A/H5N8) segment 3 (PA) 3862.5 0.000000e+00 2131/2151 (99%)
EPI585538 A/baikal teal/Korea/2417/2014 (A/H5N8) segment 3 (PA) 3856.9 0.000000e+00 2130/2151 (99%)
EPI585537 A/baikal teal/Korea/2416/2014 (A/H5N8) segment 3 (PA) 3856.9 0.000000e+00 2130/2151 (99%)
EPI585533 A/baikal teal/Korea/2402/2014 (A/H5N8) segment 3 (PA) 3856.9 0.000000e+00 2130/2151 (99%)
EPI585532 A/baikal teal/Korea/2399/2014 (A/H5N8) segment 3 (PA) 3856.9 0.000000e+00 2130/2151 (99%)
EPI585529 A/baikal teal/Korea/1456/2014 (A/H5N8) segment 3 (PA) 3856.9 0.000000e+00 2130/2151 (99%)
EPI561687 A/spot-billed duck/Korea/H455-42/2014 (A/H5N8) segment 3 (PA) 3856.9 0.000000e+00 2130/2151 (99%)
EPI561642 A/bean goose/Korea/H328/2014 (A/H5N8) segment 3 (PA) 3856.9 0.000000e+00 2130/2151 (99%)
EPI561640 A/Korean native chicken/Korea/H257/2014 (A/H5N8) segment 3 (PA) 3856.9 0.000000e+00 2130/2151 (99%)
EPI561588 A/white-fronted goose/Korea/H231/2014 (A/H5N8) segment 3 (PA) 3856.9 0.000000e+00 2130/2151 (99%)
EPI561587 A/mallard/Korea/H207/2014 (A/H5N8) segment 3 (PA) 3856.9 0.000000e+00 2130/2151 (99%)
EPI561586 A/breeder duck/Korea/H200/2014 (A/H5N8) segment 3 (PA) 3856.9 0.000000e+00 2130/2151 (99%)
EPI561584 A/broiler duck/Korea/H145/2014 (A/H5N8) segment 3 (PA) 3856.9 0.000000e+00 2130/2151 (99%)
EPI561582 A/breeder duck/Korea/H128/2014 (A/H5N8) segment 3 (PA) 3856.9 0.000000e+00 2130/2151 (99%)
EPI561501 A/broiler duck/Korea/H65/2014 (A/H5N8) segment 3 (PA) 3856.9 0.000000e+00 2130/2151 (99%)
EPI561335 A/broiler duck/Korea/H48/2014 (A/H5N8) segment 3 (PA) 3856.9 0.000000e+00 2130/2151 (99%)
EPI561333 A/Baikal teal/Korea/H41/2014 (A/H5N8) segment 3 (PA) 3856.9 0.000000e+00 2130/2151 (99%)
EPI561193 A/broiler duck/Korea/H31/2014 (A/H5N8) segment 3 (PA) 3856.9 0.000000e+00 2130/2151 (99%)
EPI561192 A/broiler duck/Korea/H29/2014 (A/H5N8) segment 3 (PA) 3856.9 0.000000e+00 2130/2151 (99%)
EPI585534 A/baikal teal/Korea/2403/2014 (A/H5N8) segment 3 (PA) 3851.4 0.000000e+00 2129/2151 (98%)
EPI585527 A/baikal teal/Korea/1452/2014 (A/H5N8) segment 3 (PA) 3851.4 0.000000e+00 2129/2151 (98%)
EPI585526 A/baikal teal/Korea/1449/2014 (A/H5N8) segment 3 (PA) 3851.4 0.000000e+00 2129/2151 (98%)
EPI585522 A/baikal teal/Korea/1445/2014 (A/H5N8) segment 3 (PA) 3851.4 0.000000e+00 2129/2151 (98%)
EPI585521 A/baikal teal/Korea/1441/2014 (A/H5N8) segment 3 (PA) 3851.4 0.000000e+00 2129/2151 (98%)
EPI585520 A/baikal teal/Korea/1437/2014 (A/H5N8) segment 3 (PA) 3851.4 0.000000e+00 2129/2151 (98%)
EPI561641 A/mallard/Korea/H297/2014 (A/H5N8) segment 3 (PA) 3851.4 0.000000e+00 2129/2151 (98%)
EPI561639 A/breeder chicken/Korea/H250/2014 (A/H5N8) segment 3 (PA) 3851.4 0.000000e+00 2129/2151 (98%)
EPI561585 A/breeder duck/Korea/H158/2014 (A/H5N8) segment 3 (PA) 3851.4 0.000000e+00 2129/2151 (98%)
EPI561539 A/breeder chicken/Korea/H122/2014 (A/H5N8) segment 3 (PA) 3851.4 0.000000e+00 2129/2151 (98%)
EPI561538 A/Baikal teal/Korea/H96/2014 (A/H5N8) segment 3 (PA) 3851.4 0.000000e+00 2129/2151 (98%)
EPI561536 A/Coot/Korea/H81/2014 (A/H5N8) segment 3 (PA) 3851.4 0.000000e+00 2129/2151 (98%)
EPI561535 A/Baikal teal/Korea/H80/2014 (A/H5N8) segment 3 (PA) 3851.4 0.000000e+00 2129/2151 (98%)
EPI561499 A/bean goose/Korea/H53/2014 (A/H5N8) segment 3 (PA) 3851.4 0.000000e+00 2129/2151 (98%)
EPI561184 A/waterfowl/Korea/S005/2014 (A/H5N8) segment 3 (PA) 3851.4 0.000000e+00 2129/2151 (98%)
EPI573645 A/crane/Kagoshima/KU21/2014(H5N8) (A/H5N8) segment 3 (PA) 3845.8 0.000000e+00 2128/2151 (98%)
EPI561638 A/breeder duck/Korea/H249/2014 (A/H5N8) segment 3 (PA) 3845.8 0.000000e+00 2128/2151 (98%)
EPI542618 A/mallard/Korea/W452/2014 (A/H5N8) segment 3 (PA) 3845.8 0.000000e+00 2128/2151 (98%)
EPI595141 A/greater white-fronted goose/Korea/K14-374-1/2014 (A/H5N8) segment 3 (PA) 3842.2 0.000000e+00 2127/2151 (98%)
EPI595128 A/greater white-fronted goose/Korea/K14-371-4/2014 (A/H5N8) segment 3 (PA) 3840.3 0.000000e+00 2127/2151 (98%)
EPI595119 A/greater white-fronted goose/Korea/K14-369-3/2014 (A/H5N8) segment 3 (PA) 3840.3 0.000000e+00 2127/2151 (98%)
EPI595111 A/greater white-fronted goose/Korea/K14-367-4/2014 (A/H5N8) segment 3 (PA) 3840.3 0.000000e+00 2127/2151 (98%)
EPI595102 A/mandarin duck/Korea/K14-367-1/2014 (A/H5N8) segment 3 (PA) 3840.3 0.000000e+00 2127/2151 (98%)
EPI595093 A/mandarin duck/Korea/K14-366-1/2014 (A/H5N8) segment 3 (PA) 3840.3 0.000000e+00 2127/2151 (98%)
EPI595081 A/mandarin duck/Korea/K14-363-1/2014 (A/H5N8) segment 3 (PA) 3840.3 0.000000e+00 2127/2151 (98%)
EPI573663 A/crane/Kagoshima/KU53/2015(H5N8) (A/H5N8) segment 3 (PA) 3840.3 0.000000e+00 2127/2151 (98%)
EPI573653 A/crane/Kagoshima/KU41/2014(H5N8) (A/H5N8) segment 3 (PA) 3840.3 0.000000e+00 2127/2151 (98%)
EPI595065 A/mallard/Korea/KU3-2/2015 (A/H5N8) segment 3 (PA) 3834.8 0.000000e+00 2126/2151 (98%)
EPI542602 A/duck/Beijing/FS01/2013 (A/H5N8) segment 3 (PA) 3834.8 0.000000e+00 2125/2149 (98%)
EPI517160 A/Chicken/Kumamoto/1-7/2014 (A/H5N8) segment 3 (PA) 3829.2 0.000000e+00 2125/2151 (98%)
EPI558010 A/duck/England/36038/14 (A/H5N8) segment 3 (PA) 3823.7 0.000000e+00 2124/2151 (98%)
EPI553342 A/chicken/Miyazaki/7/2014 (A/H5N8) segment 3 (PA) 3823.7 0.000000e+00 2124/2151 (98%)
EPI547672 A/duck/England/36254/14 (A/H5N8) segment 3 (PA) 3823.7 0.000000e+00 2124/2151 (98%)
EPI595058 A/common teal/Korea/KU-12/2015 (A/H5N8) segment 3 (PA) 3818.1 0.000000e+00 2123/2151 (98%)
EPI573170 A/Chicken/Netherlands/14015824/2014 (A/H5N8) segment 3 (PA) 3818.1 0.000000e+00 2123/2151 (98%)
EPI558003 A/duck/England/36226/14 (A/H5N8) segment 3 (PA) 3818.1 0.000000e+00 2123/2151 (98%)
EPI553184 A/turkey/Italy/14VIR7898-10/2014 (A/H5N8) segment 3 (PA) 3818.1 0.000000e+00 2123/2151 (98%)
EPI548492 A/duck/Chiba/26-372-61/2014 (A/H5N8) segment 3 (PA) 3818.1 0.000000e+00 2123/2151 (98%)
EPI548484 A/duck/Chiba/26-372-48/2014 (A/H5N8) segment 3 (PA) 3818.1 0.000000e+00 2123/2151 (98%)
EPI547681 A/Chicken/Netherlands/14015526/2014 (A/H5N8) segment 3 (PA) 3818.1 0.000000e+00 2123/2151 (98%)
EPI595074 A/mallard/Korea/N15-99/2015 (A/H5N8) segment 3 (PA) 3812.6 0.000000e+00 2122/2151 (98%)
EPI573186 A/chicken/Netherlands/14016437/2014 (A/H5N8) segment 3 (PA) 3812.6 0.000000e+00 2122/2151 (98%)
EPI573178 A/duck/Netherlands/14015898/2014 (A/H5N8) segment 3 (PA) 3812.6 0.000000e+00 2122/2151 (98%)
EPI553361 A/environment/Kagoshima/KU-ngr-H/2014 (A/H5N8) segment 3 (PA) 3812.6 0.000000e+00 2122/2151 (98%)
EPI543001 A/duck/Beijing/FS01/2014 (A/H5N8) segment 3 (PA) 3810.8 0.000000e+00 2119/2148 (98%)
EPI573671 A/mallard duck/Kagoshima/KU70/2015(H5N8) (A/H5N8) segment 3 (PA) 3807.1 0.000000e+00 2121/2151 (98%)
EPI552745 A/turkey/Germany/AR2485-86-L00899/2014 (A/H5N8) segment 3 (PA) 3807.1 0.000000e+00 2121/2151 (98%)
EPI548622 A/chicken/Netherlands/14015531/2014 (A/H5N8) segment 3 (PA) 3807.1 0.000000e+00 2121/2151 (98%)
EPI548429 A/turkey/Germany-MV/R2472/2014 (A/H5N8) segment 3 (PA) 3803.4 0.000000e+00 2120/2151 (98%)
EPI554601 A/turkey/Germany-NI/R3372/2014 (A/H5N8) segment 3 (PA) 3801.5 0.000000e+00 2120/2151 (98%)
EPI543009 A/duck/Beijing/CT01/2014 (A/H5N8) segment 3 (PA) 3801.5 0.000000e+00 2117/2148 (98%)
EPI555125 A/domestic duck/Germany-NI/R3468/2014 (A/H5N8) segment 3 (PA) 3796.0 0.000000e+00 2119/2151 (98%)
EPI576390 A/MuteSwan/Sweden/SVA-1503130141-SZ543/2015 (A/H5N8) segment 3 (PA) 3790.4 0.000000e+00 2118/2151 (98%)
EPI573679 A/mallard duck/Kagoshima/KU116/2015(H5N8) (A/H5N8) segment 3 (PA) 3790.4 0.000000e+00 2119/2152 (98%)
EPI573162 A/chicken/Netherlands/14015766/2014 (A/H5N8) segment 3 (PA) 3784.9 0.000000e+00 2117/2151 (98%)
EPI576385 A/MuteSwan/Sweden/SVA-U1503110277-SZ502/2015 (A/H5N8) segment 3 (PA) 3779.4 0.000000e+00 2116/2151 (98%)
EPI596243 A/eurasian wigeon/Netherlands/1/2014 (A/H5N8) segment 3 (PA) 3751.7 0.000000e+00 2092/2122 (98%)
EPI552759 A/eurasian wigeon/Netherlands/emc-1/2014 (A/H5N8) segment 3 (PA) 3751.7 0.000000e+00 2092/2122 (98%)
EPI431447 A/duck/Hebei/2/2011 (A/H5N2) segment 3 (PA) 3729.5 0.000000e+00 2107/2151 (97%)
EPI590468 A/eurasian wigeon/Netherlands/1/2015 (A/H5N8) segment 3 (PA) 3727.7 0.000000e+00 2086/2120 (98%)
EPI585110 A/eurasian wigeon/Netherlands/1/2015 (A/H5N8) segment 3 (PA) 3727.7 0.000000e+00 2086/2120 (98%)
EPI596245 A/chicken/Netherlands/emc-3/2014 (A/H5N8) segment 3 (PA) 3724.0 0.000000e+00 2084/2118 (98%)
EPI552775 A/chicken/Netherlands/emc-3/2014 (A/H5N8) segment 3 (PA) 3724.0 0.000000e+00 2084/2118 (98%)
EPI596244 A/eurasian wigeon/Netherlands/2/2014 (A/H5N8) segment 3 (PA) 3716.6 0.000000e+00 2078/2111 (98%)
EPI552767 A/eurasian wigeon/Netherlands/emc-2/2014 (A/H5N8) segment 3 (PA) 3716.6 0.000000e+00 2078/2111 (98%)
EPI414237 A/duck/Jiangsu/1-15/2011 (A/H4N2) segment 3 (PA) 3679.6 0.000000e+00 2098/2151 (97%)
EPI398961 A/duck/Eastern China/1111/2011 (A/H5N2) segment 3 (PA) 3663.0 0.000000e+00 2096/2152 (97%)
EPI398962 A/goose/Eastern China/1112/2011 (A/H5N2) segment 3 (PA) 3591.0 0.000000e+00 2082/2151 (96%)
EPI328887 A/duck/Eastern China/108/2008 (A/H5N1) segment 3 (PA) 3591.0 0.000000e+00 2082/2151 (96%)
EPI328879 A/duck/Eastern China/031/2009 (A/H5N5) segment 3 (PA) 3568.8 0.000000e+00 2078/2151 (96%)
EPI493832 A/duck/Guangdong/wy24/2008 (A/H5N5) segment 3 (PA) 3552.2 0.000000e+00 2075/2151 (96%)
EPI442024 A/quail/Jiangsu/k0104/2010 (A/H5N5) segment 3 (PA) 3546.7 0.000000e+00 2074/2151 (96%)
EPI431455 A/duck/Hebei/3/2011 (A/H5N2) segment 3 (PA) 3535.6 0.000000e+00 2072/2151 (96%)
EPI493816 A/duck/Guangdong/wy11/2008 (A/H5N5) segment 3 (PA) 3524.5 0.000000e+00 2070/2151 (96%)
EPI493824 A/duck/Guangdong/wy19/2008 (A/H5N5) segment 3 (PA) 3519.0 0.000000e+00 2069/2151 (96%)
EPI442008 A/goose/Guangdong/k0103/2010 (A/H5N5) segment 3 (PA) 3502.4 0.000000e+00 2066/2151 (96%)
EPI399959 A/duck/Jiangsu/m234/2012 (A/H5N2) segment 3 (PA) 3480.2 0.000000e+00 2063/2152 (95%)
EPI544891 A/duck/Shandong/Q1/2013 (A/H5N8) segment 3 (PA) 3469.1 0.000000e+00 2060/2151 (95%)
EPI442000 A/goose/Shandong/k1204/2009 (A/H5N5) segment 3 (PA) 3469.1 0.000000e+00 2061/2152 (95%)
EPI442016 A/duck/Jiangsu/k1203/2010 (A/H5N8) segment 3 (PA) 3463.6 0.000000e+00 2039/2121 (96%)
EPI475578 A/wild duck/Shandong/628/2011 (A/H5N1) segment 3 (PA) 3452.5 0.000000e+00 2059/2153 (95%)
EPI597674 A/duck/Hunan/316/2005 (A/H5N1) segment 3 (PA) 3447.0 0.000000e+00 2057/2152 (95%)
EPI127382 A/wild duck/Hunan/021/2005 (A/H5N1) segment 3 (PA) 3447.0 0.000000e+00 2057/2152 (95%)
EPI113022 A/crested myna/Hong Kong/540/2006 (A/H5N1) segment 3 (PA) 3430.3 0.000000e+00 2054/2152 (95%)
EPI568391 A/duck/Ningbo/3262/2013 (A/H0) segment 3 (PA) 3419.3 0.000000e+00 2052/2152 (95%)
EPI530983 A/duck/Zhejiang/W24/2013 (A/H5N8) segment 3 (PA) 3419.3 0.000000e+00 2053/2153 (95%)
EPI399885 A/duck/HuBei/03/2010 (A/H5N5) segment 3 (PA) 3419.3 0.000000e+00 2052/2152 (95%)
EPI337063 A/Anhui/2/2005 (A/H5N1) segment 3 (PA) 3419.3 0.000000e+00 2053/2153 (95%)
EPI337058 A/Anhui/1/2005 (A/H5N1) segment 3 (PA) 3419.3 0.000000e+00 2053/2153 (95%)
EPI275385 A/Anhui/2/2005 (A/H5N1) segment 3 (PA) 3419.3 0.000000e+00 2053/2153 (95%)
EPI227308 A/Mallard/Huadong/lk/2005 (A/H5N1) segment 3 (PA) 3419.3 0.000000e+00 2052/2152 (95%)
EPI164247 A/Anhui/2/2005 (A/H5N1) segment 3 (PA) 3419.3 0.000000e+00 2053/2153 (95%)
EPI164220 A/Anhui/1/2005 (A/H5N1) segment 3 (PA) 3419.3 0.000000e+00 2053/2153 (95%)
EPI113122 A/duck/Hunan/5472/2005 (A/H5N1) segment 3 (PA) 3419.3 0.000000e+00 2053/2153 (95%)
EPI113100 A/duck/Guiyang/497/2006 (A/H5N1) segment 3 (PA) 3419.3 0.000000e+00 2053/2153 (95%)
EPI573516 A/wildbird/Anhui/82/2005 (A/H5N1) segment 3 (PA) 3413.7 0.000000e+00 2052/2153 (95%)
EPI337094 A/Zhejiang/1/2006 (A/H5N1) segment 3 (PA) 3413.7 0.000000e+00 2052/2153 (95%)
EPI279945 A/Zhejiang/1/2006 (A/H5N1) segment 3 (PA) 3413.7 0.000000e+00 2052/2153 (95%)
EPI275981 A/duck/Hubei/49/2005 (A/H5N1) segment 3 (PA) 3413.7 0.000000e+00 2052/2153 (95%)
EPI275869 A/chicken/Sichuan/81/2005 (A/H5N1) segment 3 (PA) 3413.7 0.000000e+00 2052/2153 (95%)
EPI113102 A/goose/Guiyang/538/2006 (A/H5N1) segment 3 (PA) 3413.7 0.000000e+00 2052/2153 (95%)
EPI113098 A/duck/Guiyang/293/2006 (A/H5N1) segment 3 (PA) 3413.7 0.000000e+00 2051/2152 (95%)
EPI275957 A/duck/Anhui/1/06 (A/H5N1) segment 3 (PA) 3410.0 0.000000e+00 2051/2153 (95%)
EPI337075 A/Sichuan/2/2006 (A/H5N1) segment 3 (PA) 3408.2 0.000000e+00 2051/2153 (95%)
EPI276045 A/goose/Hubei/65/2005 (A/H5N1) segment 3 (PA) 3408.2 0.000000e+00 2051/2153 (95%)
EPI225093 A/duck/Nam Dinh/218/2006 (A/H5) segment 3 (PA) 3408.2 0.000000e+00 2050/2152 (95%)
EPI175649 A/duck/Hubei/Hangmei01/2006 (A/H5N1) segment 3 (PA) 3408.2 0.000000e+00 2051/2153 (95%)
EPI170655 A/duck/Vietnam/210/2005 (A/H5N1) segment 3 (PA) 3408.2 0.000000e+00 2050/2152 (95%)
EPI170648 A/Muscovy duck/Vietnam/211/2005 (A/H5N1) segment 3 (PA) 3408.2 0.000000e+00 2050/2152 (95%)
EPI170634 A/Muscovy duck/Vietnam/213/2005 (A/H5N1) segment 3 (PA) 3408.2 0.000000e+00 2050/2152 (95%)
EPI170620 A/chicken/Vietnam/216/2005 (A/H5N1) segment 3 (PA) 3408.2 0.000000e+00 2050/2152 (95%)
EPI170612 A/Muscovy duck/Vietnam/217/2005 (A/H5N1) segment 3 (PA) 3408.2 0.000000e+00 2050/2152 (95%)
EPI170604 A/duck/Vietnam/218/2005 (A/H5N1) segment 3 (PA) 3408.2 0.000000e+00 2050/2152 (95%)
EPI170596 A/duck/Vietnam/219/2005 (A/H5N1) segment 3 (PA) 3408.2 0.000000e+00 2050/2152 (95%)
EPI164237 A/Sichuan/2/2006 (A/H5N1) segment 3 (PA) 3408.2 0.000000e+00 2051/2153 (95%)
EPI139938 A/Duck/Fujian/1734/05 (A/H5N1) segment 3 (PA) 3408.2 0.000000e+00 2050/2152 (95%)
EPI113254 A/duck/Guiyang/1558/2006 (A/H5N1) segment 3 (PA) 3408.2 0.000000e+00 2050/2152 (95%)
EPI113160 A/duck/Fujian/720/2006 (A/H5N1) segment 3 (PA) 3408.2 0.000000e+00 2051/2153 (95%)
EPI113158 A/duck/Fujian/671/2006 (A/H5N1) segment 3 (PA) 3408.2 0.000000e+00 2051/2153 (95%)
EPI113024 A/common magpie/Hong Kong/645/2006 (A/H5N1) segment 3 (PA) 3408.2 0.000000e+00 2051/2153 (95%)
EPI591170 A/duck/Jiangxi/23970/2013 (A/H0) segment 3 (PA) 3402.6 0.000000e+00 2049/2152 (95%)
EPI507672 A/mallard duck/Shanghai/SH-9/2013 (A/H5N8) segment 3 (PA) 3402.6 0.000000e+00 2049/2152 (95%)
EPI337140 A/Anhui/1/2006 (A/H5N1) segment 3 (PA) 3402.6 0.000000e+00 2048/2151 (95%)
EPI337082 A/Sichuan/1/2006 (A/H5N1) segment 3 (PA) 3402.6 0.000000e+00 2050/2153 (95%)
EPI280028 A/Anhui/1/2006 (A/H5N1) segment 3 (PA) 3402.6 0.000000e+00 2048/2151 (95%)
EPI275377 A/Anhui/1/2005 (A/H5N1) segment 3 (PA) 3402.6 0.000000e+00 2050/2153 (95%)
EPI270187 A/Vietnam/UT30850/2005 (A/H5N1) segment 3 (PA) 3402.6 0.000000e+00 2047/2149 (95%)
EPI170719 A/chicken/Vietnam/202/2005 (A/H5N1) segment 3 (PA) 3402.6 0.000000e+00 2049/2152 (95%)
EPI170679 A/duck/Vietnam/207/2005 (A/H5N1) segment 3 (PA) 3402.6 0.000000e+00 2049/2152 (95%)
EPI170663 A/chicken/Vietnam/209/2005 (A/H5N1) segment 3 (PA) 3402.6 0.000000e+00 2049/2152 (95%)
EPI170641 A/chicken/Vietnam/212/2005 (A/H5N1) segment 3 (PA) 3402.6 0.000000e+00 2049/2152 (95%)
EPI164229 A/Sichuan/1/2006 (A/H5N1) segment 3 (PA) 3402.6 0.000000e+00 2050/2153 (95%)
EPI113244 A/chicken/Guiyang/3923/2005 (A/H5N1) segment 3 (PA) 3402.6 0.000000e+00 2050/2153 (95%)
EPI113156 A/duck/Fujian/668/2006 (A/H5N1) segment 3 (PA) 3402.6 0.000000e+00 2050/2153 (95%)
EPI113130 A/duck/Hunan/988/2006 (A/H5N1) segment 3 (PA) 3402.6 0.000000e+00 2051/2154 (95%)
EPI113092 A/chicken/Guiyang/3721/2005 (A/H5N1) segment 3 (PA) 3402.6 0.000000e+00 2050/2153 (95%)
EPI113074 A/duck/Guangxi/5457/2005 (A/H5N1) segment 3 (PA) 3402.6 0.000000e+00 2049/2152 (95%)
EPI577197 A/duck/Shaoxing/5240/2013 (A/H0) segment 3 (PA) 3397.1 0.000000e+00 2048/2152 (95%)
EPI337120 A/Sichuan/3/2006 (A/H5N1) segment 3 (PA) 3397.1 0.000000e+00 2049/2153 (95%)
EPI337113 A/Hubei/1/2006 (A/H5N1) segment 3 (PA) 3397.1 0.000000e+00 2049/2153 (95%)
EPI337106 A/Shanghai/1/2006 (A/H5N1) segment 3 (PA) 3397.1 0.000000e+00 2048/2152 (95%)
EPI280116 A/Hubei/1/2006 (A/H5N1) segment 3 (PA) 3397.1 0.000000e+00 2049/2153 (95%)
EPI280108 A/Shanghai/1/2006 (A/H5N1) segment 3 (PA) 3397.1 0.000000e+00 2048/2152 (95%)
EPI280014 A/Sichuan/3/2006 (A/H5N1) segment 3 (PA) 3397.1 0.000000e+00 2049/2153 (95%)
EPI275773 A/chicken/Hunan/21/2005 (A/H5N1) segment 3 (PA) 3397.1 0.000000e+00 2048/2152 (95%)
EPI227015 A/chicken/Ninh Binh/209/2005 (A/H5N1) segment 3 (PA) 3397.1 0.000000e+00 2048/2152 (95%)
EPI222583 A/scaly-breasted munia/Hong Kong/45/2007 (A/H5N1) segment 3 (PA) 3397.1 0.000000e+00 2050/2154 (95%)
EPI174702 A/chicken/Hunan/3157/2006 (A/H5N1) segment 3 (PA) 3397.1 0.000000e+00 2050/2154 (95%)
EPI174689 A/duck/Hunan/689/2006 (A/H5N1) segment 3 (PA) 3397.1 0.000000e+00 2050/2154 (95%)
EPI170671 A/duck/Vietnam/208/2005 (A/H5N1) segment 3 (PA) 3397.1 0.000000e+00 2048/2152 (95%)
EPI170627 A/duck/Vietnam/215/2005 (A/H5N1) segment 3 (PA) 3397.1 0.000000e+00 2048/2152 (95%)
EPI113246 A/goose/Guiyang/4030/2005 (A/H5N1) segment 3 (PA) 3397.1 0.000000e+00 2049/2153 (95%)
EPI113120 A/duck/Hunan/5152/2005 (A/H5N1) segment 3 (PA) 3397.1 0.000000e+00 2048/2152 (95%)
EPI113118 A/duck/Hunan/5106/2005 (A/H5N1) segment 3 (PA) 3397.1 0.000000e+00 2048/2152 (95%)
EPI113110 A/goose/Shantou/3265/2006 (A/H5N1) segment 3 (PA) 3397.1 0.000000e+00 2049/2153 (95%)
EPI113072 A/goose/Guangxi/5414/2005 (A/H5N1) segment 3 (PA) 3397.1 0.000000e+00 2048/2152 (95%)
EPI113068 A/duck/Guangxi/5165/2005 (A/H5N1) segment 3 (PA) 3397.1 0.000000e+00 2048/2152 (95%)
EPI113064 A/chicken/Guangxi/4989/2005 (A/H5N1) segment 3 (PA) 3397.1 0.000000e+00 2048/2152 (95%)
EPI113060 A/goose/Guangxi/4513/2005 (A/H5N1) segment 3 (PA) 3397.1 0.000000e+00 2048/2152 (95%)
EPI113058 A/duck/Guangxi/4428/2005 (A/H5N1) segment 3 (PA) 3397.1 0.000000e+00 2048/2152 (95%)
EPI113056 A/goose/Guangxi/4289/2005 (A/H5N1) segment 3 (PA) 3397.1 0.000000e+00 2048/2152 (95%)
EPI113026 A/little egret/Hong Kong/718/2006 (A/H5N1) segment 3 (PA) 3397.1 0.000000e+00 2048/2152 (95%)
EPI530984 A/duck/Zhejiang/6D18/2013 (A/H5N8) segment 3 (PA) 3391.6 0.000000e+00 2047/2152 (95%)
EPI509692 A/breeder duck/Korea/Gochang1/2014 (A/H5N8) segment 3 (PA) 3391.6 0.000000e+00 2047/2152 (95%)
EPI337088 A/Hunan/1/2006 (A/H5N1) segment 3 (PA) 3391.6 0.000000e+00 2048/2153 (95%)
EPI280100 A/Guangdong/1/2006 (A/H5N1) segment 3 (PA) 3391.6 0.000000e+00 2048/2153 (95%)
EPI280092 A/Hunan/1/2006 (A/H5N1) segment 3 (PA) 3391.6 0.000000e+00 2048/2153 (95%)
EPI170695 A/duck/Vietnam/205/2005 (A/H5N1) segment 3 (PA) 3391.6 0.000000e+00 2047/2152 (95%)
EPI113258 A/duck/Guiyang/1722/2006 (A/H5N1) segment 3 (PA) 3391.6 0.000000e+00 2047/2152 (95%)
EPI113112 A/goose/Shantou/3295/2006 (A/H5N1) segment 3 (PA) 3391.6 0.000000e+00 2048/2153 (95%)
EPI113096 A/chicken/Guiyang/29/2006 (A/H5N1) segment 3 (PA) 3391.6 0.000000e+00 2047/2152 (95%)
EPI113076 A/duck/Guangxi/150/2006 (A/H5N1) segment 3 (PA) 3391.6 0.000000e+00 2047/2152 (95%)
EPI113070 A/duck/Guangxi/5270/2005 (A/H5N1) segment 3 (PA) 3391.6 0.000000e+00 2047/2152 (95%)
EPI113018 A/chicken/Hong Kong/282/2006 (A/H5N1) segment 3 (PA) 3391.6 0.000000e+00 2047/2152 (95%)
EPI337127 A/Guangdong/2/2006 (A/H5N1) segment 3 (PA) 3386.0 0.000000e+00 2046/2152 (95%)
EPI280021 A/Guangdong/2/2006 (A/H5N1) segment 3 (PA) 3386.0 0.000000e+00 2046/2152 (95%)
EPI224970 A/chicken/Hong Kong/D-06-0947/2006 (A/H5N1) segment 3 (PA) 3386.0 0.000000e+00 2046/2152 (95%)
EPI224776 A/Shanghai/1/2006 (A/H5N1) segment 3 (PA) 3386.0 0.000000e+00 2047/2153 (95%)
EPI174701 A/chicken/Hubei/3002/2007 (A/H5N1) segment 3 (PA) 3386.0 0.000000e+00 2048/2154 (95%)
EPI126697 A/human/China/GD02/2006 (A/H5N1) segment 3 (PA) 3386.0 0.000000e+00 2046/2152 (95%)
EPI113326 A/Shenzhen/406H/2006 (A/H5N1) segment 3 (PA) 3386.0 0.000000e+00 2046/2152 (95%)
EPI113266 A/duck/Guiyang/1081/2006 (A/H5N1) segment 3 (PA) 3386.0 0.000000e+00 2046/2152 (95%)
EPI113264 A/goose/Guiyang/765/2006 (A/H5N1) segment 3 (PA) 3386.0 0.000000e+00 2046/2152 (95%)
EPI113148 A/duck/Fujian/11311/2005 (A/H5N1) segment 3 (PA) 3386.0 0.000000e+00 2046/2152 (95%)
EPI113128 A/duck/Hunan/856/2006 (A/H5N1) segment 3 (PA) 3386.0 0.000000e+00 2042/2145 (95%)
EPI113080 A/duck/Guangxi/288/2006 (A/H5N1) segment 3 (PA) 3386.0 0.000000e+00 2046/2152 (95%)
EPI113062 A/duck/Guangxi/4830/2005 (A/H5N1) segment 3 (PA) 3386.0 0.000000e+00 2044/2149 (95%)
EPI113028 A/chicken/Hong Kong/947/2006 (A/H5N1) segment 3 (PA) 3386.0 0.000000e+00 2046/2152 (95%)
EPI110458 A/human/Zhejiang/16/2006 (A/H5N1) segment 3 (PA) 3386.0 0.000000e+00 2049/2155 (95%)
EPI106024 A/China/GD01/2006 (A/H5N1) segment 3 (PA) 3386.0 0.000000e+00 2046/2152 (95%)
EPI222149 A/lesser kestrel/Heilongjiang/194/2007 (A/H5N1) segment 3 (PA) 3384.2 0.000000e+00 2047/2153 (95%)
EPI561498 A/Baikal teal/Korea/H52/2014 (A/H5N8) segment 3 (PA) 3380.5 0.000000e+00 2045/2152 (95%)
EPI337940 A/Guangxi/1/2005 (A/H5N1) segment 3 (PA) 3380.5 0.000000e+00 2045/2152 (95%)
EPI276069 A/shrike/Tibet/13/2006 (A/H5N1) segment 3 (PA) 3380.5 0.000000e+00 2047/2154 (95%)
EPI276021 A/duck/Jiangxi/80/2005 (A/H5N1) segment 3 (PA) 3380.5 0.000000e+00 2048/2155 (95%)
EPI222001 A/environment/Hunan/1-8/2007 (A/H5N1) segment 3 (PA) 3380.5 0.000000e+00 2046/2153 (95%)
EPI164372 A/goose/Yunnan/6193/2006 (A/H5N1) segment 3 (PA) 3380.5 0.000000e+00 2045/2152 (95%)
EPI164263 A/Guangxi/1/2005 (A/H5N1) segment 3 (PA) 3380.5 0.000000e+00 2045/2152 (95%)
EPI113250 A/duck/Fujian/10389/2005 (A/H5N1) segment 3 (PA) 3380.5 0.000000e+00 2045/2152 (95%)
EPI113146 A/duck/Fujian/11094/2005 (A/H5N1) segment 3 (PA) 3380.5 0.000000e+00 2045/2152 (95%)
EPI113144 A/duck/Fujian/10934/2005 (A/H5N1) segment 3 (PA) 3380.5 0.000000e+00 2045/2152 (95%)
EPI113142 A/chicken/Fujian/10567/2005 (A/H5N1) segment 3 (PA) 3380.5 0.000000e+00 2045/2152 (95%)
EPI113140 A/chicken/Fujian/10313/2005 (A/H5N1) segment 3 (PA) 3380.5 0.000000e+00 2045/2152 (95%)
EPI113078 A/goose/Guangxi/224/2006 (A/H5N1) segment 3 (PA) 3380.5 0.000000e+00 2045/2152 (95%)
EPI113020 A/magpie robin/Hong Kong/366/2006 (A/H5N1) segment 3 (PA) 3380.5 0.000000e+00 2043/2149 (95%)
EPI506252 A/duck/Laos/3295/2006 (A/H5N1) segment 3 (PA) 3374.9 0.000000e+00 2046/2154 (94%)
EPI174703 A/duck/Hunan/3315/2006 (A/H5N1) segment 3 (PA) 3374.9 0.000000e+00 2046/2154 (94%)
EPI174700 A/duck/Hubei/2911/2007 (A/H5N1) segment 3 (PA) 3374.9 0.000000e+00 2046/2154 (94%)
EPI174693 A/duck/Henan/1650/2006 (A/H5N1) segment 3 (PA) 3374.9 0.000000e+00 2045/2153 (94%)
EPI167857 A/crested goshawk/Hong Kong/458/2007 (A/H5N1) segment 3 (PA) 3374.9 0.000000e+00 2046/2154 (94%)
EPI164292 A/duck/Yunnan/6490/2006 (A/H5N1) segment 3 (PA) 3374.9 0.000000e+00 2044/2152 (94%)
EPI113290 A/duck/Guangxi/1830/2006 (A/H5N1) segment 3 (PA) 3374.9 0.000000e+00 2044/2152 (94%)
EPI113260 A/goose/Guiyang/1794/2006 (A/H5N1) segment 3 (PA) 3374.9 0.000000e+00 2044/2152 (94%)
EPI113152 A/duck/Fujian/12032/2005 (A/H5N1) segment 3 (PA) 3374.9 0.000000e+00 2044/2152 (94%)
EPI113150 A/chicken/Fujian/11933/2005 (A/H5N1) segment 3 (PA) 3374.9 0.000000e+00 2044/2152 (94%)
EPI113134 A/duck/Fujian/9713/2005 (A/H5N1) segment 3 (PA) 3374.9 0.000000e+00 2044/2152 (94%)
EPI113132 A/duck/Fujian/9651/2005 (A/H5N1) segment 3 (PA) 3374.9 0.000000e+00 2044/2152 (94%)
EPI113126 A/duck/Hunan/344/2006 (A/H5N1) segment 3 (PA) 3374.9 0.000000e+00 2030/2131 (95%)
EPI113124 A/duck/Hunan/324/2006 (A/H5N1) segment 3 (PA) 3374.9 0.000000e+00 2030/2131 (95%)
EPI113104 A/duck/Shantou/13323/2005 (A/H5N1) segment 3 (PA) 3374.9 0.000000e+00 2044/2152 (94%)
EPI113016 A/magpie robin/Hong Kong/75/2006 (A/H5N1) segment 3 (PA) 3374.9 0.000000e+00 2037/2141 (95%)
EPI337100 A/Guangdong/1/2006 (A/H5N1) segment 3 (PA) 3371.3 0.000000e+00 2037/2142 (95%)
EPI350887 A/duck/Vietnam/NCVD-377/2009 (A/H5N1) segment 3 (PA) 3369.4 0.000000e+00 2044/2153 (94%)
EPI350761 A/duck/Vietnam/NCVD-287/2009 (A/H5N1) segment 3 (PA) 3369.4 0.000000e+00 2044/2153 (94%)
EPI337153 A/Anhui/1/2007 (A/H5N1) segment 3 (PA) 3369.4 0.000000e+00 2044/2153 (94%)
EPI280148 A/Jiangsu/2/2007 (A/H5N1) segment 3 (PA) 3369.4 0.000000e+00 2044/2153 (94%)
EPI280140 A/Jiangsu/1/2007 (A/H5N1) segment 3 (PA) 3369.4 0.000000e+00 2044/2153 (94%)
EPI280035 A/Anhui/1/2007 (A/H5N1) segment 3 (PA) 3369.4 0.000000e+00 2044/2153 (94%)
EPI180942 A/chicken/Laos/37/2008 (A/H5N1) segment 3 (PA) 3369.4 0.000000e+00 2045/2154 (94%)
EPI180934 A/chicken/Laos/35/2008 (A/H5N1) segment 3 (PA) 3369.4 0.000000e+00 2045/2154 (94%)
EPI180926 A/chicken/Laos/33/2008 (A/H5N1) segment 3 (PA) 3369.4 0.000000e+00 2045/2154 (94%)
EPI180902 A/chicken/Laos/13/2008 (A/H5N1) segment 3 (PA) 3369.4 0.000000e+00 2044/2153 (94%)
EPI174691 A/chicken/Henan/1362/2006 (A/H5N1) segment 3 (PA) 3369.4 0.000000e+00 2044/2153 (94%)
EPI164316 A/goose/Yunnan/4389/2006 (A/H5N1) segment 3 (PA) 3369.4 0.000000e+00 2043/2152 (94%)
EPI164308 A/goose/Yunnan/4371/2006 (A/H5N1) segment 3 (PA) 3369.4 0.000000e+00 2043/2152 (94%)
EPI141284 A/Jiangsu/1/2007 (A/H5N1) segment 3 (PA) 3369.4 0.000000e+00 2044/2153 (94%)
EPI141276 A/Jiangsu/2/2007 (A/H5N1) segment 3 (PA) 3369.4 0.000000e+00 2044/2153 (94%)
EPI113298 A/chicken/Fujian/12239/2005 (A/H5N1) segment 3 (PA) 3369.4 0.000000e+00 2043/2152 (94%)
EPI113292 A/goose/Guangxi/1898/2006 (A/H5N1) segment 3 (PA) 3369.4 0.000000e+00 2043/2152 (94%)
EPI113286 A/duck/Guangxi/1550/2006 (A/H5N1) segment 3 (PA) 3369.4 0.000000e+00 2043/2152 (94%)
EPI113256 A/goose/Guiyang/1636/2006 (A/H5N1) segment 3 (PA) 3369.4 0.000000e+00 2044/2153 (94%)
EPI113248 A/duck/Fujian/10160/2005 (A/H5N1) segment 3 (PA) 3369.4 0.000000e+00 2043/2152 (94%)
EPI113138 A/chicken/Fujian/10039/2005 (A/H5N1) segment 3 (PA) 3369.4 0.000000e+00 2043/2152 (94%)
EPI113136 A/chicken/Fujian/9821/2005 (A/H5N1) segment 3 (PA) 3369.4 0.000000e+00 2043/2152 (94%)
EPI113114 A/chicken/Shantou/3840/2006 (A/H5N1) segment 3 (PA) 3369.4 0.000000e+00 2043/2152 (94%)
EPI113108 A/chicken/Shantou/1233/2006 (A/H5N1) segment 3 (PA) 3369.4 0.000000e+00 2043/2152 (94%)
EPI350035 A/chicken/Vietnam/NCVD-289/2009 (A/H5N1) segment 3 (PA) 3365.7 0.000000e+00 2043/2153 (94%)
EPI351577 A/poultry/Vietnam/NCVD-416/2010 (A/H5N1) segment 3 (PA) 3363.9 0.000000e+00 2043/2153 (94%)
EPI351351 A/duck/Vietnam/NCVD-378/2009 (A/H5N1) segment 3 (PA) 3363.9 0.000000e+00 2043/2153 (94%)
EPI350042 A/chicken/Vietnam/NCVD-290/2009 (A/H5N1) segment 3 (PA) 3363.9 0.000000e+00 2043/2153 (94%)
EPI337294 A/environment/Guizhou/9/2009 (A/H5N1) segment 3 (PA) 3363.9 0.000000e+00 2043/2153 (94%)
EPI337286 A/environment/Guizhou/7/2009 (A/H5N1) segment 3 (PA) 3363.9 0.000000e+00 2043/2153 (94%)
EPI337223 A/Hunan/2/2009 (A/H5N1) segment 3 (PA) 3363.9 0.000000e+00 2043/2153 (94%)
EPI280236 A/environment/Guizhou/7/2009 (A/H5N1) segment 3 (PA) 3363.9 0.000000e+00 2043/2153 (94%)
EPI280172 A/Hunan/2/2009 (A/H5N1) segment 3 (PA) 3363.9 0.000000e+00 2043/2153 (94%)
EPI180950 A/duck/Laos/25/2006 (A/H5N1) segment 3 (PA) 3363.9 0.000000e+00 2042/2152 (94%)
EPI180846 A/duck/Laos/A0301/2007 (A/H5N1) segment 3 (PA) 3363.9 0.000000e+00 2043/2153 (94%)
EPI180822 A/duck/Laos/P0127/2007 (A/H5N1) segment 3 (PA) 3363.9 0.000000e+00 2041/2151 (94%)
EPI167782 A/Muscovy duck/Vietnam/NCVD-46/2007 (A/H5N1) segment 3 (PA) 3363.9 0.000000e+00 2042/2152 (94%)
EPI164284 A/duck/Yunnan/5310/2006 (A/H5N1) segment 3 (PA) 3363.9 0.000000e+00 2044/2154 (94%)
EPI113296 A/duck/Guangxi/2143/2006 (A/H5N1) segment 3 (PA) 3363.9 0.000000e+00 2042/2152 (94%)
EPI113164 A/goose/Guangxi/532/2006 (A/H5N1) segment 3 (PA) 3363.9 0.000000e+00 2029/2132 (95%)
EPI113154 A/chicken/Fujian/584/2006 (A/H5N1) segment 3 (PA) 3363.9 0.000000e+00 2042/2152 (94%)
EPI113116 A/chicken/Shantou/3923/2006 (A/H5N1) segment 3 (PA) 3363.9 0.000000e+00 2042/2152 (94%)
EPI113066 A/duck/Guangxi/5075/2005 (A/H5N1) segment 3 (PA) 3363.9 0.000000e+00 2028/2131 (95%)
EPI280244 A/environment/Guizhou/9/2009 (A/H5N1) segment 3 (PA) 3360.2 0.000000e+00 2042/2153 (94%)
EPI167758 A/chicken/Vietnam/NCVD-44/2007 (A/H5N1) segment 3 (PA) 3360.2 0.000000e+00 2040/2152 (94%)
EPI351358 A/duck/Vietnam/NCVD-379/2009 (A/H5N1) segment 3 (PA) 3358.3 0.000000e+00 2042/2153 (94%)
EPI348898 A/duck/Vietnam/NCVD-462/2010 (A/H5N1) segment 3 (PA) 3358.3 0.000000e+00 2042/2153 (94%)
EPI221923 A/duck/Nong-Khai/Thailand/KU-56/2007 (A/H5N1) segment 3 (PA) 3358.3 0.000000e+00 2042/2153 (94%)
EPI180830 A/duck/Laos/P0117/2007 (A/H5N1) segment 3 (PA) 3358.3 0.000000e+00 2041/2152 (94%)
EPI164565 A/chicken/Laos/P0169/2007 (A/H5N1) segment 3 (PA) 3358.3 0.000000e+00 2041/2152 (94%)
EPI164557 A/duck/Laos/P0106/2007 (A/H5N1) segment 3 (PA) 3358.3 0.000000e+00 2040/2151 (94%)
EPI113288 A/goose/Guangxi/1633/2006 (A/H5N1) segment 3 (PA) 3358.3 0.000000e+00 2041/2152 (94%)
EPI113284 A/goose/Guangxi/1458/2006 (A/H5N1) segment 3 (PA) 3358.3 0.000000e+00 2042/2153 (94%)
EPI113282 A/duck/Guangxi/1436/2006 (A/H5N1) segment 3 (PA) 3358.3 0.000000e+00 2041/2152 (94%)
EPI350824 A/duck/Vietnam/NCVD-343/2009 (A/H5N1) segment 3 (PA) 3356.5 0.000000e+00 2041/2153 (94%)
EPI594117 A/Vietnam/HN31676/2010 (A/H5N1) segment 3 (PA) 3352.8 0.000000e+00 2041/2153 (94%)
EPI361515 A/Chicken/Laos/Xaythiani 26/2006 (A/H5N1) segment 3 (PA) 3352.8 0.000000e+00 2040/2152 (94%)
EPI350873 A/duck/Vietnam/NCVD-376/2009 (A/H5N1) segment 3 (PA) 3352.8 0.000000e+00 2041/2153 (94%)
EPI337209 A/Guizhou/1/2009 (A/H5N1) segment 3 (PA) 3352.8 0.000000e+00 2041/2153 (94%)
EPI337174 A/Guangdong/1/2008 (A/H5N1) segment 3 (PA) 3352.8 0.000000e+00 2041/2153 (94%)
EPI280077 A/Guizhou/1/2009 (A/H5N1) segment 3 (PA) 3352.8 0.000000e+00 2041/2153 (94%)
EPI280056 A/Guangdong/1/2008 (A/H5N1) segment 3 (PA) 3352.8 0.000000e+00 2041/2153 (94%)
EPI174690 A/chicken/Anhui/1089/2007 (A/H5N1) segment 3 (PA) 3352.8 0.000000e+00 2041/2153 (94%)
EPI164573 A/chicken/Laos/P0171/2007 (A/H5N1) segment 3 (PA) 3352.8 0.000000e+00 2041/2153 (94%)
EPI164380 A/goose/Yunnan/6384/2006 (A/H5N1) segment 3 (PA) 3352.8 0.000000e+00 2042/2154 (94%)
EPI164348 A/goose/Yunnan/5599/2006 (A/H5N1) segment 3 (PA) 3352.8 0.000000e+00 2042/2154 (94%)
EPI164276 A/duck/Yunnan/4873/2006 (A/H5N1) segment 3 (PA) 3352.8 0.000000e+00 2040/2152 (94%)
EPI113294 A/chicken/Guangxi/1951/2006 (A/H5N1) segment 3 (PA) 3352.8 0.000000e+00 2041/2153 (94%)
EPI105388 A/chicken/Zhejiang/24/2005 (A/H5N1) segment 3 (PA) 3352.8 0.000000e+00 2021/2123 (95%)
EPI594126 A/Vietnam/UT36285/2010 (A/H5N1) segment 3 (PA) 3347.2 0.000000e+00 2040/2153 (94%)
EPI594123 A/Vietnam/UT36282/2010 (A/H5N1) segment 3 (PA) 3347.2 0.000000e+00 2040/2153 (94%)
EPI408096 A/village chicken/Kyaing Tong/2433/2007 (A/H5N1) segment 3 (PA) 3347.2 0.000000e+00 2039/2152 (94%)
EPI406383 A/chicken/Ha Tay/44/2007 (A/H5N1) segment 3 (PA) 3347.2 0.000000e+00 2039/2152 (94%)
EPI350880 A/duck/Vietnam/NCVD-374/2009 (A/H5N1) segment 3 (PA) 3347.2 0.000000e+00 2040/2153 (94%)
EPI350866 A/duck/Vietnam/NCVD-375/2009 (A/H5N1) segment 3 (PA) 3347.2 0.000000e+00 2040/2153 (94%)
EPI350418 A/chicken/Vietnam/NCVD-410/2010 (A/H5N1) segment 3 (PA) 3347.2 0.000000e+00 2040/2153 (94%)
EPI350403 A/chicken/Vietnam/NCVD-407/2010 (A/H5N1) segment 3 (PA) 3347.2 0.000000e+00 2040/2153 (94%)
EPI350388 A/chicken/Vietnam/NCVD-405/2010 (A/H5N1) segment 3 (PA) 3347.2 0.000000e+00 2040/2153 (94%)
EPI337270 A/environment/Guizhou/2/2009 (A/H5N1) segment 3 (PA) 3347.2 0.000000e+00 2039/2152 (94%)
EPI337188 A/Shandong/1/2009 (A/H5N1) segment 3 (PA) 3347.2 0.000000e+00 2040/2153 (94%)
EPI337147 A/Fujian/1/2007 (A/H5N1) segment 3 (PA) 3347.2 0.000000e+00 2040/2153 (94%)
EPI280132 A/Fujian/1/2007 (A/H5N1) segment 3 (PA) 3347.2 0.000000e+00 2040/2153 (94%)
EPI280063 A/Shandong/1/2009 (A/H5N1) segment 3 (PA) 3347.2 0.000000e+00 2040/2153 (94%)
EPI275725 A/chicken/Fujian/1/2007 (A/H5N1) segment 3 (PA) 3347.2 0.000000e+00 2040/2153 (94%)
EPI222872 A/tree sparrow/Jiangsu/1/2008 (A/H5N1) segment 3 (PA) 3347.2 0.000000e+00 2033/2142 (94%)
EPI180910 A/chicken/Laos/16/2008 (A/H5N1) segment 3 (PA) 3347.2 0.000000e+00 2039/2152 (94%)
EPI180862 A/duck/Laos/A0503/2007 (A/H5N1) segment 3 (PA) 3347.2 0.000000e+00 2039/2152 (94%)
EPI180811 A/pigeon/Laos/P0022/2007 (A/H5N1) segment 3 (PA) 3347.2 0.000000e+00 2039/2152 (94%)
EPI174692 A/duck/Henan/1647/2006 (A/H5N1) segment 3 (PA) 3347.2 0.000000e+00 2041/2154 (94%)
EPI167991 A/little egret/Hong Kong/8550/2007 (A/H5N1) segment 3 (PA) 3347.2 0.000000e+00 2039/2152 (94%)
EPI164364 A/goose/Yunnan/5979/2006 (A/H5N1) segment 3 (PA) 3347.2 0.000000e+00 2041/2154 (94%)
EPI164324 A/goose/Yunnan/4985/2006 (A/H5N1) segment 3 (PA) 3347.2 0.000000e+00 2039/2152 (94%)
EPI78019 A/chicken/Malaysia/5223/2007 (A/H5N1) segment 3 (PA) 3345.4 0.000000e+00 2020/2124 (95%)
EPI350474 A/chicken/Vietnam/NCVD-412/2010 (A/H5N1) segment 3 (PA) 3343.6 0.000000e+00 2039/2153 (94%)
EPI350395 A/chicken/Vietnam/NCVD-406/2010 (A/H5N1) segment 3 (PA) 3343.6 0.000000e+00 2039/2153 (94%)
EPI350381 A/chicken/Vietnam/NCVD-404/2010 (A/H5N1) segment 3 (PA) 3343.6 0.000000e+00 2039/2153 (94%)
EPI408094 A/chicken/Hmawbi/517/2007 (A/H5N1) segment 3 (PA) 3341.7 0.000000e+00 2038/2152 (94%)
EPI351446 A/muscovy duck/Vietnam/NCVD-038/2008 (A/H5N1) segment 3 (PA) 3341.7 0.000000e+00 2038/2152 (94%)
EPI350411 A/chicken/Vietnam/NCVD-409/2010 (A/H5N1) segment 3 (PA) 3341.7 0.000000e+00 2039/2153 (94%)
EPI350049 A/chicken/Vietnam/NCVD-291/2009 (A/H5N1) segment 3 (PA) 3341.7 0.000000e+00 2039/2153 (94%)
EPI349886 A/chicken/Vietnam/NCVD-080/2008 (A/H5N1) segment 3 (PA) 3341.7 0.000000e+00 2039/2153 (94%)
EPI286510 A/muscovy duck/Bac Gieng/07-66/2007 (A/H5N1) segment 3 (PA) 3341.7 0.000000e+00 2039/2153 (94%)
EPI285955 A/chicken/Bac Giang/07-74/2007 (A/H5N1) segment 3 (PA) 3341.7 0.000000e+00 2039/2153 (94%)
EPI285952 A/duck/Mong Cai/07-58/2007 (A/H5N1) segment 3 (PA) 3341.7 0.000000e+00 2038/2152 (94%)
EPI285948 A/duck/Phu Tho/07-48/2007 (A/H5N1) segment 3 (PA) 3341.7 0.000000e+00 2039/2153 (94%)
EPI285945 A/duck/Hai Duong/07-40/2007 (A/H5N1) segment 3 (PA) 3341.7 0.000000e+00 2038/2152 (94%)
EPI270235 A/Vietnam/HN31388M1/2007 (A/H5N1) segment 3 (PA) 3341.7 0.000000e+00 2039/2153 (94%)
EPI221931 A/duck/Phu Tho/07-92/2007 (A/H5N1) segment 3 (PA) 3341.7 0.000000e+00 2039/2153 (94%)
EPI180854 A/chicken/Laos/A0464/2007 (A/H5N1) segment 3 (PA) 3341.7 0.000000e+00 2038/2152 (94%)
EPI170751 A/Laos/Nong Khai 1/2007 (A/H5N1) segment 3 (PA) 3341.7 0.000000e+00 2038/2152 (94%)
EPI167780 A/chicken/Vietnam/NCVD-45/2007 (A/H5N1) segment 3 (PA) 3341.7 0.000000e+00 2037/2152 (94%)
EPI167729 A/chicken/Vietnam/NCVD-40/2007 (A/H5N1) segment 3 (PA) 3341.7 0.000000e+00 2038/2152 (94%)
EPI167721 A/goose/Laos/NCVD-39/2007 (A/H5N1) segment 3 (PA) 3341.7 0.000000e+00 2038/2152 (94%)
EPI164356 A/goose/Yunnan/5769/2006 (A/H5N1) segment 3 (PA) 3341.7 0.000000e+00 2040/2154 (94%)
EPI113090 A/duck/Guangxi/804/2006 (A/H5N1) segment 3 (PA) 3341.7 0.000000e+00 2024/2131 (94%)
EPI113088 A/duck/Guangxi/744/2006 (A/H5N1) segment 3 (PA) 3341.7 0.000000e+00 2025/2132 (94%)
EPI113086 A/duck/Guangxi/619/2006 (A/H5N1) segment 3 (PA) 3341.7 0.000000e+00 2024/2131 (94%)
EPI113084 A/goose/Guangxi/582/2006 (A/H5N1) segment 3 (PA) 3341.7 0.000000e+00 2024/2131 (94%)
EPI113082 A/duck/Guangxi/392/2006 (A/H5N1) segment 3 (PA) 3341.7 0.000000e+00 2024/2131 (94%)
EPI594120 A/Vietnam/UT36236/2010 (A/H5N1) segment 3 (PA) 3339.9 0.000000e+00 2038/2153 (94%)
EPI351372 A/duck/Vietnam/NCVD-422/2010 (A/H5N1) segment 3 (PA) 3338.0 0.000000e+00 2038/2153 (94%)
EPI463678 A/swine/Jiangsu/2/2009 (A/H5N1) segment 3 (PA) 3336.2 0.000000e+00 2039/2154 (94%)
EPI406375 A/chicken/Hai Duong/41/2007 (A/H5N1) segment 3 (PA) 3336.2 0.000000e+00 2037/2152 (94%)
EPI406343 A/chicken/Hanoi/45/2007 (A/H5N1) segment 3 (PA) 3336.2 0.000000e+00 2037/2152 (94%)
EPI383692 A/duck/Vietnam/TY114/2007 (A/H5N1) segment 3 (PA) 3336.2 0.000000e+00 2038/2153 (94%)
EPI351482 A/muscovy duck/Vietnam/NCVD-120/2007 (A/H5N1) segment 3 (PA) 3336.2 0.000000e+00 2038/2153 (94%)
EPI351432 A/muscovy duck/Vietnam/NCVD-079/2008 (A/H5N1) segment 3 (PA) 3336.2 0.000000e+00 2033/2146 (94%)
EPI286512 A/muscovy duck/Son La/07-85/2007 (A/H5N1) segment 3 (PA) 3336.2 0.000000e+00 2038/2153 (94%)
EPI286511 A/muscovy duck/Ha Nam/07-84/2007 (A/H5N1) segment 3 (PA) 3336.2 0.000000e+00 2038/2153 (94%)
EPI285959 A/duck/Thai Ninh/07-86/2007 (A/H5N1) segment 3 (PA) 3336.2 0.000000e+00 2038/2153 (94%)
EPI285956 A/chicken/Ha Nam/07-83/2007 (A/H5N1) segment 3 (PA) 3336.2 0.000000e+00 2038/2153 (94%)
EPI285950 A/duck/Ha Tinh/07-53/2007 (A/H5N1) segment 3 (PA) 3336.2 0.000000e+00 2038/2153 (94%)
EPI285949 A/duck/Nghe An/07-49/2007 (A/H5N1) segment 3 (PA) 3336.2 0.000000e+00 2038/2153 (94%)
EPI285936 A/avian/Hong Kong/0719/2007 (A/H5N1) segment 3 (PA) 3336.2 0.000000e+00 2038/2153 (94%)
EPI180918 A/chicken/Laos/17/2008 (A/H5N1) segment 3 (PA) 3336.2 0.000000e+00 2039/2154 (94%)
EPI180886 A/chicken/Laos/P0130/2007 (A/H5N1) segment 3 (PA) 3336.2 0.000000e+00 2037/2152 (94%)
EPI180870 A/duck/Laos/A0617/2007 (A/H5N1) segment 3 (PA) 3336.2 0.000000e+00 2037/2152 (94%)
EPI168039 A/grey heron/Hong Kong/1046/2008 (A/H5N1) segment 3 (PA) 3336.2 0.000000e+00 2038/2153 (94%)
EPI168007 A/grey heron/Hong Kong/3088/2007 (A/H5N1) segment 3 (PA) 3336.2 0.000000e+00 2038/2153 (94%)
EPI167701 A/duck/Laos/NCVD-35/2007 (A/H5N1) segment 3 (PA) 3336.2 0.000000e+00 2037/2152 (94%)
EPI164340 A/goose/Yunnan/5540/2006 (A/H5N1) segment 3 (PA) 3336.2 0.000000e+00 2039/2154 (94%)
EPI113280 A/duck/Guangxi/1258/2006 (A/H5N1) segment 3 (PA) 3336.2 0.000000e+00 2038/2153 (94%)
EPI113166 A/chicken/Guangxi/683/2006 (A/H5N1) segment 3 (PA) 3336.2 0.000000e+00 2023/2131 (94%)
EPI113162 A/chicken/Guangxi/463/2006 (A/H5N1) segment 3 (PA) 3336.2 0.000000e+00 2023/2131 (94%)
EPI350530 A/duck/Vietnam/NCVD-013/2008 (A/H5N1) segment 3 (PA) 3334.3 0.000000e+00 2037/2152 (94%)
EPI349939 A/chicken/Vietnam/NCVD-083/2008 (A/H5N1) segment 3 (PA) 3332.5 0.000000e+00 2036/2152 (94%)
EPI167686 A/duck/Vietnam/NCVD-31/2007 (A/H5N1) segment 3 (PA) 3332.5 0.000000e+00 2037/2153 (94%)
EPI620865 A/duck/Vietnam NamDinh/NCVD-88/2007 (A/H5N1) segment 3 (PA) 3330.6 0.000000e+00 2037/2153 (94%)
EPI492507 A/chicken/Laos/LH2/2010 (A/H5N1) segment 3 (PA) 3330.6 0.000000e+00 2037/2153 (94%)
EPI350426 A/chicken/Vietnam/NCVD-400/2010 (A/H5N1) segment 3 (PA) 3330.6 0.000000e+00 2037/2153 (94%)
EPI350021 A/chicken/Vietnam/NCVD-283/2009 (A/H5N1) segment 3 (PA) 3330.6 0.000000e+00 2036/2152 (94%)
EPI349078 A/avian/Vietnam/NCVD-132/2008 (A/H5N1) segment 3 (PA) 3330.6 0.000000e+00 2037/2153 (94%)
EPI335241 A/chicken/Lao/LH1/2010 (A/H5N1) segment 3 (PA) 3330.6 0.000000e+00 2037/2153 (94%)
EPI286514 A/muscovy duck/Thai Binh/07-90/2007 (A/H5N1) segment 3 (PA) 3330.6 0.000000e+00 2037/2153 (94%)
EPI286509 A/muscovy duck/Ha Nam/07-47/2007 (A/H5N1) segment 3 (PA) 3330.6 0.000000e+00 2037/2153 (94%)
EPI286508 A/muscovy duck/Bac Ninh/07-69/2007 (A/H5N1) segment 3 (PA) 3330.6 0.000000e+00 2038/2154 (94%)
EPI285964 A/duck/Nam Dinh/07-91/2007 (A/H5N1) segment 3 (PA) 3330.6 0.000000e+00 2037/2153 (94%)
EPI285962 A/chicken/Thai Binh/07-89/2007 (A/H5N1) segment 3 (PA) 3330.6 0.000000e+00 2037/2153 (94%)
EPI285961 A/duck/Nam Dinh/07-88/2007 (A/H5N1) segment 3 (PA) 3330.6 0.000000e+00 2037/2153 (94%)
EPI285954 A/duck/Ninh Binh/07-68/2007 (A/H5N1) segment 3 (PA) 3330.6 0.000000e+00 2038/2154 (94%)
EPI285951 A/duck/Nam Dinh/07-55/2007 (A/H5N1) segment 3 (PA) 3330.6 0.000000e+00 2037/2153 (94%)
EPI285937 A/avian/Hong Kong/0828/2007 (A/H5N1) segment 3 (PA) 3330.6 0.000000e+00 2037/2153 (94%)
EPI270219 A/Vietnam/UT31244III/2007 (A/H5N1) segment 3 (PA) 3330.6 0.000000e+00 2037/2153 (94%)
EPI270211 A/Vietnam/UT31244II/2007 (A/H5N1) segment 3 (PA) 3330.6 0.000000e+00 2037/2153 (94%)
EPI174699 A/chicken/Hubei/2856/2007 (A/H5N1) segment 3 (PA) 3330.6 0.000000e+00 2037/2153 (94%)
EPI174694 A/duck/Henan/1652/2006 (A/H5N1) segment 3 (PA) 3330.6 0.000000e+00 2038/2154 (94%)
EPI167952 A/long-tailed shrike/Hong Kong/2762/2007 (A/H5N1) segment 3 (PA) 3330.6 0.000000e+00 2023/2132 (94%)
EPI164549 A/duck/Laos/P0050/2007 (A/H5N1) segment 3 (PA) 3330.6 0.000000e+00 2036/2152 (94%)
EPI164541 A/chicken/Laos/P0020/2007 (A/H5N1) segment 3 (PA) 3330.6 0.000000e+00 2036/2152 (94%)
EPI164332 A/goose/Yunnan/5141/2006 (A/H5N1) segment 3 (PA) 3330.6 0.000000e+00 2036/2152 (94%)
EPI164300 A/goose/Yunnan/3798/2006 (A/H5N1) segment 3 (PA) 3330.6 0.000000e+00 2037/2153 (94%)
EPI113106 A/goose/Shantou/18442/2005 (A/H5N1) segment 3 (PA) 3330.6 0.000000e+00 2023/2132 (94%)
EPI351379 A/duck/Vietnam/NCVD-99/2007 (A/H5N1) segment 3 (PA) 3328.8 0.000000e+00 2036/2152 (94%)
EPI350551 A/duck/Vietnam/NCVD-020/2008 (A/H5N1) segment 3 (PA) 3328.8 0.000000e+00 2036/2152 (94%)
EPI280220 A/environment/Guizhou/2/2009 (A/H5N1) segment 3 (PA) 3328.8 0.000000e+00 2035/2152 (94%)
EPI350112 A/chicken/Vietnam/NCVD-295/2009 (A/H5N1) segment 3 (PA) 3325.1 0.000000e+00 2035/2152 (94%)
EPI350028 A/chicken/Vietnam/NCVD-288/2009 (A/H5N1) segment 3 (PA) 3325.1 0.000000e+00 2038/2155 (94%)
EPI349893 A/chicken/Vietnam/NCVD-081/2008 (A/H5N1) segment 3 (PA) 3325.1 0.000000e+00 2035/2152 (94%)
EPI348905 A/duck/Vietnam/NCVD-471/2010 (A/H5N1) segment 3 (PA) 3325.1 0.000000e+00 2036/2153 (94%)
EPI285935 A/avian/Hong Kong/2065/2007 (A/H5N1) segment 3 (PA) 3325.1 0.000000e+00 2036/2153 (94%)
EPI270251 A/Vietnam/UT31412II/2008 (A/H5N1) segment 3 (PA) 3325.1 0.000000e+00 2036/2153 (94%)
EPI222575 A/scaly-breasted munia/Hong Kong/2572/2007 (A/H5N1) segment 3 (PA) 3325.1 0.000000e+00 2036/2153 (94%)
EPI180894 A/duck/Laos/P0137/2007 (A/H5N1) segment 3 (PA) 3325.1 0.000000e+00 2035/2152 (94%)
EPI180838 A/duck/Laos/P0161/2007 (A/H5N1) segment 3 (PA) 3325.1 0.000000e+00 2036/2153 (94%)
EPI168055 A/magpie robin/Hong Kong/1897/2008 (A/H5N1) segment 3 (PA) 3325.1 0.000000e+00 2036/2153 (94%)
EPI168047 A/magpie robin/Hong Kong/1097/2008 (A/H5N1) segment 3 (PA) 3325.1 0.000000e+00 2036/2153 (94%)
EPI167889 A/peregrine falcon/Hong Kong/1143/2007 (A/H5N1) segment 3 (PA) 3325.1 0.000000e+00 2035/2152 (94%)
EPI351386 A/duck/Vietnam/NCVD-98/2007 (A/H5N1) segment 3 (PA) 3323.2 0.000000e+00 2035/2152 (94%)
EPI350698 A/duck/Vietnam/NCVD-107/2007 (A/H5N1) segment 3 (PA) 3323.2 0.000000e+00 2035/2152 (94%)
EPI350565 A/duck/Vietnam/NCVD-022/2008 (A/H5N1) segment 3 (PA) 3323.2 0.000000e+00 2035/2152 (94%)
EPI350119 A/chicken/Vietnam/NCVD-296/2009 (A/H5N1) segment 3 (PA) 3323.2 0.000000e+00 2035/2153 (94%)
EPI349997 A/chicken/Vietnam/NCVD-108/2007 (A/H5N1) segment 3 (PA) 3323.2 0.000000e+00 2035/2152 (94%)
EPI349851 A/chicken/Vietnam/NCVD-035/2008 (A/H5N1) segment 3 (PA) 3323.2 0.000000e+00 2034/2151 (94%)
EPI351468 A/muscovy duck/Vietnam/NCVD-114/2007 (A/H5N1) segment 3 (PA) 3319.5 0.000000e+00 2035/2153 (94%)
EPI350831 A/duck/Vietnam/NCVD-293/2009 (A/H5N1) segment 3 (PA) 3319.5 0.000000e+00 2037/2155 (94%)
EPI337246 A/water/Hebei/2/2009 (A/H5N1) segment 3 (PA) 3319.5 0.000000e+00 2035/2153 (94%)

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Wed Oct 14, 2015 12:01 pm 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
EPI620458 A/chicken/Iowa/14589-1/2015 (A/H5N2) segment 5 (NP) 2760.0 0.000000e+00 1496/1497 (99%)
EPI620451 A/chicken/Iowa/14399-4/2015 (A/H5N2) segment 5 (NP) 2760.0 0.000000e+00 1496/1497 (99%)
EPI620437 A/turkey/Iowa/14319-1/2015 (A/H5N2) segment 5 (NP) 2760.0 0.000000e+00 1496/1497 (99%)
EPI620430 A/turkey/Iowa/14318-1/2015 (A/H5N2) segment 5 (NP) 2760.0 0.000000e+00 1496/1497 (99%)
EPI620423 A/chicken/Iowa/13542-2/2015 (A/H5N2) segment 5 (NP) 2760.0 0.000000e+00 1496/1497 (99%)
EPI620416 A/turkey/Iowa/13541-1/2015 (A/H5N2) segment 5 (NP) 2760.0 0.000000e+00 1496/1497 (99%)
EPI620444 A/chicken/Iowa/14322-6/2015 (A/H5N2) segment 5 (NP) 2754.5 0.000000e+00 1495/1497 (99%)
EPI590741 A/turkey/Minnesota/9845-4/2015 (A/H5N2) segment 5 (NP) 2754.5 0.000000e+00 1495/1497 (99%)
EPI587634 A/chicken/Iowa/04-20/2015 (A/H5N2) segment 5 (NP) 2754.5 0.000000e+00 1495/1497 (99%)
EPI620409 A/turkey/Iowa/11762-1/2015 (A/H5N2) segment 5 (NP) 2748.9 0.000000e+00 1494/1497 (99%)
EPI590720 A/turkey/Missouri/7458-1/2015 (A/H5N2) segment 5 (NP) 2748.9 0.000000e+00 1494/1497 (99%)
EPI590713 A/turkey/Minnesota/7172-1/2015 (A/H5N2) segment 5 (NP) 2748.9 0.000000e+00 1494/1497 (99%)
EPI586543 A/chicken/BC/FAV23/2014 (A/H5N2) segment 5 (NP) 2748.9 0.000000e+00 1494/1497 (99%)
EPI586510 A/poultry/BC/FAV19/2014 (A/H5N2) segment 5 (NP) 2748.9 0.000000e+00 1494/1497 (99%)
EPI584080 A/turkey/BC/FAV14/2014 (A/H5N2) segment 5 (NP) 2748.9 0.000000e+00 1494/1497 (99%)
EPI573299 A/turkey/BC/FAV10/2014 (A/H5N2) segment 5 (NP) 2748.9 0.000000e+00 1494/1497 (99%)
EPI590700 A/chicken/Oregon/A01819044/2015 (A/H5N2) segment 5 (NP) 2743.4 0.000000e+00 1493/1497 (99%)
EPI590686 A/turkey/Minnesota/9892-2/2015 (A/H5N2) segment 5 (NP) 2743.4 0.000000e+00 1493/1497 (99%)
EPI586551 A/chicken/BC/FAV24/2014 (A/H5N2) segment 5 (NP) 2743.4 0.000000e+00 1493/1497 (99%)
EPI586527 A/chicken/BC/FAV21/2014 (A/H5N2) segment 5 (NP) 2743.4 0.000000e+00 1493/1497 (99%)
EPI586519 A/chicken/BC/FAV20/2014 (A/H5N2) segment 5 (NP) 2743.4 0.000000e+00 1493/1497 (99%)
EPI586502 A/poultry/BC/FAV17/2014 (A/H5N2) segment 5 (NP) 2743.4 0.000000e+00 1493/1497 (99%)
EPI576471 A/chicken/BC/FAV8/2014 (A/H5N2) segment 5 (NP) 2743.4 0.000000e+00 1493/1497 (99%)
EPI569384 A/Northern pintail/Washington/40964/2014 (A/H5N2) segment 5 (NP) 2743.4 0.000000e+00 1493/1497 (99%)
EPI569365 A/turkey/Washington/61-22/2014 (A/H5N2) segment 5 (NP) 2743.4 0.000000e+00 1493/1497 (99%)
EPI586559 A/chicken/BC/FAV25/2014 (A/H5N2) segment 5 (NP) 2737.9 0.000000e+00 1492/1497 (99%)
EPI586535 A/chicken/BC/FAV22/2014 (A/H5N2) segment 5 (NP) 2737.9 0.000000e+00 1492/1497 (99%)
EPI586494 A/poultry/BC/FAV15/2014 (A/H5N2) segment 5 (NP) 2737.9 0.000000e+00 1492/1497 (99%)
EPI576478 A/chicken/BC/FAV9/2014 (A/H5N2) segment 5 (NP) 2737.9 0.000000e+00 1492/1497 (99%)
EPI590734 A/chicken/Kansas/8395-3/2015 (A/H5N2) segment 5 (NP) 2732.3 0.000000e+00 1491/1497 (99%)
EPI573277 A/domestic duck/Washington/61-16/2014 (A/H5N2) segment 5 (NP) 2732.3 0.000000e+00 1491/1497 (99%)
EPI573272 A/chicken/Washington/61-9/2014 (A/H5N2) segment 5 (NP) 2732.3 0.000000e+00 1491/1497 (99%)
EPI590727 A/turkey/Arkansas/7791-1/2015 (A/H5N2) segment 5 (NP) 2726.8 0.000000e+00 1490/1497 (99%)
EPI590693 A/chicken/Washington/3490-18/2015 (A/H5N2) segment 5 (NP) 2726.8 0.000000e+00 1490/1497 (99%)
EPI585093 A/pheasant/Washington/3147-2/2015 (A/H5N2) segment 5 (NP) 2726.8 0.000000e+00 1490/1497 (99%)
EPI526421 A/American green-winged teal/Ohio/13OS2086/2013 (A/H6N8) segment 5 (NP) 2671.4 0.000000e+00 1480/1497 (98%)
EPI526348 A/American green-winged teal/Ohio/13OS2084/2013 (A/H6N8) segment 5 (NP) 2671.4 0.000000e+00 1480/1497 (98%)
EPI616371 A/blue-winged teal/Illinois/12OS2929/2012 (A/H3N8) segment 5 (NP) 2665.8 0.000000e+00 1479/1497 (98%)
EPI513134 A/mallard/Wisconsin/11OS4085/2011 (A/H0) segment 5 (NP) 2660.3 0.000000e+00 1478/1497 (98%)
EPI512973 A/blue-winged teal/Wisconsin/11OS3052/2011 (A/H3N2) segment 5 (NP) 2660.3 0.000000e+00 1478/1497 (98%)
EPI512391 A/northern pintail/Illinois/11OS4796/2011 (A/H5N3) segment 5 (NP) 2660.3 0.000000e+00 1478/1497 (98%)
EPI512368 A/northern shoveler/Illinois/11OS4707/2011 (A/H4N6) segment 5 (NP) 2660.3 0.000000e+00 1478/1497 (98%)
EPI616435 A/mallard/Illinois/12OS5130/2012 (A/H1N1) segment 5 (NP) 2654.8 0.000000e+00 1477/1497 (98%)
EPI616391 A/northern shoveler/Illinois/12OS5138/2012 (A/H1N1) segment 5 (NP) 2654.8 0.000000e+00 1477/1497 (98%)
EPI513005 A/northern shoveler/Wisconsin/11OS4110/2011 (A/H4N6) segment 5 (NP) 2654.8 0.000000e+00 1477/1497 (98%)
EPI512353 A/mallard/Illinois/11OS4420/2011 (A/H2N3) segment 5 (NP) 2654.8 0.000000e+00 1477/1497 (98%)
EPI616291 A/blue-winged teal/Ohio/12OS4593/2012 (A/H4N6) segment 5 (NP) 2649.2 0.000000e+00 1476/1497 (98%)
EPI526332 A/American green-winged teal/Ohio/13OS2060/2013 (A/H6N8) segment 5 (NP) 2649.2 0.000000e+00 1476/1497 (98%)
EPI512695 A/mallard/Wisconsin/11OS4309/2011 (A/H4N6) segment 5 (NP) 2649.2 0.000000e+00 1476/1497 (98%)
EPI616346 A/American green-winged teal/Mississippi/12OS5061/2012 (A/H5N2) segment 5 (NP) 2643.7 0.000000e+00 1475/1497 (98%)
EPI512616 A/mallard/Wisconsin/11OS4310/2011 (A/H4N6) segment 5 (NP) 2643.7 0.000000e+00 1475/1497 (98%)
EPI418744 A/wood duck/Wisconsin/10OS2778/2010 (A/H3N8) segment 5 (NP) 2643.7 0.000000e+00 1475/1497 (98%)
EPI418737 A/mallard/Wisconsin/10OS2773/2010 (A/H3N8) segment 5 (NP) 2643.7 0.000000e+00 1475/1497 (98%)
EPI616351 A/blue-winged teal/Illinois/12OS2986/2012 (A/H3N8) segment 5 (NP) 2638.1 0.000000e+00 1474/1497 (98%)
EPI616186 A/blue-winged teal/Ohio/12OS2229/2012 (A/H3N6) segment 5 (NP) 2638.1 0.000000e+00 1474/1497 (98%)
EPI596207 A/mallard/Maryland/13OS3035/2014 (A/H10N7) segment 5 (NP) 2638.1 0.000000e+00 1474/1497 (98%)
EPI585180 A/redhead/Ohio/13OS0406/2013 (A/H7N3) segment 5 (NP) 2638.1 0.000000e+00 1474/1497 (98%)
EPI512928 A/mallard/Illinois/11OS4121/2011 (A/H6N2) segment 5 (NP) 2638.1 0.000000e+00 1474/1497 (98%)
EPI616467 A/mallard/Illinois/12OS5080/2012 (A/H5N1) segment 5 (NP) 2632.6 0.000000e+00 1473/1497 (98%)
EPI512749 A/northern shoveler/Wisconsin/11OS3013/2011 (A/H4N8) segment 5 (NP) 2632.6 0.000000e+00 1473/1497 (98%)
EPI449581 A/green-winged teal/Minnesota/Sg-01000/2008 (A/H3N6) segment 5 (NP) 2632.6 0.000000e+00 1473/1497 (98%)
EPI449553 A/mallard/Minnesota/Sg-00930/2008 (A/H11N9) segment 5 (NP) 2632.6 0.000000e+00 1473/1497 (98%)
EPI419628 A/mallard/Missouri/10MO084/2010 (A/H5N9) segment 5 (NP) 2632.6 0.000000e+00 1473/1497 (98%)
EPI594842 A/mallard/Maryland/13OS3019/2014 (A/H0) segment 5 (NP) 2627.1 0.000000e+00 1472/1497 (98%)
EPI475450 A/northern shoveler/Minnesota/Sg-00655/2008 (A/H1N1) segment 5 (NP) 2627.1 0.000000e+00 1472/1497 (98%)
EPI468600 A/northern shoveler/Minnesota/Sg-00651/2008 (A/H1N1) segment 5 (NP) 2627.1 0.000000e+00 1472/1497 (98%)
EPI450064 A/red-necked grebe/Minnesota/AI10-2528/2010 (A/H4N8) segment 5 (NP) 2627.1 0.000000e+00 1472/1497 (98%)
EPI449397 A/northern shoveler/Minnesota/Sg-00665/2008 (A/H0) segment 5 (NP) 2627.1 0.000000e+00 1472/1497 (98%)
EPI448589 A/mallard/Minnesota/Sg-00620/2008 (A/H1N1) segment 5 (NP) 2627.1 0.000000e+00 1472/1497 (98%)
EPI419491 A/northern shoverl/Mississippi/11OS145/2011 (A/H7N9) segment 5 (NP) 2627.1 0.000000e+00 1472/1497 (98%)
EPI418903 A/blue-winged teal/Wisconsin/10OS2862/2010 (A/H3N2) segment 5 (NP) 2627.1 0.000000e+00 1472/1497 (98%)
EPI334171 A/mallard/Illinois/3974/2009 (A/H5N2) segment 5 (NP) 2627.1 0.000000e+00 1472/1497 (98%)
EPI468579 A/mallard/Minnesota/Sg-00627/2008 (A/H1N1) segment 5 (NP) 2621.5 0.000000e+00 1471/1497 (98%)
EPI468414 A/mallard/Minnesota/Sg-00628/2008 (A/H1N1) segment 5 (NP) 2621.5 0.000000e+00 1471/1497 (98%)
EPI433780 A/blue-winged teal/Nova Scotia/00067/2010 (A/H0) segment 5 (NP) 2621.5 0.000000e+00 1471/1497 (98%)
EPI419506 A/American green-winged teal/Mississippi/11OS247/2011 (A/H0) segment 5 (NP) 2621.5 0.000000e+00 1471/1497 (98%)
EPI334289 A/blue-winged teal/Wisconsin/2753/2009 (A/H4N6) segment 5 (NP) 2621.5 0.000000e+00 1471/1497 (98%)
EPI328603 A/northern shoveler/California/9079/2008 (A/H4N4) segment 5 (NP) 2621.5 0.000000e+00 1471/1497 (98%)
EPI328067 A/northern shoveler/California/10024/2008 (A/H4N4) segment 5 (NP) 2621.5 0.000000e+00 1471/1497 (98%)
EPI616200 A/blue-winged teal/Ohio/12OS2244/2012 (A/H4N6) segment 5 (NP) 2616.0 0.000000e+00 1470/1497 (98%)
EPI595979 A/American black duck/Maryland/11OS3978/2012 (A/H2N1) segment 5 (NP) 2616.0 0.000000e+00 1470/1497 (98%)
EPI595972 A/American black duck/Maryland/11OS3898/2012 (A/H2N1) segment 5 (NP) 2616.0 0.000000e+00 1470/1497 (98%)
EPI595958 A/mallard/Maryland/11OS3829/2012 (A/H2N2) segment 5 (NP) 2616.0 0.000000e+00 1470/1497 (98%)
EPI449387 A/mallard/Minnesota/Sg-0617/2008 (A/H1N1) segment 5 (NP) 2616.0 0.000000e+00 1470/1497 (98%)
EPI419169 A/mallard/Wisconsin/10OS3866/2010 (A/H3N6) segment 5 (NP) 2616.0 0.000000e+00 1470/1497 (98%)
EPI616227 A/blue-winged teal/Ohio/12OS2123/2012 (A/H3N2) segment 5 (NP) 2610.4 0.000000e+00 1469/1497 (98%)
EPI595965 A/mallard/Maryland/11OS3833/2012 (A/H2N1) segment 5 (NP) 2610.4 0.000000e+00 1469/1497 (98%)
EPI486895 A/mallard/California/3471/2012 (A/H4N6) segment 5 (NP) 2610.4 0.000000e+00 1469/1497 (98%)
EPI328083 A/northern shoveler/California/9267/2008 (A/H4N6) segment 5 (NP) 2610.4 0.000000e+00 1469/1497 (98%)
EPI616113 A/blue-winged teal/Ohio/12OS2154/2012 (A/H3N2) segment 5 (NP) 2604.9 0.000000e+00 1468/1497 (98%)
EPI328091 A/northern shoveler/California/9228/2008 (A/H4N6) segment 5 (NP) 2604.9 0.000000e+00 1468/1497 (98%)
EPI596179 A/mallard/Maryland/12OS565/2012 (A/H2N2) segment 5 (NP) 2599.4 0.000000e+00 1467/1497 (97%)
EPI526489 A/blue-winged teal/Iowa/13OS2338/2013 (A/H4N6) segment 5 (NP) 2599.4 0.000000e+00 1467/1497 (97%)
EPI513149 A/northern shoveler/Wisconsin/11OS4631/2011 (A/H0) segment 5 (NP) 2599.4 0.000000e+00 1467/1497 (97%)
EPI387206 A/mallard/California/3134/2010 (A/H1N1) segment 5 (NP) 2593.8 0.000000e+00 1466/1497 (97%)
EPI342993 A/mallard/Alberta/507/2008 (A/H3N8) segment 5 (NP) 2593.8 0.000000e+00 1466/1497 (97%)
EPI327399 A/ring-necked duck/Ontario/15530/2005 (A/H3N2) segment 5 (NP) 2593.8 0.000000e+00 1466/1497 (97%)
EPI596165 A/environment/Maryland/12OS1510/2012 (A/H3N6) segment 5 (NP) 2588.3 0.000000e+00 1465/1497 (97%)
EPI596144 A/environment/Maryland/12OS1505/2012 (A/H3N6) segment 5 (NP) 2588.3 0.000000e+00 1465/1497 (97%)
EPI596137 A/environment/Maryland/12OS1502/2012 (A/H3N6) segment 5 (NP) 2588.3 0.000000e+00 1465/1497 (97%)
EPI596130 A/environment/Maryland/12OS1501/2012 (A/H3N6) segment 5 (NP) 2588.3 0.000000e+00 1465/1497 (97%)
EPI596119 A/environment/Maryland/12OS1500/2012 (A/H3N6) segment 5 (NP) 2588.3 0.000000e+00 1465/1497 (97%)
EPI596112 A/environment/Maryland/12OS1499/2012 (A/H3N6) segment 5 (NP) 2588.3 0.000000e+00 1465/1497 (97%)
EPI596091 A/environment/Maryland/12OS1487/2012 (A/H3N6) segment 5 (NP) 2588.3 0.000000e+00 1465/1497 (97%)
EPI596084 A/environment/Maryland/12OS1486/2012 (A/H3N6) segment 5 (NP) 2588.3 0.000000e+00 1465/1497 (97%)
EPI596077 A/environment/Maryland/12OS1484/2012 (A/H3N6) segment 5 (NP) 2588.3 0.000000e+00 1465/1497 (97%)
EPI596070 A/environment/Maryland/12OS1482/2012 (A/H3N6) segment 5 (NP) 2588.3 0.000000e+00 1465/1497 (97%)
EPI596063 A/environment/Maryland/12OS1479/2012 (A/H3N6) segment 5 (NP) 2588.3 0.000000e+00 1465/1497 (97%)
EPI596049 A/environment/Maryland/12OS1477/2012 (A/H3N6) segment 5 (NP) 2588.3 0.000000e+00 1465/1497 (97%)
EPI596042 A/environment/Maryland/12OS1476/2012 (A/H3N6) segment 5 (NP) 2588.3 0.000000e+00 1465/1497 (97%)
EPI596035 A/environment/Maryland/12OS1475/2012 (A/H3N6) segment 5 (NP) 2588.3 0.000000e+00 1465/1497 (97%)
EPI596028 A/environment/Maryland/12OS1474/2012 (A/H3N6) segment 5 (NP) 2588.3 0.000000e+00 1465/1497 (97%)
EPI596021 A/environment/Maryland/12OS1473/2012 (A/H3N6) segment 5 (NP) 2588.3 0.000000e+00 1465/1497 (97%)
EPI596014 A/environment/Maryland/12OS1472/2012 (A/H3N6) segment 5 (NP) 2588.3 0.000000e+00 1465/1497 (97%)
EPI596007 A/environment/Maryland/12OS1469/2012 (A/H3N6) segment 5 (NP) 2588.3 0.000000e+00 1465/1497 (97%)
EPI596000 A/environment/Maryland/12OS1467/2012 (A/H3N6) segment 5 (NP) 2588.3 0.000000e+00 1465/1497 (97%)
EPI595993 A/environment/Maryland/12OS1466/2012 (A/H3N6) segment 5 (NP) 2588.3 0.000000e+00 1465/1497 (97%)
EPI595986 A/environment/Maryland/12OS1465/2012 (A/H3N6) segment 5 (NP) 2588.3 0.000000e+00 1465/1497 (97%)
EPI542020 A/Northern shoveler/Alaska/ND0006934/2013 (A/H10N7) segment 5 (NP) 2588.3 0.000000e+00 1465/1497 (97%)
EPI60013 A/american black duck/Ohio/1823/2005 (A/H11N9) segment 5 (NP) 2588.3 0.000000e+00 1465/1497 (97%)
EPI616443 A/blue-winged teal/Illinois/12OS4763/2012 (A/H0) segment 5 (NP) 2582.7 0.000000e+00 1464/1497 (97%)
EPI596158 A/environment/Maryland/12OS1509/2012 (A/H3N6) segment 5 (NP) 2582.7 0.000000e+00 1464/1497 (97%)
EPI596105 A/environment/Maryland/12OS1496/2012 (A/H3N6) segment 5 (NP) 2582.7 0.000000e+00 1464/1497 (97%)
EPI596098 A/environment/Maryland/12OS1495/2012 (A/H3N6) segment 5 (NP) 2582.7 0.000000e+00 1464/1497 (97%)
EPI596056 A/environment/Maryland/12OS1478/2012 (A/H3N6) segment 5 (NP) 2582.7 0.000000e+00 1464/1497 (97%)
EPI419789 A/northern shoveler/California/2815/2011 (A/H5N2) segment 5 (NP) 2577.2 0.000000e+00 1463/1497 (97%)
EPI327691 A/mallard/California/5386/2009 (A/H5N2) segment 5 (NP) 2577.2 0.000000e+00 1463/1497 (97%)
EPI289855 A/mallard/Alaska/44430-088/2008 (A/H1N1) segment 5 (NP) 2577.2 0.000000e+00 1455/1485 (97%)
EPI420190 A/bufflehead/California/3118/2011 (A/H4N8) segment 5 (NP) 2571.7 0.000000e+00 1463/1498 (97%)
EPI418611 A/American green-winged teal/Mississippi/11OS98/2011 (A/H0) segment 5 (NP) 2571.7 0.000000e+00 1462/1497 (97%)
EPI328395 A/mallard/California/5219/2009 (A/H5N2) segment 5 (NP) 2571.7 0.000000e+00 1462/1497 (97%)
EPI327827 A/mallard/California/5212/2009 (A/H5N2) segment 5 (NP) 2571.7 0.000000e+00 1462/1497 (97%)
EPI327819 A/mallard/California/5222/2009 (A/H5N2) segment 5 (NP) 2571.7 0.000000e+00 1462/1497 (97%)
EPI327811 A/mallard/California/5250/2009 (A/H5N2) segment 5 (NP) 2571.7 0.000000e+00 1462/1497 (97%)
EPI327795 A/mallard/California/5276/2009 (A/H5N2) segment 5 (NP) 2571.7 0.000000e+00 1462/1497 (97%)
EPI327779 A/mallard/California/5296/2009 (A/H5N2) segment 5 (NP) 2571.7 0.000000e+00 1462/1497 (97%)
EPI327763 A/mallard/California/5502/2009 (A/H5N2) segment 5 (NP) 2571.7 0.000000e+00 1462/1497 (97%)
EPI327747 A/mallard/California/5174/2009 (A/H5N2) segment 5 (NP) 2571.7 0.000000e+00 1462/1497 (97%)
EPI327715 A/mallard/California/5319/2009 (A/H5N2) segment 5 (NP) 2571.7 0.000000e+00 1462/1497 (97%)
EPI327699 A/mallard/California/5359/2009 (A/H5N2) segment 5 (NP) 2571.7 0.000000e+00 1462/1497 (97%)
EPI327683 A/mallard/California/5491/2009 (A/H5N2) segment 5 (NP) 2571.7 0.000000e+00 1462/1497 (97%)
EPI420033 A/mallard/California/2571V/2011 (A/H0) segment 5 (NP) 2566.1 0.000000e+00 1461/1497 (97%)
EPI420025 A/mallard/California/2571P/2011 (A/H11N2) segment 5 (NP) 2566.1 0.000000e+00 1461/1497 (97%)
EPI387353 A/mallard/California/5197/2009 (A/H5N2) segment 5 (NP) 2566.1 0.000000e+00 1461/1497 (97%)
EPI327675 A/mallard/California/5191/2009 (A/H5N2) segment 5 (NP) 2566.1 0.000000e+00 1461/1497 (97%)
EPI343406 A/mallard/Alberta/221/2006 (A/H12) segment 5 (NP) 2560.6 0.000000e+00 1460/1497 (97%)
EPI343398 A/mallard/Alberta/224/2006 (A/H12N5) segment 5 (NP) 2560.6 0.000000e+00 1460/1497 (97%)
EPI327755 A/mallard/California/5149/2009 (A/H5N2) segment 5 (NP) 2560.6 0.000000e+00 1460/1497 (97%)
EPI296781 A/mallard/Alberta/224/2006 (A/H12N5) segment 5 (NP) 2560.6 0.000000e+00 1460/1497 (97%)
EPI296773 A/mallard/Alberta/221/2006 (A/H12) segment 5 (NP) 2560.6 0.000000e+00 1460/1497 (97%)
EPI542118 A/mallard/Alaska/ND0006301/2013 (A/H3N8) segment 5 (NP) 2555.0 0.000000e+00 1459/1497 (97%)
EPI343306 A/mallard/Alberta/297/2006 (A/H4N6) segment 5 (NP) 2555.0 0.000000e+00 1459/1497 (97%)
EPI486683 A/mallard/California/3070/2012 (A/H11N2) segment 5 (NP) 2538.4 0.000000e+00 1457/1498 (97%)
EPI456387 A/ruddy turnstone/New Jersey/AI09-1211/2009 (A/H1N9) segment 5 (NP) 2538.4 0.000000e+00 1456/1497 (97%)
EPI456359 A/ruddy turnstone/New Jersey/AI09-1082/2009 (A/H1N9) segment 5 (NP) 2532.9 0.000000e+00 1455/1497 (97%)
EPI450089 A/red-necked grebe/Minnesota/AI10-2531/2010 (A/H0) segment 5 (NP) 2532.9 0.000000e+00 1455/1497 (97%)
EPI178791 A/northern shoveler/California/HKWF2031/2008 (A/H7N3) segment 5 (NP) 2532.9 0.000000e+00 1455/1497 (97%)
EPI456486 A/ruddy turnstone/New Jersey/AI09-1381/2009 (A/H1N9) segment 5 (NP) 2527.3 0.000000e+00 1454/1497 (97%)
EPI436056 A/shorebird/Delaware Bay/351/2009 (A/H1N9) segment 5 (NP) 2527.3 0.000000e+00 1454/1497 (97%)
EPI615683 A/duck/Peru-PuV196/2009 (A/H10N2) segment 5 (NP) 2525.5 0.000000e+00 1438/1473 (97%)
EPI456189 A/ruddy turnstone/New Jersey/AI09-618/2009 (A/H1N9) segment 5 (NP) 2521.8 0.000000e+00 1453/1497 (97%)
EPI433751 A/ring-billed gull/Quebec/G192/2010 (A/H1N3) segment 5 (NP) 2488.6 0.000000e+00 1447/1497 (96%)
EPI433744 A/ring-billed gull/Quebec/G139/2010 (A/H1N3) segment 5 (NP) 2488.6 0.000000e+00 1447/1497 (96%)
EPI433737 A/ring-billed gull/Quebec/G068/2010 (A/H1N3) segment 5 (NP) 2488.6 0.000000e+00 1447/1497 (96%)
EPI433730 A/ring-billed gull/Quebec/G066/2010 (A/H1N3) segment 5 (NP) 2488.6 0.000000e+00 1447/1497 (96%)
EPI433696 A/ring-billed gull/Quebec/G018/2010 (A/H1N3) segment 5 (NP) 2488.6 0.000000e+00 1447/1497 (96%)
EPI454918 A/ruddy turnstone/New Jersey/1321394/2005 (A/H3N6) segment 5 (NP) 2460.9 0.000000e+00 1442/1497 (96%)
EPI227473 A/ruddy turnstone/New Jersey/327/2005 (A/H3N6) segment 5 (NP) 2460.9 0.000000e+00 1442/1497 (96%)
EPI59975 A/environment/Delaware/251/2005 (A/H3N6) segment 5 (NP) 2460.9 0.000000e+00 1442/1497 (96%)
EPI343659 A/shorebird/Delaware Bay/117/2005 (A/H0) segment 5 (NP) 2455.3 0.000000e+00 1441/1497 (96%)
EPI343651 A/shorebird/Delaware Bay/140/2005 (A/H3N6) segment 5 (NP) 2455.3 0.000000e+00 1441/1497 (96%)
EPI343643 A/shorebird/Delaware Bay/148/2005 (A/H3N6) segment 5 (NP) 2455.3 0.000000e+00 1441/1497 (96%)
EPI343635 A/shorebird/Delaware Bay/153/2005 (A/H3N6) segment 5 (NP) 2455.3 0.000000e+00 1441/1497 (96%)
EPI343627 A/shorebird/Delaware Bay/161/2005 (A/H3N6) segment 5 (NP) 2455.3 0.000000e+00 1441/1497 (96%)
EPI59823 A/environment/Delaware/245/2005 (A/H3N6) segment 5 (NP) 2455.3 0.000000e+00 1441/1497 (96%)
EPI88487 A/mallard/ALB/196/1996 (A/H10N7) segment 5 (NP) 2438.7 0.000000e+00 1438/1497 (96%)
EPI22413 A/pintail/Alberta/156/97 (A/H3N8) segment 5 (NP) 2438.7 0.000000e+00 1438/1497 (96%)
EPI173542 A/mallard/Ohio/363/2003 (A/H2N1) segment 5 (NP) 2433.2 0.000000e+00 1437/1497 (95%)
EPI236166 A/mallard/Ohio/686/2002 (A/H4N2) segment 5 (NP) 2427.6 0.000000e+00 1436/1497 (95%)
EPI85368 A/mallard/ALB/201/1996 (A/H2N3) segment 5 (NP) 2427.6 0.000000e+00 1436/1497 (95%)
EPI238529 A/mallard/Minnesota/204/1999 (A/H6N8) segment 5 (NP) 2422.1 0.000000e+00 1435/1497 (95%)
EPI238222 A/ruddy turnstone/Delaware/1564/2000 (A/H10N7) segment 5 (NP) 2422.1 0.000000e+00 1435/1497 (95%)
EPI86353 A/mallard/Alberta/209/2003 (A/H10N7) segment 5 (NP) 2422.1 0.000000e+00 1435/1497 (95%)
EPI455058 A/ruddy turnstone/New Jersey/AI00-1143/2000 (A/H10N4) segment 5 (NP) 2416.5 0.000000e+00 1434/1497 (95%)
EPI437689 A/shorebird/Delaware Bay/267/2000 (A/H10N4) segment 5 (NP) 2416.5 0.000000e+00 1434/1497 (95%)
EPI437675 A/shorebird/Delaware Bay/260/2000 (A/H10N4) segment 5 (NP) 2416.5 0.000000e+00 1434/1497 (95%)
EPI402361 A/mallard/Alberta/203/1992 (A/H6N5) segment 5 (NP) 2416.5 0.000000e+00 1434/1497 (95%)
EPI344231 A/blue-winged teal/Alberta/16/1997 (A/H2N9) segment 5 (NP) 2416.5 0.000000e+00 1434/1497 (95%)
EPI238558 A/mallard/Minnesota/271/1999 (A/H4N8) segment 5 (NP) 2416.5 0.000000e+00 1434/1497 (95%)
EPI238247 A/ruddy turnstone/New Jersey/1143/2000 (A/H10N7) segment 5 (NP) 2416.5 0.000000e+00 1434/1497 (95%)
EPI238238 A/ruddy turnstone/Delaware/722/2000 (A/H10N7) segment 5 (NP) 2416.5 0.000000e+00 1434/1497 (95%)
EPI238216 A/ruddy turnstone/Delaware/1554/2000 (A/H10N7) segment 5 (NP) 2416.5 0.000000e+00 1434/1497 (95%)
EPI159159 A/mallard/MN/269/1999 (A/H4N6) segment 5 (NP) 2416.5 0.000000e+00 1434/1497 (95%)
EPI158407 A/pheasant/NJ/1355/98 (A/H5N2) segment 5 (NP) 2416.5 0.000000e+00 1434/1497 (95%)
EPI156203 A/pheasant/NJ/9804566/1998 (A/H5N2) segment 5 (NP) 2416.5 0.000000e+00 1434/1497 (95%)
EPI88499 A/ruddy turnstone/Delaware/76/2000 (A/H10N4) segment 5 (NP) 2416.5 0.000000e+00 1434/1497 (95%)
EPI86102 A/mallard/ALB/199/1992 (A/H6N5) segment 5 (NP) 2416.5 0.000000e+00 1434/1497 (95%)
EPI85406 A/blue-winged teal/ALB/16/1997 (A/H2N9) segment 5 (NP) 2416.5 0.000000e+00 1434/1497 (95%)
EPI455065 A/red knot/Delaware/AI00-1269/2000 (A/H10N4) segment 5 (NP) 2411.0 0.000000e+00 1433/1497 (95%)
EPI455051 A/ruddy turnstone/Delaware/AI00-1121/2000 (A/H10N5) segment 5 (NP) 2411.0 0.000000e+00 1433/1497 (95%)
EPI437624 A/shorebird/Delaware Bay/102/2000 (A/H10N4) segment 5 (NP) 2411.0 0.000000e+00 1433/1497 (95%)
EPI343692 A/mallard/Alberta/192/2004 (A/H3N1) segment 5 (NP) 2411.0 0.000000e+00 1433/1497 (95%)
EPI238252 A/ruddy turnstone/New Jersey/1185/2000 (A/H10N7) segment 5 (NP) 2411.0 0.000000e+00 1433/1497 (95%)
EPI238193 A/red knot/Delaware/997/2000 (A/H10N7) segment 5 (NP) 2411.0 0.000000e+00 1433/1497 (95%)
EPI238174 A/red knot/Delaware/1269/2000 (A/H10N7) segment 5 (NP) 2411.0 0.000000e+00 1433/1497 (95%)
EPI236161 A/mallard/Ohio/684/2002 (A/H4N6) segment 5 (NP) 2411.0 0.000000e+00 1433/1497 (95%)
EPI169628 A/mallard/MN/327/1999 (A/H4N8) segment 5 (NP) 2411.0 0.000000e+00 1433/1497 (95%)
EPI45684 A/gadwall/Ohio/37/1999 (A/H6N2) segment 5 (NP) 2411.0 0.000000e+00 1433/1497 (95%)
EPI448314 A/mallard/Minnesota/182761/1998 (A/H7N3) segment 5 (NP) 2405.5 0.000000e+00 1432/1497 (95%)
EPI238275 A/ruddy turnstone/New Jersey/993/2000 (A/H10N7) segment 5 (NP) 2405.5 0.000000e+00 1432/1497 (95%)
EPI238186 A/red knot/Delaware/1886/2000 (A/H10N7) segment 5 (NP) 2405.5 0.000000e+00 1432/1497 (95%)
EPI238180 A/red knot/Delaware/1329/2000 (A/H10N7) segment 5 (NP) 2405.5 0.000000e+00 1432/1497 (95%)
EPI44126 A/pintail/Alaska/279/2005 (A/H3N8) segment 5 (NP) 2405.5 0.000000e+00 1432/1497 (95%)
EPI81476 A/mallard/MN/192/99 (A/H4N6) segment 5 (NP) 2401.8 0.000000e+00 1423/1484 (95%)
EPI384827 A/parrot/Guangdong/258/2004 (A/H5N2) segment 5 (NP) 2399.9 0.000000e+00 1431/1497 (95%)
EPI344143 A/mallard/Alberta/167/1998 (A/H3N8) segment 5 (NP) 2399.9 0.000000e+00 1431/1497 (95%)
EPI344135 A/mallard/Alberta/169/1998 (A/H3N8) segment 5 (NP) 2399.9 0.000000e+00 1431/1497 (95%)
EPI263157 A/blue-winged teal/Texas/Sg-00076/2007 (A/H4N6) segment 5 (NP) 2399.9 0.000000e+00 1431/1497 (95%)
EPI158634 A/mallard/MN/259/1999 (A/H3N6) segment 5 (NP) 2399.9 0.000000e+00 1431/1497 (95%)
EPI85814 A/mallard duck/ALB/1151/1979 (A/H6N9) segment 5 (NP) 2399.9 0.000000e+00 1431/1497 (95%)
EPI46238 A/mallard/Alaska/715/2005 (A/H3N8) segment 5 (NP) 2399.9 0.000000e+00 1431/1497 (95%)
EPI369966 A/mallard/Alberta/257/1984 (A/H2N3) segment 5 (NP) 2394.4 0.000000e+00 1430/1497 (95%)
EPI314974 A/pintail/Alaska/315/2005 (A/H3N8) segment 5 (NP) 2394.4 0.000000e+00 1430/1497 (95%)
EPI158610 A/pintail/MN/479/99 (A/H3N6) segment 5 (NP) 2394.4 0.000000e+00 1430/1497 (95%)
EPI87978 A/widgeon/Alberta/284/1977 (A/H7N3) segment 5 (NP) 2394.4 0.000000e+00 1430/1497 (95%)
EPI87961 A/blue-winged teal/ALB/295/1977 (A/H7N3) segment 5 (NP) 2394.4 0.000000e+00 1430/1497 (95%)
EPI616931 A/shorebird/Delaware Bay/2696/1988 (A/H7N3) segment 5 (NP) 2388.8 0.000000e+00 1429/1497 (95%)
EPI510517 A/goose/MB/428/2006 (A/H5N2) segment 5 (NP) 2388.8 0.000000e+00 1429/1497 (95%)
EPI369973 A/pintail/Alberta/22/1997 (A/H2N9) segment 5 (NP) 2388.8 0.000000e+00 1430/1498 (95%)
EPI344658 A/mallard/Alberta/54/1993 (A/H3N9) segment 5 (NP) 2388.8 0.000000e+00 1429/1497 (95%)
EPI238493 A/mallard/Minnesota/168/1999 (A/H4N8) segment 5 (NP) 2388.8 0.000000e+00 1430/1498 (95%)
EPI87990 A/mallard duck/ALB/279/1977 (A/H7N3) segment 5 (NP) 2388.8 0.000000e+00 1429/1497 (95%)
EPI87776 A/mallard/Alberta/30/2001 (A/H4N8) segment 5 (NP) 2388.8 0.000000e+00 1429/1497 (95%)
EPI81490 A/mallard/MN/284/98 (A/H7N3) segment 5 (NP) 2385.1 0.000000e+00 1421/1486 (95%)
EPI442390 A/emperor goose/Alaska/44063-145/2006 (A/H2N1) segment 5 (NP) 2383.3 0.000000e+00 1428/1497 (95%)
EPI442372 A/brant/Alaska/44063-007/2006 (A/H2N1) segment 5 (NP) 2383.3 0.000000e+00 1428/1497 (95%)
EPI344279 A/lesser scaup/Alberta/206/1995 (A/H3N8) segment 5 (NP) 2383.3 0.000000e+00 1428/1497 (95%)
EPI342922 A/pintail/Alberta/207/1999 (A/H0) segment 5 (NP) 2383.3 0.000000e+00 1428/1497 (95%)
EPI299625 A/mallard/Interior Alaska/7MP1643/2007 (A/H0) segment 5 (NP) 2383.3 0.000000e+00 1428/1497 (95%)
EPI296958 A/American widgeon/Interior Alaska/7MP1707/2007 (A/H3N8) segment 5 (NP) 2383.3 0.000000e+00 1428/1497 (95%)
EPI296925 A/northern shoveler/Interior Alaska/7MP1080/2007 (A/H3N8) segment 5 (NP) 2383.3 0.000000e+00 1428/1497 (95%)
EPI296901 A/northern shoveler/Interior Alaska/7MP0944/2007 (A/H3N8) segment 5 (NP) 2383.3 0.000000e+00 1428/1497 (95%)
EPI296853 A/mallard/Interior Alaska/7MP0510/2007 (A/H3N6) segment 5 (NP) 2383.3 0.000000e+00 1428/1497 (95%)
EPI239274 A/chicken/New Jersey/15906-9/1996 (A/H11N1) segment 5 (NP) 2383.3 0.000000e+00 1428/1497 (95%)
EPI238031 A/mallard/Minnesota/166/2000 (A/H5N2) segment 5 (NP) 2383.3 0.000000e+00 1428/1497 (95%)
EPI236595 A/blue-winged teal/Ohio/467/2001 (A/H11N9) segment 5 (NP) 2383.3 0.000000e+00 1428/1497 (95%)
EPI87762 A/pintail/Alberta/207/1999 (A/H4N8) segment 5 (NP) 2383.3 0.000000e+00 1428/1497 (95%)
EPI59329 A/mallard/Ohio/568/1987 (A/H11N9) segment 5 (NP) 2383.3 0.000000e+00 1428/1497 (95%)
EPI59310 A/northern shoveler/Ohio/35/1986 (A/H3N8) segment 5 (NP) 2383.3 0.000000e+00 1428/1497 (95%)
EPI46200 A/mallard/Ohio/264/1986 (A/H3N8) segment 5 (NP) 2383.3 0.000000e+00 1428/1497 (95%)
EPI468259 A/canvasback/Alberta/276/2005 (A/H1N1) segment 5 (NP) 2377.8 0.000000e+00 1427/1497 (95%)
EPI442353 A/emperor goose/Alaska/44063-029/2006 (A/H2N1) segment 5 (NP) 2377.8 0.000000e+00 1427/1497 (95%)
EPI435812 A/canvasback/Alberta/276/2005 (A/H1N1) segment 5 (NP) 2377.8 0.000000e+00 1427/1497 (95%)
EPI327360 A/mallard/British Columbia/18311/2006 (A/H5N2) segment 5 (NP) 2377.8 0.000000e+00 1427/1497 (95%)
EPI299576 A/northern pintail/Interior Alaska/7MP0509/2007 (A/H3N8) segment 5 (NP) 2377.8 0.000000e+00 1427/1497 (95%)
EPI299045 A/northern pintail/Interior Alaska/7MP1822/2007 (A/H3N8) segment 5 (NP) 2377.8 0.000000e+00 1427/1497 (95%)
EPI296893 A/northern shoveler/Interior Alaska/7MP1765/2007 (A/H3N8) segment 5 (NP) 2377.8 0.000000e+00 1427/1497 (95%)
EPI237916 A/blue-winged teal/Texas/108/2000 (A/H10N7) segment 5 (NP) 2377.8 0.000000e+00 1427/1497 (95%)
EPI222186 A/mallard/Interior Alaska/2/2007 (A/H3N8) segment 5 (NP) 2377.8 0.000000e+00 1427/1497 (95%)
EPI221702 A/blue-winged teal/Saskatchewan/22542/2007 (A/H5N2) segment 5 (NP) 2377.8 0.000000e+00 1427/1497 (95%)
EPI165989 A/mallard/MN/1/2000 (A/H5N2) segment 5 (NP) 2377.8 0.000000e+00 1427/1497 (95%)
EPI158809 A/northern shoveler/TX/56/2000 (A/H10N7) segment 5 (NP) 2377.8 0.000000e+00 1427/1497 (95%)
EPI88029 A/pintail duck/ALB/169/1980 (A/H3N8) segment 5 (NP) 2377.8 0.000000e+00 1427/1497 (95%)
EPI59424 A/mallard/Ohio/129/1989 (A/H4N6) segment 5 (NP) 2377.8 0.000000e+00 1427/1497 (95%)
EPI59006 A/mallard/Ohio/686/2002 (A/H4N2) segment 5 (NP) 2377.8 0.000000e+00 1427/1497 (95%)
EPI58987 A/mallard/Ohio/671/2002 (A/H4N6) segment 5 (NP) 2377.8 0.000000e+00 1427/1497 (95%)
EPI58968 A/mallard/Ohio/668/2002 (A/H4N6) segment 5 (NP) 2377.8 0.000000e+00 1427/1497 (95%)
EPI50047 A/mallard/Ohio/102/1986 (A/H11N3) segment 5 (NP) 2377.8 0.000000e+00 1427/1497 (95%)
EPI44048 A/mallard/Ohio/83/1986 (A/H4N6) segment 5 (NP) 2377.8 0.000000e+00 1427/1497 (95%)
EPI44029 A/green-winged teal/Ohio/344/1986 (A/H4N2) segment 5 (NP) 2377.8 0.000000e+00 1427/1497 (95%)
EPI370497 A/chicken/Connecticut/13657/1990 (A/H2N2) segment 5 (NP) 2374.1 0.000000e+00 1425/1495 (95%)
EPI616966 A/mallard/Alberta/699/1981 (A/H7N3) segment 5 (NP) 2372.2 0.000000e+00 1426/1497 (95%)
EPI510549 A/duck/BC/8038/2006 (A/H5N2) segment 5 (NP) 2372.2 0.000000e+00 1426/1497 (95%)
EPI407047 A/wild bird/Korea/8G39/2005 (A/H9N2) segment 5 (NP) 2372.2 0.000000e+00 1426/1497 (95%)
EPI402961 A/mallard/Alberta/125/1999 (A/H11N6) segment 5 (NP) 2372.2 0.000000e+00 1426/1497 (95%)
EPI402954 A/mallard/Alberta/122/1999 (A/H11N9) segment 5 (NP) 2372.2 0.000000e+00 1426/1497 (95%)
EPI402625 A/ruddy turnstone/Delaware Bay/220/1995 (A/H7N9) segment 5 (NP) 2372.2 0.000000e+00 1427/1498 (95%)
EPI343756 A/redhead/Alberta/192/2002 (A/H3N6) segment 5 (NP) 2372.2 0.000000e+00 1426/1497 (95%)
EPI314850 A/mallard/Ohio/42/1989 (A/H10N6) segment 5 (NP) 2372.2 0.000000e+00 1426/1497 (95%)
EPI286115 A/duck/Oregon/459674-3/2006 (A/H5N2) segment 5 (NP) 2372.2 0.000000e+00 1426/1497 (95%)
EPI280865 A/Guinea fowl/Oregon/459674-5/2006 (A/H5N2) segment 5 (NP) 2372.2 0.000000e+00 1426/1497 (95%)
EPI238074 A/mallard/Minnesota/313/2000 (A/H4N6) segment 5 (NP) 2372.2 0.000000e+00 1426/1497 (95%)
EPI225345 A/pintail/Alberta/21/2006 (A/H1N1) segment 5 (NP) 2372.2 0.000000e+00 1426/1497 (95%)
EPI88697 A/mallard/Alberta/125/1999 (A/H11N6) segment 5 (NP) 2372.2 0.000000e+00 1426/1497 (95%)
EPI86687 A/mallard duck/ALB/965/1979 (A/H1N1) segment 5 (NP) 2372.2 0.000000e+00 1426/1497 (95%)
EPI85155 A/pintail/Alberta/293/1977 (A/H2N9) segment 5 (NP) 2372.2 0.000000e+00 1426/1497 (95%)
EPI61011 A/green-winged teal/Ohio/496/1987 (A/H11N9) segment 5 (NP) 2372.2 0.000000e+00 1426/1497 (95%)
EPI59747 A/mallard/Ohio/37/1986 (A/H2N1) segment 5 (NP) 2372.2 0.000000e+00 1426/1497 (95%)
EPI370513 A/guinea fowl/New Jersey/26146/1990 (A/H2N2) segment 5 (NP) 2368.5 0.000000e+00 1424/1495 (95%)
EPI453337 A/mallard/Interior Alaska/9BM9984R0/2009 (A/H4N6) segment 5 (NP) 2366.7 0.000000e+00 1425/1497 (95%)
EPI453145 A/mallard/Interior Alaska/9BM9985R0/2009 (A/H4N6) segment 5 (NP) 2366.7 0.000000e+00 1425/1497 (95%)
EPI453138 A/mallard/Interior Alaska/9BM9983R0/2009 (A/H4N6) segment 5 (NP) 2366.7 0.000000e+00 1425/1497 (95%)
EPI452843 A/northern pintail/Interior Alaska/9BM7934R0/2009 (A/H4N6) segment 5 (NP) 2366.7 0.000000e+00 1425/1497 (95%)
EPI442410 A/northern pintail/Alaska/44161-087/2006 (A/H4N6) segment 5 (NP) 2366.7 0.000000e+00 1425/1497 (95%)
EPI442406 A/lesser snow goose/Alaska/44301-116/2007 (A/H2N3) segment 5 (NP) 2366.7 0.000000e+00 1421/1491 (95%)
EPI437150 A/ruddy turnstone/New Jersey/154/1990 (A/H0) segment 5 (NP) 2366.7 0.000000e+00 1425/1497 (95%)
EPI370855 A/silkie chicken/Pennsylvania/9600897/1996 (A/H2N3) segment 5 (NP) 2366.7 0.000000e+00 1426/1498 (95%)
EPI345209 A/sanderling/Delaware Bay/70/1999 (A/H3N8) segment 5 (NP) 2366.7 0.000000e+00 1425/1497 (95%)
EPI344887 A/mallard/Alberta/782/1986 (A/H3N8) segment 5 (NP) 2366.7 0.000000e+00 1425/1497 (95%)
EPI299534 A/environment/Indiana/08OS2857/2008 (A/H2N3) segment 5 (NP) 2366.7 0.000000e+00 1425/1497 (95%)
EPI288803 A/mallard/Alaska/44244-148/2006 (A/H4N6) segment 5 (NP) 2366.7 0.000000e+00 1425/1497 (95%)
EPI238970 A/mallard/Minnesota/95/1998 (A/H4N2) segment 5 (NP) 2366.7 0.000000e+00 1425/1497 (95%)
EPI222420 A/northern shoveler/Interior Alaska/1/2007 (A/H12N5) segment 5 (NP) 2366.7 0.000000e+00 1425/1497 (95%)
EPI220261 A/bald eagle/Virginia/Sg-00154/2008 (A/H0) segment 5 (NP) 2366.7 0.000000e+00 1425/1497 (95%)
EPI87892 A/pintail duck/Alberta/114/1979 (A/H8N4) segment 5 (NP) 2366.7 0.000000e+00 1425/1497 (95%)
EPI87397 A/mallard duck/ALB/354/1978 (A/H4N2) segment 5 (NP) 2366.7 0.000000e+00 1425/1497 (95%)
EPI85912 A/mallard duck/ALB/289/1982 (A/H6N6) segment 5 (NP) 2366.7 0.000000e+00 1425/1497 (95%)
EPI85893 A/blue-winged teal/ALB/266/1982 (A/H6N6) segment 5 (NP) 2366.7 0.000000e+00 1425/1497 (95%)
EPI85874 A/widgeon/ALB/256/1982 (A/H6N6) segment 5 (NP) 2366.7 0.000000e+00 1425/1497 (95%)
EPI85795 A/mallard duck/ALB/676/1979 (A/H3N6) segment 5 (NP) 2366.7 0.000000e+00 1425/1497 (95%)
EPI85695 A/mallard duck/ALB/1270/1979 (A/H6N5) segment 5 (NP) 2366.7 0.000000e+00 1425/1497 (95%)
EPI58949 A/mallard/Ohio/666/2002 (A/H6N2) segment 5 (NP) 2366.7 0.000000e+00 1425/1497 (95%)
EPI52093 A/green-winged teal/Ohio/175/1986 (A/H2N1) segment 5 (NP) 2366.7 0.000000e+00 1425/1497 (95%)
EPI49302 A/mallard/Ohio/324/1988 (A/H4N6) segment 5 (NP) 2366.7 0.000000e+00 1425/1497 (95%)
EPI49283 A/mallard/Ohio/30/1986 (A/H2N1) segment 5 (NP) 2366.7 0.000000e+00 1425/1497 (95%)
EPI44069 A/mallard/Ohio/249/1998 (A/H6N1) segment 5 (NP) 2366.7 0.000000e+00 1425/1497 (95%)
EPI42727 A/black duck/New York/184/1988 (A/H5N2) segment 5 (NP) 2366.7 0.000000e+00 1425/1497 (95%)
EPI21981 A/mallard/Alberta/111/99 (A/H4N6) segment 5 (NP) 2366.7 0.000000e+00 1425/1497 (95%)
EPI616943 A/blue-winged teal/Alberta/221/1978 (A/H3N8) segment 5 (NP) 2361.1 0.000000e+00 1424/1497 (95%)
EPI616924 A/ruddy turnstone/New Jersey/65/1985 (A/H7N3) segment 5 (NP) 2361.1 0.000000e+00 1424/1497 (95%)
EPI475399 A/pintail/Alberta/68/2005 (A/H1N1) segment 5 (NP) 2361.1 0.000000e+00 1424/1497 (95%)
EPI453309 A/northern pintail/Interior Alaska/9BM6039R0/2009 (A/H4N6) segment 5 (NP) 2361.1 0.000000e+00 1424/1497 (95%)
EPI453238 A/mallard/Interior Alaska/9BM10375R0/2009 (A/H4N6) segment 5 (NP) 2361.1 0.000000e+00 1424/1497 (95%)
EPI453231 A/northern pintail/Interior Alaska/9BM7972R0/2009 (A/H4N6) segment 5 (NP) 2361.1 0.000000e+00 1424/1497 (95%)
EPI453203 A/northern pintail/Interior Alaska/9BM6040R0/2009 (A/H4N6) segment 5 (NP) 2361.1 0.000000e+00 1424/1497 (95%)
EPI453152 A/northern pintail/Interior Alaska/9BM9989R0/2009 (A/H4N6) segment 5 (NP) 2361.1 0.000000e+00 1424/1497 (95%)
EPI452942 A/northern pintail/Interior Alaska/9BM10813R0/2009 (A/H4N6) segment 5 (NP) 2361.1 0.000000e+00 1424/1497 (95%)
EPI452907 A/mallard/Interior Alaska/9BM8829R0/2009 (A/H4N6) segment 5 (NP) 2361.1 0.000000e+00 1424/1497 (95%)
EPI452893 A/northern pintail/Interior Alaska/9BM8803R0/2009 (A/H4N6) segment 5 (NP) 2361.1 0.000000e+00 1424/1497 (95%)
EPI452865 A/American green-winged teal/Interior Alaska/9BM8129R0/2009 (A/H4N6) segment 5 (NP) 2361.1 0.000000e+00 1424/1497 (95%)
EPI452829 A/northern pintail/Interior Alaska/9BM7632R0/2009 (A/H4N6) segment 5 (NP) 2361.1 0.000000e+00 1424/1497 (95%)
EPI452780 A/northern pintail/Interior Alaska/9BM11915R0/2009 (A/H4N6) segment 5 (NP) 2361.1 0.000000e+00 1424/1497 (95%)
EPI452703 A/mallard/Interior Alaska/9BM11015R0/2009 (A/H4N6) segment 5 (NP) 2361.1 0.000000e+00 1424/1497 (95%)
EPI452612 A/northern pintail/Interior Alaska/9BM7232R0/2009 (A/H4N6) segment 5 (NP) 2361.1 0.000000e+00 1424/1497 (95%)
EPI452577 A/mallard/Interior Alaska/9BM6886R0/2009 (A/H4N6) segment 5 (NP) 2361.1 0.000000e+00 1424/1497 (95%)
EPI452549 A/American green-winged teal/Interior Alaska/9BM6258R0/2009 (A/H4N6) segment 5 (NP) 2361.1 0.000000e+00 1424/1497 (95%)
EPI448777 A/mallard/Minnesota/355779/2000 (A/H5N2) segment 5 (NP) 2361.1 0.000000e+00 1424/1497 (95%)
EPI448412 A/mallard/Minnesota/182750/1998 (A/H6N3) segment 5 (NP) 2361.1 0.000000e+00 1424/1497 (95%)
EPI442403 A/emperor goose/Alaska/44045-125/2006 (A/H4N6) segment 5 (NP) 2361.1 0.000000e+00 1424/1497 (95%)
EPI442398 A/emperor goose/Alaska/44297-260/2007 (A/H2N2) segment 5 (NP) 2361.1 0.000000e+00 1420/1491 (95%)
EPI442397 A/emperor goose/Alaska/44297-269/2007 (A/H2N2) segment 5 (NP) 2361.1 0.000000e+00 1424/1497 (95%)
EPI442387 A/emperor goose/Alaska/44063-049/2006 (A/H4N6) segment 5 (NP) 2361.1 0.000000e+00 1424/1497 (95%)
EPI437398 A/mallard/Alberta/294/1987 (A/H0) segment 5 (NP) 2361.1 0.000000e+00 1424/1497 (95%)
EPI437368 A/mallard/Alberta/230/1987 (A/H6N2) segment 5 (NP) 2361.1 0.000000e+00 1424/1497 (95%)
EPI437361 A/mallard/Alberta/197/1987 (A/H6N2) segment 5 (NP) 2361.1 0.000000e+00 1424/1497 (95%)
EPI437347 A/mallard/Alberta/195/1987 (A/H6N2) segment 5 (NP) 2361.1 0.000000e+00 1424/1497 (95%)
EPI437325 A/coot/Alberta/134/1987 (A/H6N2) segment 5 (NP) 2361.1 0.000000e+00 1424/1497 (95%)
EPI437014 A/northern pintail/Interior Alaska/9BM9419R0/2009 (A/H0) segment 5 (NP) 2361.1 0.000000e+00 1424/1497 (95%)
EPI435805 A/mallard/Alberta/257/2005 (A/H1N1) segment 5 (NP) 2361.1 0.000000e+00 1424/1497 (95%)
EPI435798 A/mallard/Alberta/240/2005 (A/H1N1) segment 5 (NP) 2361.1 0.000000e+00 1424/1497 (95%)
EPI435791 A/pintail/Alberta/69/2005 (A/H1N1) segment 5 (NP) 2361.1 0.000000e+00 1424/1497 (95%)
EPI433094 A/American green-winged teal/Interior Alaska/9BM5041R0/2009 (A/H4N6) segment 5 (NP) 2361.1 0.000000e+00 1424/1497 (95%)
EPI433073 A/northern shoveler/Interior Alaska/9BM4905R0/2009 (A/H4N6) segment 5 (NP) 2361.1 0.000000e+00 1424/1497 (95%)
EPI432990 A/northern pintail/Interior Alaska/9BM4660R0/2009 (A/H4N6) segment 5 (NP) 2361.1 0.000000e+00 1424/1497 (95%)
EPI432976 A/northern pintail/Interior Alaska/9BM4641R0/2009 (A/H4N6) segment 5 (NP) 2361.1 0.000000e+00 1424/1497 (95%)
EPI432915 A/northern pintail/Interior Alaska/9BM4347R0/2009 (A/H4N6) segment 5 (NP) 2361.1 0.000000e+00 1424/1497 (95%)
EPI402998 A/mallard/Alberta/64/2000 (A/H11N9) segment 5 (NP) 2361.1 0.000000e+00 1425/1498 (95%)
EPI402288 A/ruddy turnstone/Delaware Bay/255/1991 (A/H6N2) segment 5 (NP) 2361.1 0.000000e+00 1424/1497 (95%)
EPI402117 A/mallard/Alberta/270/1986 (A/H6N2) segment 5 (NP) 2361.1 0.000000e+00 1424/1497 (95%)
EPI345018 A/mallard/Alberta/144/1987 (A/H0) segment 5 (NP) 2361.1 0.000000e+00 1424/1497 (95%)
EPI307533 A/mallard/Ohio/662/2002 (A/H0) segment 5 (NP) 2361.1 0.000000e+00 1424/1497 (95%)
EPI299221 A/northern pintail/Interior Alaska/8BM3736/2008 (A/H12N5) segment 5 (NP) 2361.1 0.000000e+00 1424/1497 (95%)
EPI290517 A/mallard/Washington/44242-144/2006 (A/H4N6) segment 5 (NP) 2361.1 0.000000e+00 1424/1497 (95%)
EPI288813 A/mallard/Alaska/44243-097/2006 (A/H4N6) segment 5 (NP) 2361.1 0.000000e+00 1424/1497 (95%)
EPI286559 A/American widgeon/Washington/466769/2006 (A/H5N2) segment 5 (NP) 2361.1 0.000000e+00 1424/1497 (95%)
EPI286130 A/Canada goose/Colorado/473047-2/2006 (A/H5N2) segment 5 (NP) 2361.1 0.000000e+00 1424/1497 (95%)
EPI280785 A/mallard/Minnesota/464334/2006 (A/H5N2) segment 5 (NP) 2361.1 0.000000e+00 1425/1498 (95%)
EPI238929 A/mallard/Minnesota/29/1998 (A/H6N8) segment 5 (NP) 2361.1 0.000000e+00 1424/1497 (95%)
EPI238119 A/mallard/Minnesota/524/2000 (A/H4N6) segment 5 (NP) 2361.1 0.000000e+00 1424/1497 (95%)
EPI227283 A/mallard/California/GL30/2005 (A/H4N6) segment 5 (NP) 2361.1 0.000000e+00 1424/1497 (95%)
EPI158934 A/turkey/MO/21939/1987 (A/H1N1) segment 5 (NP) 2361.1 0.000000e+00 1424/1497 (95%)
EPI87247 A/canvasback duck/ALB/274/1977 (A/H4N6) segment 5 (NP) 2361.1 0.000000e+00 1424/1497 (95%)
EPI87233 A/mallard duck/Alberta/299/1977 (A/H4N4) segment 5 (NP) 2361.1 0.000000e+00 1424/1497 (95%)
EPI87139 A/mallard duck/ALB/144/1987 (A/H3N2) segment 5 (NP) 2361.1 0.000000e+00 1424/1497 (95%)
EPI86934 A/mallard duck/ALB/127/1977 (A/H1N1) segment 5 (NP) 2361.1 0.000000e+00 1424/1497 (95%)
EPI86765 A/mallard duck/ALB/294/1987 (A/H6N2) segment 5 (NP) 2361.1 0.000000e+00 1424/1497 (95%)
EPI86746 A/coot/ALB/134/1987 (A/H6N2) segment 5 (NP) 2361.1 0.000000e+00 1424/1497 (95%)
EPI85931 A/blue-winged teal/ALB/685/1982 (A/H6N4) segment 5 (NP) 2361.1 0.000000e+00 1424/1497 (95%)
EPI85682 A/pintail duck/ALB/1045/1979 (A/H6N5) segment 5 (NP) 2361.1 0.000000e+00 1424/1497 (95%)
EPI85672 A/pintail duck/ALB/1040/1979 (A/H6N5) segment 5 (NP) 2361.1 0.000000e+00 1424/1497 (95%)
EPI59082 A/mallard/Ohio/653/2002 (A/H6N2) segment 5 (NP) 2361.1 0.000000e+00 1424/1497 (95%)
EPI59044 A/mallard/Maryland/172/2002 (A/H6N2) segment 5 (NP) 2361.1 0.000000e+00 1424/1497 (95%)
EPI50028 A/green-winged teal/Ohio/203/1998 (A/H6N2) segment 5 (NP) 2361.1 0.000000e+00 1424/1497 (95%)
EPI42039 A/mallard duck/Alberta/283/1977 (A/H8N4) segment 5 (NP) 2361.1 0.000000e+00 1424/1497 (95%)
EPI81480 A/mallard/MN/198/99 (A/H4N6) segment 5 (NP) 2359.3 0.000000e+00 1417/1486 (95%)
EPI370505 A/avian/Massachusetts/25756/1990 (A/H2N2) segment 5 (NP) 2357.4 0.000000e+00 1422/1495 (95%)
EPI81478 A/mallard/MN/195/99 (A/H4N6) segment 5 (NP) 2357.4 0.000000e+00 1414/1483 (95%)
EPI617022 A/mallard/Alberta/93/1996 (A/H7N3) segment 5 (NP) 2355.6 0.000000e+00 1423/1497 (95%)
EPI468371 A/pintail/Alberta/69/2005 (A/H1N1) segment 5 (NP) 2355.6 0.000000e+00 1423/1497 (95%)
EPI455122 A/sanderling/New Jersey/1148674/2004 (A/H10N7) segment 5 (NP) 2355.6 0.000000e+00 1423/1497 (95%)
EPI453323 A/northern pintail/Interior Alaska/9BM6095R0/2009 (A/H4N6) segment 5 (NP) 2355.6 0.000000e+00 1423/1497 (95%)
EPI453316 A/northern pintail/Interior Alaska/9BM6094R0/2009 (A/H4N6) segment 5 (NP) 2355.6 0.000000e+00 1423/1497 (95%)
EPI453089 A/northern shoveler/Interior Alaska/9BM12519R0/2009 (A/H4N8) segment 5 (NP) 2355.6 0.000000e+00 1423/1497 (95%)
EPI452822 A/northern pintail/Interior Alaska/9BM7620R0/2009 (A/H4N6) segment 5 (NP) 2355.6 0.000000e+00 1423/1497 (95%)
EPI452794 A/northern pintail/Interior Alaska/9BM12066R1/2009 (A/H3N8) segment 5 (NP) 2355.6 0.000000e+00 1423/1497 (95%)
EPI452759 A/northern pintail/Interior Alaska/9BM11789R0/2009 (A/H3N8) segment 5 (NP) 2355.6 0.000000e+00 1423/1497 (95%)
EPI452745 A/northern pintail/Interior Alaska/9BM11719R1/2009 (A/H4N6) segment 5 (NP) 2355.6 0.000000e+00 1424/1498 (95%)
EPI452738 A/northern pintail/Interior Alaska/9BM11572R0/2009 (A/H3N8) segment 5 (NP) 2355.6 0.000000e+00 1423/1497 (95%)
EPI452668 A/mallard/Interior Alaska/9BM10095R0/2009 (A/H4N6) segment 5 (NP) 2355.6 0.000000e+00 1423/1497 (95%)
EPI448506 A/northern pintail/Texas/828191/2002 (A/H6N1) segment 5 (NP) 2355.6 0.000000e+00 1423/1497 (95%)
EPI437420 A/ruddy turnstone/New Jersey/147/1990 (A/H1N1) segment 5 (NP) 2355.6 0.000000e+00 1423/1497 (95%)
EPI437389 A/pintail/Alberta/267/1987 (A/H6N2) segment 5 (NP) 2355.6 0.000000e+00 1423/1497 (95%)
EPI437382 A/mallard/Alberta/260/1987 (A/H6N2) segment 5 (NP) 2355.6 0.000000e+00 1423/1497 (95%)
EPI437375 A/mallard/Alberta/238/1987 (A/H6N2) segment 5 (NP) 2355.6 0.000000e+00 1423/1497 (95%)
EPI437354 A/mallard/Alberta/196/1987 (A/H6N2) segment 5 (NP) 2355.6 0.000000e+00 1424/1498 (95%)
EPI437340 A/mallard/Alberta/186/1987 (A/H6N2) segment 5 (NP) 2355.6 0.000000e+00 1423/1497 (95%)
EPI437035 A/northern pintail/Interior Alaska/9BM7799R0/2009 (A/H4N7) segment 5 (NP) 2355.6 0.000000e+00 1423/1497 (95%)
EPI436972 A/mallard/Interior Alaska/9BM8935R0/2009 (A/H4N7) segment 5 (NP) 2355.6 0.000000e+00 1423/1497 (95%)
EPI432962 A/northern pintail/Interior Alaska/9BM4583R0/2009 (A/H4N6) segment 5 (NP) 2355.6 0.000000e+00 1423/1497 (95%)
EPI345166 A/mallard/Alberta/38/2001 (A/H4N6) segment 5 (NP) 2355.6 0.000000e+00 1423/1497 (95%)
EPI344863 A/herring gull/New Jersey/159/1990 (A/H3N6) segment 5 (NP) 2355.6 0.000000e+00 1423/1497 (95%)
EPI343788 A/mallard/Alberta/35/2001 (A/H4N6) segment 5 (NP) 2355.6 0.000000e+00 1423/1497 (95%)
EPI327273 A/mallard/Alberta/11393/2005 (A/H1N1) segment 5 (NP) 2355.6 0.000000e+00 1423/1497 (95%)
EPI299213 A/northern pintail/Interior Alaska/8BM3731/2008 (A/H3N8) segment 5 (NP) 2355.6 0.000000e+00 1423/1497 (95%)
EPI298997 A/mallard/Interior Alaska/7MP0747/2007 (A/H1N1) segment 5 (NP) 2355.6 0.000000e+00 1423/1497 (95%)
EPI290533 A/mallard/Washington/44242-271/2006 (A/H4N6) segment 5 (NP) 2355.6 0.000000e+00 1423/1497 (95%)
EPI288814 A/mallard/Alaska/44244-010/2006 (A/H4N6) segment 5 (NP) 2355.6 0.000000e+00 1423/1497 (95%)
EPI286560 A/American widgeon/Oregon/467919/2006 (A/H5N2) segment 5 (NP) 2355.6 0.000000e+00 1423/1497 (95%)
EPI286132 A/Canada goose/Colorado/474037-5/2006 (A/H5N2) segment 5 (NP) 2355.6 0.000000e+00 1423/1497 (95%)
EPI280601 A/white front goose/Alaska/477003/2007 (A/H5N2) segment 5 (NP) 2355.6 0.000000e+00 1423/1497 (95%)
EPI280585 A/tundra swan/Alaska/442960/2006 (A/H5N2) segment 5 (NP) 2355.6 0.000000e+00 1423/1497 (95%)
EPI238093 A/mallard/Minnesota/410/2000 (A/H5N2) segment 5 (NP) 2355.6 0.000000e+00 1423/1497 (95%)
EPI236119 A/mallard/Ohio/648/2002 (A/H6N2) segment 5 (NP) 2355.6 0.000000e+00 1423/1497 (95%)
EPI230683 A/green-winged teal/California/K481/2006 (A/H1N3) segment 5 (NP) 2355.6 0.000000e+00 1423/1497 (95%)
EPI229493 A/ruddy turnstone/New Jersey/110/2004 (A/H10N7) segment 5 (NP) 2355.6 0.000000e+00 1423/1497 (95%)
EPI229485 A/ruddy turnstone/New Jersey/27/2004 (A/H10N7) segment 5 (NP) 2355.6 0.000000e+00 1423/1497 (95%)
EPI227398 A/northern shoveler/North Carolina/6412-050/2005 (A/H7N3) segment 5 (NP) 2355.6 0.000000e+00 1423/1497 (95%)
EPI227391 A/northern shoveler/California/K138/2005 (A/H6N2) segment 5 (NP) 2355.6 0.000000e+00 1423/1497 (95%)
EPI158745 A/ruddy turnstone/NJ/203/2004 (A/H10N7) segment 5 (NP) 2355.6 0.000000e+00 1423/1497 (95%)
EPI158729 A/ruddy turnstone/NJ/350/2004 (A/H10N7) segment 5 (NP) 2355.6 0.000000e+00 1423/1497 (95%)
EPI120381 A/duck/NJ/7717-70/1995 (A/H1N1) segment 5 (NP) 2355.6 0.000000e+00 1423/1497 (95%)
EPI88548 A/shorebird/DE/122/2004 (A/H10N7) segment 5 (NP) 2355.6 0.000000e+00 1423/1497 (95%)
EPI87827 A/mallard duck/ALB/291/1977 (A/H4N1) segment 5 (NP) 2355.6 0.000000e+00 1423/1497 (95%)
EPI87264 A/gadwall duck/ALB/53/1977 (A/H4N6) segment 5 (NP) 2355.6 0.000000e+00 1423/1497 (95%)
EPI86668 A/pintail duck/ALB/238/1979 (A/H1N1) segment 5 (NP) 2355.6 0.000000e+00 1423/1497 (95%)
EPI86611 A/mallard duck/ALB/42/1977 (A/H1N6) segment 5 (NP) 2355.6 0.000000e+00 1423/1497 (95%)
EPI85855 A/pintail duck/ALB/189/1982 (A/H6N6) segment 5 (NP) 2355.6 0.000000e+00 1423/1497 (95%)
EPI85778 A/pintail duck/ALB/628/1979 (A/H6N8) segment 5 (NP) 2355.6 0.000000e+00 1424/1498 (95%)
EPI59063 A/mallard/Ohio/648/2002 (A/H6N2) segment 5 (NP) 2355.6 0.000000e+00 1423/1497 (95%)
EPI617019 A/mallard/Alberta/26/2001 (A/H0) segment 5 (NP) 2350.1 0.000000e+00 1422/1497 (94%)
EPI452921 A/mallard/Interior Alaska/9BM9049R0/2009 (A/H4N6) segment 5 (NP) 2350.1 0.000000e+00 1422/1497 (94%)
EPI452900 A/northern pintail/Interior Alaska/9BM8815R0/2009 (A/H4N6) segment 5 (NP) 2350.1 0.000000e+00 1422/1497 (94%)
EPI452815 A/northern pintail/Interior Alaska/9BM7496R0/2009 (A/H4N6) segment 5 (NP) 2350.1 0.000000e+00 1422/1497 (94%)
EPI452682 A/northern pintail/Interior Alaska/9BM10877R0/2009 (A/H4N6) segment 5 (NP) 2350.1 0.000000e+00 1422/1497 (94%)
EPI448474 A/mallard/Minnesota/346242/2000 (A/H3N6) segment 5 (NP) 2350.1 0.000000e+00 1422/1497 (94%)
EPI442385 A/lesser snow goose/Alaska/44065-144/2006 (A/H2N3) segment 5 (NP) 2350.1 0.000000e+00 1422/1497 (94%)
EPI442357 A/greater white-fronted goose/Alaska/44049-046/2006 (A/H5N2) segment 5 (NP) 2350.1 0.000000e+00 1422/1497 (94%)
EPI437028 A/northern pintail/Interior Alaska/9BM9663R0/2009 (A/H4N6) segment 5 (NP) 2350.1 0.000000e+00 1422/1497 (94%)
EPI432863 A/northern shoveler/Interior Alaska/9BM2943R1/2009 (A/H4N6) segment 5 (NP) 2350.1 0.000000e+00 1422/1497 (94%)
EPI345044 A/pintail/Alberta/128/1987 (A/H3N8) segment 5 (NP) 2350.1 0.000000e+00 1422/1497 (94%)
EPI307950 A/mallard/Maryland/1143/2005 (A/H0) segment 5 (NP) 2350.1 0.000000e+00 1422/1497 (94%)
EPI307631 A/black duck/Ohio/195/1990 (A/H0) segment 5 (NP) 2350.1 0.000000e+00 1422/1497 (94%)
EPI297028 A/northern pintail/Interior Alaska/7MP0692/2007 (A/H1N1) segment 5 (NP) 2350.1 0.000000e+00 1422/1497 (94%)
EPI297013 A/northern pintail/Interior Alaska/7MP0278/2007 (A/H1N1) segment 5 (NP) 2350.1 0.000000e+00 1422/1497 (94%)
EPI292409 A/cinnamon teal/California/44287-234/2007 (A/H11N9) segment 5 (NP) 2350.1 0.000000e+00 1422/1497 (94%)
EPI286140 A/white front goose/Alaska//445210/2006 (A/H5N2) segment 5 (NP) 2350.1 0.000000e+00 1422/1497 (94%)
EPI280529 A/mallard/Idaho/455398-2/2006 (A/H5N2) segment 5 (NP) 2350.1 0.000000e+00 1422/1497 (94%)
EPI236223 A/northern pintail/Texas/184/2002 (A/H6N4) segment 5 (NP) 2350.1 0.000000e+00 1422/1497 (94%)
EPI229477 A/ruddy turnstone/New Jersey/26/2004 (A/H10N7) segment 5 (NP) 2350.1 0.000000e+00 1422/1497 (94%)
EPI227450 A/redhead/Alberta/11817/2005 (A/H4N6) segment 5 (NP) 2350.1 0.000000e+00 1422/1497 (94%)
EPI222372 A/northern pintail/Interior Alaska/1/2007 (A/H1N1) segment 5 (NP) 2350.1 0.000000e+00 1422/1497 (94%)
EPI173534 A/mallard/Ohio/365/2003 (A/H2N1) segment 5 (NP) 2350.1 0.000000e+00 1422/1497 (94%)
EPI158894 A/chicken/NY/11602-12/1998 (A/H3N2) segment 5 (NP) 2350.1 0.000000e+00 1422/1497 (94%)
EPI158626 A/mallard/MN/99/2000 (A/H3N6) segment 5 (NP) 2350.1 0.000000e+00 1422/1497 (94%)
EPI131965 A/mallard/Missouri/209/2006 (A/H11N9) segment 5 (NP) 2350.1 0.000000e+00 1422/1497 (94%)
EPI86999 A/pintail duck/ALB/627/1979 (A/H3N2) segment 5 (NP) 2350.1 0.000000e+00 1422/1497 (94%)
EPI60992 A/mallard/Ohio/173/1990 (A/H11N9) segment 5 (NP) 2350.1 0.000000e+00 1422/1497 (94%)
EPI60146 A/mallard/Maryland/1153/2005 (A/H12N5) segment 5 (NP) 2350.1 0.000000e+00 1422/1497 (94%)
EPI275213 A/thick-billed murre/Alaska/44085-040/2006 (A/H10N3) segment 5 (NP) 2348.2 0.000000e+00 1417/1490 (95%)
EPI442383 A/tundra swan/Alaska/44049-168/2006 (A/H5N2) segment 5 (NP) 2346.4 0.000000e+00 1418/1492 (95%)
EPI49473 A/longtail duck/Maryland/291/2005 (A/H3N8) segment 5 (NP) 2346.4 0.000000e+00 1420/1495 (94%)
EPI616825 A/mallard/Minnesota/AI07-3433/2007 (A/H7N3) segment 5 (NP) 2344.5 0.000000e+00 1421/1497 (94%)
EPI595335 A/mallard/Maryland/06OS194/2006 (A/H10N4) segment 5 (NP) 2344.5 0.000000e+00 1421/1497 (94%)
EPI453330 A/American green-winged teal/Interior Alaska/9BM12714R1/2009 (A/H3N8) segment 5 (NP) 2344.5 0.000000e+00 1421/1497 (94%)
EPI453210 A/northern pintail/Interior Alaska/9BM6145R0/2009 (A/H3N8) segment 5 (NP) 2344.5 0.000000e+00 1421/1497 (94%)
EPI453131 A/northern pintail/Interior Alaska/9BM9975R0/2009 (A/H4N6) segment 5 (NP) 2344.5 0.000000e+00 1421/1497 (94%)
EPI453103 A/northern pintail/Interior Alaska/9BM9447R0/2009 (A/H3N8) segment 5 (NP) 2344.5 0.000000e+00 1421/1497 (94%)
EPI452956 A/northern pintail/Interior Alaska/9BM10835R0/2009 (A/H4N6) segment 5 (NP) 2344.5 0.000000e+00 1421/1497 (94%)
EPI452879 A/mallard/Interior Alaska/9BM8471R0/2009 (A/H4N6) segment 5 (NP) 2344.5 0.000000e+00 1421/1497 (94%)
EPI452626 A/northern pintail/Interior Alaska/9BM7254R0/2009 (A/H3N8) segment 5 (NP) 2344.5 0.000000e+00 1421/1497 (94%)
EPI452619 A/northern pintail/Interior Alaska/9BM7252R0/2009 (A/H3N8) segment 5 (NP) 2344.5 0.000000e+00 1421/1497 (94%)
EPI452535 A/northern pintail/Interior Alaska/9BM6146R0/2009 (A/H3N8) segment 5 (NP) 2344.5 0.000000e+00 1421/1497 (94%)
EPI452528 A/northern pintail/Interior Alaska/9BM6144R0/2009 (A/H3N8) segment 5 (NP) 2344.5 0.000000e+00 1421/1497 (94%)
EPI452409 A/northern pintail/Interior Alaska/9BM7861R0/2009 (A/H10N7) segment 5 (NP) 2344.5 0.000000e+00 1421/1497 (94%)
EPI452215 A/northern pintail/Interior Alaska/9BM7846R0/2009 (A/H10N7) segment 5 (NP) 2344.5 0.000000e+00 1421/1497 (94%)
EPI452208 A/northern pintail/Interior Alaska/9BM7840R0/2009 (A/H10N7) segment 5 (NP) 2344.5 0.000000e+00 1421/1497 (94%)
EPI442388 A/American green-winged teal/Alaska/44419-241/2008 (A/H4N6) segment 5 (NP) 2344.5 0.000000e+00 1421/1497 (94%)
EPI442373 A/American green-winged teal/Alaska/44419-256/2008 (A/H4N6) segment 5 (NP) 2344.5 0.000000e+00 1421/1497 (94%)
EPI437617 A/shorebird/Delaware Bay/180/1999 (A/H10N7) segment 5 (NP) 2344.5 0.000000e+00 1422/1498 (94%)
EPI435239 A/mallard/New Brunswick/00913/2010 (A/H0) segment 5 (NP) 2344.5 0.000000e+00 1421/1497 (94%)
EPI432819 A/mallard/Interior Alaska/9BM8469R0/2009 (A/H0) segment 5 (NP) 2344.5 0.000000e+00 1421/1497 (94%)
EPI432732 A/American green-winged teal/Interior Alaska/9BM5433R0/2009 (A/H0) segment 5 (NP) 2344.5 0.000000e+00 1421/1497 (94%)
EPI407872 A/duck/Alberta/35/1976 (A/H1N1) segment 5 (NP) 2344.5 0.000000e+00 1421/1497 (94%)
EPI404782 A/American black duck/New Brunswick/02729/2007 (A/H4N6) segment 5 (NP) 2344.5 0.000000e+00 1421/1497 (94%)
EPI404575 A/American black duck/Prince Edward Island/02684/2007 (A/H4N6) segment 5 (NP) 2344.5 0.000000e+00 1421/1497 (94%)
EPI404555 A/mallard/Nova Scotia/02335/2007 (A/H4N6) segment 5 (NP) 2344.5 0.000000e+00 1421/1497 (94%)
EPI404541 A/American black duck/Prince Edward Island/02683/2007 (A/H4N6) segment 5 (NP) 2344.5 0.000000e+00 1421/1497 (94%)
EPI404417 A/American black duck/New Brunswick/02375/2007 (A/H4N8) segment 5 (NP) 2344.5 0.000000e+00 1421/1497 (94%)
EPI391999 A/mallard-black duck hybrid/Nova Scotia/02330/2007 (A/H4N6) segment 5 (NP) 2344.5 0.000000e+00 1421/1497 (94%)
EPI370977 A/mallard/Alberta/720/1984 (A/H2N3) segment 5 (NP) 2344.5 0.000000e+00 1421/1497 (94%)

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Wed Oct 14, 2015 12:03 pm 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
EPI620461 A/chicken/Iowa/14589-1/2015 (A/H5N2) segment 8 (NS) 1537.5 0.000000e+00 836/838 (99%)
EPI620447 A/chicken/Iowa/14322-6/2015 (A/H5N2) segment 8 (NS) 1537.5 0.000000e+00 836/838 (99%)
EPI620440 A/turkey/Iowa/14319-1/2015 (A/H5N2) segment 8 (NS) 1537.5 0.000000e+00 836/838 (99%)
EPI620433 A/turkey/Iowa/14318-1/2015 (A/H5N2) segment 8 (NS) 1537.5 0.000000e+00 836/838 (99%)
EPI620426 A/chicken/Iowa/13542-2/2015 (A/H5N2) segment 8 (NS) 1537.5 0.000000e+00 836/838 (99%)
EPI620419 A/turkey/Iowa/13541-1/2015 (A/H5N2) segment 8 (NS) 1537.5 0.000000e+00 836/838 (99%)
EPI620412 A/turkey/Iowa/11762-1/2015 (A/H5N2) segment 8 (NS) 1537.5 0.000000e+00 836/838 (99%)
EPI590689 A/turkey/Minnesota/9892-2/2015 (A/H5N2) segment 8 (NS) 1537.5 0.000000e+00 836/838 (99%)
EPI587637 A/chicken/Iowa/04-20/2015 (A/H5N2) segment 8 (NS) 1537.5 0.000000e+00 836/838 (99%)
EPI620454 A/chicken/Iowa/14399-4/2015 (A/H5N2) segment 8 (NS) 1532.0 0.000000e+00 835/838 (99%)
EPI590744 A/turkey/Minnesota/9845-4/2015 (A/H5N2) segment 8 (NS) 1532.0 0.000000e+00 835/838 (99%)
EPI590737 A/chicken/Kansas/8395-3/2015 (A/H5N2) segment 8 (NS) 1532.0 0.000000e+00 835/838 (99%)
EPI590723 A/turkey/Missouri/7458-1/2015 (A/H5N2) segment 8 (NS) 1532.0 0.000000e+00 835/838 (99%)
EPI590716 A/turkey/Minnesota/7172-1/2015 (A/H5N2) segment 8 (NS) 1532.0 0.000000e+00 835/838 (99%)
EPI569366 A/turkey/Washington/61-22/2014 (A/H5N2) segment 8 (NS) 1532.0 0.000000e+00 835/838 (99%)
EPI586554 A/chicken/BC/FAV24/2014 (A/H5N2) segment 8 (NS) 1526.5 0.000000e+00 834/838 (99%)
EPI586538 A/chicken/BC/FAV22/2014 (A/H5N2) segment 8 (NS) 1526.5 0.000000e+00 834/838 (99%)
EPI586522 A/chicken/BC/FAV20/2014 (A/H5N2) segment 8 (NS) 1526.5 0.000000e+00 834/838 (99%)
EPI586514 A/poultry/BC/FAV19/2014 (A/H5N2) segment 8 (NS) 1526.5 0.000000e+00 834/838 (99%)
EPI585671 A/baikal teal/Korea/2417/2014 (A/H5N8) segment 8 (NS) 1526.5 0.000000e+00 834/838 (99%)
EPI585670 A/baikal teal/Korea/2416/2014 (A/H5N8) segment 8 (NS) 1526.5 0.000000e+00 834/838 (99%)
EPI585669 A/baikal teal/Korea/2414/2014 (A/H5N8) segment 8 (NS) 1526.5 0.000000e+00 834/838 (99%)
EPI585667 A/baikal teal/Korea/2403/2014 (A/H5N8) segment 8 (NS) 1526.5 0.000000e+00 834/838 (99%)
EPI585666 A/baikal teal/Korea/2402/2014 (A/H5N8) segment 8 (NS) 1526.5 0.000000e+00 834/838 (99%)
EPI585664 A/baikal teal/Korea/1458/2014 (A/H5N8) segment 8 (NS) 1526.5 0.000000e+00 834/838 (99%)
EPI585663 A/baikal teal/Korea/1457/2014 (A/H5N8) segment 8 (NS) 1526.5 0.000000e+00 834/838 (99%)
EPI585660 A/baikal teal/Korea/1452/2014 (A/H5N8) segment 8 (NS) 1526.5 0.000000e+00 834/838 (99%)
EPI585657 A/baikal teal/Korea/1447/2014 (A/H5N8) segment 8 (NS) 1526.5 0.000000e+00 834/838 (99%)
EPI585656 A/baikal teal/Korea/1446/2014 (A/H5N8) segment 8 (NS) 1526.5 0.000000e+00 834/838 (99%)
EPI585655 A/baikal teal/Korea/1445/2014 (A/H5N8) segment 8 (NS) 1526.5 0.000000e+00 834/838 (99%)
EPI585653 A/baikal teal/Korea/1437/2014 (A/H5N8) segment 8 (NS) 1526.5 0.000000e+00 834/838 (99%)
EPI585096 A/pheasant/Washington/3147-2/2015 (A/H5N2) segment 8 (NS) 1526.5 0.000000e+00 834/838 (99%)
EPI576474 A/chicken/BC/FAV8/2014 (A/H5N2) segment 8 (NS) 1526.5 0.000000e+00 834/838 (99%)
EPI569394 A/gyrfalcon/Washington/41088-6/2014 (A/H5N8) segment 8 (NS) 1526.5 0.000000e+00 834/838 (99%)
EPI569387 A/Northern pintail/Washington/40964/2014 (A/H5N2) segment 8 (NS) 1526.5 0.000000e+00 834/838 (99%)
EPI569363 A/domestic duck/Washington/61-16/2014 (A/H5N2) segment 8 (NS) 1526.5 0.000000e+00 834/838 (99%)
EPI569361 A/chicken/Washington/61-9/2014 (A/H5N2) segment 8 (NS) 1526.5 0.000000e+00 834/838 (99%)
EPI568703 A/guinea fowl/Oregon/41613-1/2014 (A/H5N8) segment 8 (NS) 1526.5 0.000000e+00 834/838 (99%)
EPI568700 A/chicken/Oregon/41613-2/2014 (A/H5N8) segment 8 (NS) 1526.5 0.000000e+00 834/838 (99%)
EPI561713 A/broiler duck/Korea/H31/2014 (A/H5N8) segment 8 (NS) 1526.5 0.000000e+00 834/838 (99%)
EPI561701 A/spot-billed duck/Korea/H455-42/2014 (A/H5N8) segment 8 (NS) 1526.5 0.000000e+00 834/838 (99%)
EPI561694 A/common teal/Korea/H455-30/2014 (A/H5N8) segment 8 (NS) 1526.5 0.000000e+00 834/838 (99%)
EPI561685 A/tundra swan/Korea/H411/2014 (A/H5N8) segment 8 (NS) 1526.5 0.000000e+00 834/838 (99%)
EPI561678 A/bean goose/Korea/H328/2014 (A/H5N8) segment 8 (NS) 1526.5 0.000000e+00 834/838 (99%)
EPI561671 A/mallard/Korea/H297/2014 (A/H5N8) segment 8 (NS) 1526.5 0.000000e+00 834/838 (99%)
EPI561664 A/Korean native chicken/Korea/H257/2014 (A/H5N8) segment 8 (NS) 1526.5 0.000000e+00 834/838 (99%)
EPI561657 A/breeder chicken/Korea/H250/2014 (A/H5N8) segment 8 (NS) 1526.5 0.000000e+00 834/838 (99%)
EPI561630 A/mallard/Korea/H207/2014 (A/H5N8) segment 8 (NS) 1526.5 0.000000e+00 834/838 (99%)
EPI561623 A/breeder duck/Korea/H200/2014 (A/H5N8) segment 8 (NS) 1526.5 0.000000e+00 834/838 (99%)
EPI561574 A/Baikal teal/Korea/H96/2014 (A/H5N8) segment 8 (NS) 1526.5 0.000000e+00 834/838 (99%)
EPI561560 A/Coot/Korea/H81/2014 (A/H5N8) segment 8 (NS) 1526.5 0.000000e+00 834/838 (99%)
EPI561553 A/Baikal teal/Korea/H80/2014 (A/H5N8) segment 8 (NS) 1526.5 0.000000e+00 834/838 (99%)
EPI561533 A/Baikal teal/Korea/H66/2014 (A/H5N8) segment 8 (NS) 1526.5 0.000000e+00 834/838 (99%)
EPI561519 A/Baikal teal/Korea/H62/2014 (A/H5N8) segment 8 (NS) 1526.5 0.000000e+00 834/838 (99%)
EPI561345 A/Baikal teal/Korea/H41/2014 (A/H5N8) segment 8 (NS) 1526.5 0.000000e+00 834/838 (99%)
EPI561200 A/broiler duck/Korea/H29/2014 (A/H5N8) segment 8 (NS) 1526.5 0.000000e+00 834/838 (99%)
EPI542634 A/mallard/Korea/W452/2014 (A/H5N8) segment 8 (NS) 1526.5 0.000000e+00 834/838 (99%)
EPI509757 A/baikal teal/Korea/Donglim3/2014 (A/H5N8) segment 8 (NS) 1526.5 0.000000e+00 834/838 (99%)
EPI509712 A/broiler duck/Korea/Buan2/2014 (A/H5N8) segment 8 (NS) 1526.5 0.000000e+00 834/838 (99%)
EPI590730 A/turkey/Arkansas/7791-1/2015 (A/H5N2) segment 8 (NS) 1520.9 0.000000e+00 833/838 (99%)
EPI590709 A/chicken/Oregon/A01819044/2015 (A/H5N2) segment 8 (NS) 1520.9 0.000000e+00 833/838 (99%)
EPI587525 A/American wigeon/BC/050-31/2015 (A/H5N8) segment 8 (NS) 1520.9 0.000000e+00 833/838 (99%)
EPI586562 A/chicken/BC/FAV25/2014 (A/H5N2) segment 8 (NS) 1520.9 0.000000e+00 833/838 (99%)
EPI586546 A/chicken/BC/FAV23/2014 (A/H5N2) segment 8 (NS) 1520.9 0.000000e+00 833/838 (99%)
EPI586530 A/chicken/BC/FAV21/2014 (A/H5N2) segment 8 (NS) 1520.9 0.000000e+00 833/838 (99%)
EPI586505 A/poultry/BC/FAV17/2014 (A/H5N2) segment 8 (NS) 1520.9 0.000000e+00 833/838 (99%)
EPI585668 A/baikal teal/Korea/2406/2014 (A/H5N8) segment 8 (NS) 1520.9 0.000000e+00 833/838 (99%)
EPI585665 A/baikal teal/Korea/2399/2014 (A/H5N8) segment 8 (NS) 1520.9 0.000000e+00 833/838 (99%)
EPI585661 A/baikal teal/Korea/1454/2014 (A/H5N8) segment 8 (NS) 1520.9 0.000000e+00 833/838 (99%)
EPI585659 A/baikal teal/Korea/1449/2014 (A/H5N8) segment 8 (NS) 1520.9 0.000000e+00 833/838 (99%)
EPI585658 A/baikal teal/Korea/1448/2014 (A/H5N8) segment 8 (NS) 1520.9 0.000000e+00 833/838 (99%)
EPI585654 A/baikal teal/Korea/1441/2014 (A/H5N8) segment 8 (NS) 1520.9 0.000000e+00 833/838 (99%)
EPI584083 A/turkey/BC/FAV14/2014 (A/H5N2) segment 8 (NS) 1520.9 0.000000e+00 833/838 (99%)
EPI573175 A/Chicken/Netherlands/14015824/2014 (A/H5N8) segment 8 (NS) 1520.9 0.000000e+00 833/838 (99%)
EPI573166 A/chicken/Netherlands/14015766/2014 (A/H5N8) segment 8 (NS) 1520.9 0.000000e+00 833/838 (99%)
EPI561650 A/breeder duck/Korea/H249/2014 (A/H5N8) segment 8 (NS) 1520.9 0.000000e+00 833/838 (99%)
EPI561609 A/broiler duck/Korea/H145/2014 (A/H5N8) segment 8 (NS) 1520.9 0.000000e+00 833/838 (99%)
EPI561602 A/broiler duck/Korea/H133/2014 (A/H5N8) segment 8 (NS) 1520.9 0.000000e+00 833/838 (99%)
EPI561595 A/breeder duck/Korea/H128/2014 (A/H5N8) segment 8 (NS) 1520.9 0.000000e+00 833/838 (99%)
EPI561581 A/breeder chicken/Korea/H122/2014 (A/H5N8) segment 8 (NS) 1520.9 0.000000e+00 833/838 (99%)
EPI561546 A/Baikal teal/Korea/H68/2014 (A/H5N8) segment 8 (NS) 1520.9 0.000000e+00 833/838 (99%)
EPI561364 A/bean goose/Korea/H40/2014 (A/H5N8) segment 8 (NS) 1520.9 0.000000e+00 833/838 (99%)
EPI561357 A/broiler duck/Korea/H48/2014 (A/H5N8) segment 8 (NS) 1520.9 0.000000e+00 833/838 (99%)
EPI561352 A/broiler duck/Korea/H47/2014 (A/H5N8) segment 8 (NS) 1520.9 0.000000e+00 833/838 (99%)
EPI561191 A/waterfowl/Korea/S005/2014 (A/H5N8) segment 8 (NS) 1520.9 0.000000e+00 833/838 (99%)
EPI554604 A/turkey/Germany-NI/R3372/2014 (A/H5N8) segment 8 (NS) 1520.9 0.000000e+00 833/838 (99%)
EPI553471 A/wigeon/Sakha/1/2014 (A/H5N8) segment 8 (NS) 1520.9 0.000000e+00 833/838 (99%)
EPI552750 A/turkey/Germany/AR2485-86-L00899/2014 (A/H5N8) segment 8 (NS) 1520.9 0.000000e+00 833/838 (99%)
EPI548628 A/chicken/Netherlands/14015531/2014 (A/H5N8) segment 8 (NS) 1520.9 0.000000e+00 833/838 (99%)
EPI548428 A/turkey/Germany-MV/R2472/2014 (A/H5N8) segment 8 (NS) 1520.9 0.000000e+00 833/838 (99%)
EPI590696 A/chicken/Washington/3490-18/2015 (A/H5N2) segment 8 (NS) 1515.4 0.000000e+00 832/838 (99%)
EPI588956 A/goose/Taiwan/a015/2015 (A/H5N8) segment 8 (NS) 1515.4 0.000000e+00 832/838 (99%)
EPI586497 A/poultry/BC/FAV15/2014 (A/H5N2) segment 8 (NS) 1515.4 0.000000e+00 832/838 (99%)
EPI585662 A/baikal teal/Korea/1456/2014 (A/H5N8) segment 8 (NS) 1515.4 0.000000e+00 832/838 (99%)
EPI576481 A/chicken/BC/FAV9/2014 (A/H5N2) segment 8 (NS) 1515.4 0.000000e+00 832/838 (99%)
EPI573642 A/crane/Kagoshima/KU13/2014(H5N8) (A/H5N8) segment 8 (NS) 1515.4 0.000000e+00 832/838 (99%)
EPI573302 A/turkey/BC/FAV10/2014 (A/H5N2) segment 8 (NS) 1515.4 0.000000e+00 832/838 (99%)
EPI573183 A/duck/Netherlands/14015898/2014 (A/H5N8) segment 8 (NS) 1515.4 0.000000e+00 832/838 (99%)
EPI561637 A/white-fronted goose/Korea/H231/2014 (A/H5N8) segment 8 (NS) 1515.4 0.000000e+00 832/838 (99%)
EPI561616 A/breeder duck/Korea/H158/2014 (A/H5N8) segment 8 (NS) 1515.4 0.000000e+00 832/838 (99%)
EPI561567 A/Baikal teal/Korea/H84/2014 (A/H5N8) segment 8 (NS) 1515.4 0.000000e+00 832/838 (99%)
EPI561512 A/bean goose/Korea/H53/2014 (A/H5N8) segment 8 (NS) 1515.4 0.000000e+00 832/838 (99%)
EPI558013 A/duck/England/36038/14 (A/H5N8) segment 8 (NS) 1515.4 0.000000e+00 832/838 (99%)
EPI553212 A/crane/Kagoshima/KU1/2014 (A/H5N8) segment 8 (NS) 1515.4 0.000000e+00 832/838 (99%)
EPI547685 A/Chicken/Netherlands/14015526/2014 (A/H5N8) segment 8 (NS) 1515.4 0.000000e+00 832/838 (99%)
EPI547677 A/duck/England/36254/14 (A/H5N8) segment 8 (NS) 1515.4 0.000000e+00 832/838 (99%)
EPI517165 A/Chicken/Kumamoto/1-7/2014 (A/H5N8) segment 8 (NS) 1515.4 0.000000e+00 833/839 (99%)
EPI558006 A/duck/England/36226/14 (A/H5N8) segment 8 (NS) 1511.7 0.000000e+00 831/838 (99%)
EPI588972 A/chicken/Taiwan/a174/2015 (A/H5N3) segment 8 (NS) 1509.8 0.000000e+00 831/838 (99%)
EPI576395 A/MuteSwan/Sweden/SVA-1503130141-SZ543/2015 (A/H5N8) segment 8 (NS) 1509.8 0.000000e+00 831/838 (99%)
EPI576380 A/MuteSwan/Sweden/SVA-U1503110277-SZ502/2015 (A/H5N8) segment 8 (NS) 1509.8 0.000000e+00 831/838 (99%)
EPI561526 A/broiler duck/Korea/H65/2014 (A/H5N8) segment 8 (NS) 1509.8 0.000000e+00 831/838 (99%)
EPI561369 A/broiler duck/Korea/H49/2014 (A/H5N8) segment 8 (NS) 1509.8 0.000000e+00 831/838 (99%)
EPI553366 A/environment/Kagoshima/KU-ngr-H/2014 (A/H5N8) segment 8 (NS) 1509.8 0.000000e+00 831/838 (99%)
EPI548497 A/duck/Chiba/26-372-61/2014 (A/H5N8) segment 8 (NS) 1509.8 0.000000e+00 831/838 (99%)
EPI548489 A/duck/Chiba/26-372-48/2014 (A/H5N8) segment 8 (NS) 1509.8 0.000000e+00 831/838 (99%)
EPI573684 A/mallard duck/Kagoshima/KU116/2015(H5N8) (A/H5N8) segment 8 (NS) 1504.3 0.000000e+00 830/838 (99%)
EPI573668 A/crane/Kagoshima/KU53/2015(H5N8) (A/H5N8) segment 8 (NS) 1504.3 0.000000e+00 830/838 (99%)
EPI573658 A/crane/Kagoshima/KU41/2014(H5N8) (A/H5N8) segment 8 (NS) 1504.3 0.000000e+00 830/838 (99%)
EPI573650 A/crane/Kagoshima/KU21/2014(H5N8) (A/H5N8) segment 8 (NS) 1504.3 0.000000e+00 830/838 (99%)
EPI595145 A/greater white-fronted goose/Korea/K14-374-1/2014 (A/H5N8) segment 8 (NS) 1498.8 0.000000e+00 829/838 (98%)
EPI595132 A/greater white-fronted goose/Korea/K14-371-4/2014 (A/H5N8) segment 8 (NS) 1498.8 0.000000e+00 829/838 (98%)
EPI595123 A/greater white-fronted goose/Korea/K14-369-3/2014 (A/H5N8) segment 8 (NS) 1498.8 0.000000e+00 829/838 (98%)
EPI595115 A/greater white-fronted goose/Korea/K14-367-4/2014 (A/H5N8) segment 8 (NS) 1498.8 0.000000e+00 829/838 (98%)
EPI595106 A/mandarin duck/Korea/K14-367-1/2014 (A/H5N8) segment 8 (NS) 1498.8 0.000000e+00 829/838 (98%)
EPI595098 A/mandarin duck/Korea/K14-366-1/2014 (A/H5N8) segment 8 (NS) 1498.8 0.000000e+00 829/838 (98%)
EPI595078 A/mallard/Korea/N15-99/2015 (A/H5N8) segment 8 (NS) 1498.8 0.000000e+00 829/838 (98%)
EPI585088 A/turkey/California/K1500169-1.2/2015 (A/H5N8) segment 8 (NS) 1498.8 0.000000e+00 829/838 (98%)
EPI573191 A/chicken/Netherlands/14016437/2014 (A/H5N8) segment 8 (NS) 1498.8 0.000000e+00 829/838 (98%)
EPI553347 A/chicken/Miyazaki/7/2014 (A/H5N8) segment 8 (NS) 1498.8 0.000000e+00 829/838 (98%)
EPI542998 A/duck/Beijing/FS01/2013 (A/H5N8) segment 8 (NS) 1498.8 0.000000e+00 827/835 (99%)
EPI573676 A/mallard duck/Kagoshima/KU70/2015(H5N8) (A/H5N8) segment 8 (NS) 1496.9 0.000000e+00 828/837 (98%)
EPI595086 A/mandarin duck/Korea/K14-363-1/2014 (A/H5N8) segment 8 (NS) 1493.2 0.000000e+00 828/838 (98%)
EPI595062 A/common teal/Korea/KU-12/2015 (A/H5N8) segment 8 (NS) 1493.2 0.000000e+00 828/838 (98%)
EPI543014 A/duck/Beijing/CT01/2014 (A/H5N8) segment 8 (NS) 1493.2 0.000000e+00 826/835 (98%)
EPI595137 A/greater white-fronted goose/Korea/K14-372-2/2014 (A/H5N8) segment 8 (NS) 1487.7 0.000000e+00 827/838 (98%)
EPI543006 A/duck/Beijing/FS01/2014 (A/H5N8) segment 8 (NS) 1487.7 0.000000e+00 825/835 (98%)
EPI596305 A/chicken/Netherlands/emc-3/2014 (A/H5N8) segment 8 (NS) 1471.1 0.000000e+00 808/814 (99%)
EPI553183 A/turkey/Italy/14VIR7898-10/2014 (A/H5N8) segment 8 (NS) 1471.1 0.000000e+00 809/816 (99%)
EPI552780 A/chicken/Netherlands/emc-3/2014 (A/H5N8) segment 8 (NS) 1471.1 0.000000e+00 808/814 (99%)
EPI431452 A/duck/Hebei/2/2011 (A/H5N2) segment 8 (NS) 1471.1 0.000000e+00 819/830 (98%)
EPI403396 A/duck/Eastern China/1111/2011 (A/H5N2) segment 8 (NS) 1471.1 0.000000e+00 824/838 (98%)
EPI414242 A/duck/Jiangsu/1-15/2011 (A/H4N2) segment 8 (NS) 1465.5 0.000000e+00 823/838 (98%)
EPI403397 A/goose/Eastern China/1112/2011 (A/H5N2) segment 8 (NS) 1460.0 0.000000e+00 823/839 (98%)
EPI596306 A/eurasian wigeon/Netherlands/1/2014 (A/H5N8) segment 8 (NS) 1450.7 0.000000e+00 795/800 (99%)
EPI552764 A/eurasian wigeon/Netherlands/emc-1/2014 (A/H5N8) segment 8 (NS) 1450.7 0.000000e+00 795/800 (99%)
EPI595070 A/mallard/Korea/KU3-2/2015 (A/H5N8) segment 8 (NS) 1445.2 0.000000e+00 813/838 (97%)
EPI475583 A/wild duck/Shandong/628/2011 (A/H5N1) segment 8 (NS) 1426.7 0.000000e+00 816/838 (97%)
EPI590707 A/eurasian wigeon/Netherlands/1/2015 (A/H5N8) segment 8 (NS) 1423.0 0.000000e+00 786/794 (98%)
EPI585115 A/eurasian wigeon/Netherlands/1/2015 (A/H5N8) segment 8 (NS) 1423.0 0.000000e+00 786/794 (98%)
EPI431460 A/duck/Hebei/3/2011 (A/H5N2) segment 8 (NS) 1417.5 0.000000e+00 811/832 (97%)
EPI399964 A/duck/Jiangsu/m234/2012 (A/H5N2) segment 8 (NS) 1406.4 0.000000e+00 811/836 (97%)
EPI596307 A/eurasian wigeon/Netherlands/2/2014 (A/H5N8) segment 8 (NS) 1382.4 0.000000e+00 764/772 (98%)
EPI552772 A/eurasian wigeon/Netherlands/emc-2/2014 (A/H5N8) segment 8 (NS) 1382.4 0.000000e+00 764/772 (98%)
EPI296628 A/mallard/Sweden/95/2005 (A/H7N7) segment 8 (NS) 1354.7 0.000000e+00 804/839 (95%)
EPI130868 A/duck/Nanchang/1944/1993 (A/H7N4) segment 8 (NS) 1354.7 0.000000e+00 803/838 (95%)
EPI89129 A/duck/Nanchang/1904/1992 (A/H7N1) segment 8 (NS) 1354.7 0.000000e+00 803/838 (95%)
EPI619297 A/mallard/Sweden/1997/2003 (A/H7N7) segment 8 (NS) 1349.2 0.000000e+00 802/838 (95%)
EPI619290 A/mallard/Sweden/1985/2003 (A/H7N7) segment 8 (NS) 1349.2 0.000000e+00 802/838 (95%)
EPI619268 A/mallard/Sweden/2001/2003 (A/H7N7) segment 8 (NS) 1349.2 0.000000e+00 802/838 (95%)
EPI619181 A/mallard/Sweden/124987/2010 (A/H7N7) segment 8 (NS) 1349.2 0.000000e+00 802/838 (95%)
EPI618947 A/mallard/Sweden/223/2002 (A/H10N2) segment 8 (NS) 1349.2 0.000000e+00 803/839 (95%)
EPI618202 A/mallard/Sweden/3269/2003 (A/H7N7) segment 8 (NS) 1349.2 0.000000e+00 802/838 (95%)
EPI618189 A/mallard/Sweden/2051/2003 (A/H7N7) segment 8 (NS) 1349.2 0.000000e+00 802/838 (95%)
EPI618175 A/mallard/Sweden/2027/2003 (A/H7N7) segment 8 (NS) 1349.2 0.000000e+00 802/838 (95%)
EPI618148 A/mallard/Sweden/1978/2003 (A/H7N7) segment 8 (NS) 1349.2 0.000000e+00 802/838 (95%)
EPI618103 A/mallard/Sweden/396/2002 (A/H10N4) segment 8 (NS) 1349.2 0.000000e+00 803/839 (95%)
EPI617112 A/mallard/Sweden/1962/2003 (A/H7N7) segment 8 (NS) 1349.2 0.000000e+00 802/838 (95%)
EPI617100 A/mallard/Sweden/1981/2003 (A/H7N7) segment 8 (NS) 1349.2 0.000000e+00 802/838 (95%)
EPI617087 A/mallard/Sweden/1975/2003 (A/H7N7) segment 8 (NS) 1349.2 0.000000e+00 802/838 (95%)
EPI617073 A/mallard/Sweden/1972/2003 (A/H7N7) segment 8 (NS) 1349.2 0.000000e+00 802/838 (95%)
EPI617044 A/mallard/Sweden/1967/2003 (A/H7N7) segment 8 (NS) 1349.2 0.000000e+00 802/838 (95%)
EPI617032 A/mallard/Sweden/1965/2003 (A/H7N7) segment 8 (NS) 1349.2 0.000000e+00 802/838 (95%)
EPI485927 A/mallard/Sweden/17/2002 (A/H10N4) segment 8 (NS) 1349.2 0.000000e+00 803/839 (95%)
EPI485684 A/mallard/Sweden/64/2003 (A/H7N7) segment 8 (NS) 1349.2 0.000000e+00 802/838 (95%)
EPI377644 A/mallard/Netherlands/14/2001 (A/H2N3) segment 8 (NS) 1349.2 0.000000e+00 803/839 (95%)
EPI251862 A/whitefronted goose/Netherlands/2/1999 (A/H6N2) segment 8 (NS) 1349.2 0.000000e+00 803/839 (95%)
EPI251854 A/whitefronted goose/Netherlands/1/1999 (A/H6N1) segment 8 (NS) 1349.2 0.000000e+00 803/839 (95%)
EPI251704 A/mallard/Sweden/4/2002 (A/H10N2) segment 8 (NS) 1349.2 0.000000e+00 803/839 (95%)
EPI251621 A/greylag goose/Netherlands/4/1999 (A/H6N1) segment 8 (NS) 1349.2 0.000000e+00 803/839 (95%)
EPI182085 A/black-headed gull/Netherlands/1/2005 (A/H6N8) segment 8 (NS) 1349.2 0.000000e+00 803/839 (95%)
EPI105878 A/duck/Primorie/3691/02 (A/H12N2) segment 8 (NS) 1349.2 0.000000e+00 797/830 (96%)
EPI619275 A/mallard/Sweden/2003/2003 (A/H7N7) segment 8 (NS) 1343.6 0.000000e+00 801/838 (95%)
EPI619258 A/mallard/Sweden/7206/2004 (A/H7N7) segment 8 (NS) 1343.6 0.000000e+00 801/838 (95%)
EPI619229 A/mallard/Sweden/3331/2003 (A/H7N7) segment 8 (NS) 1343.6 0.000000e+00 801/838 (95%)
EPI619222 A/mallard/Sweden/3329/2003 (A/H7N7) segment 8 (NS) 1343.6 0.000000e+00 801/838 (95%)
EPI619129 A/mallard/Sweden/7242/2004 (A/H8N4) segment 8 (NS) 1343.6 0.000000e+00 801/838 (95%)
EPI618962 A/mallard/Sweden/737/2002 (A/H10N2) segment 8 (NS) 1343.6 0.000000e+00 802/839 (95%)
EPI618936 A/mallard/Sweden/831/2002 (A/H10N2) segment 8 (NS) 1343.6 0.000000e+00 802/839 (95%)
EPI618161 A/mallard/Sweden/1983/2003 (A/H7N7) segment 8 (NS) 1343.6 0.000000e+00 801/838 (95%)
EPI617058 A/mallard/Sweden/1970/2003 (A/H7N7) segment 8 (NS) 1343.6 0.000000e+00 801/838 (95%)
EPI514909 A/mallard/Sweden/146/2002 (A/H4N6) segment 8 (NS) 1343.6 0.000000e+00 802/839 (95%)
EPI514749 A/mallard/Sweden/4514/2004 (A/H4N6) segment 8 (NS) 1343.6 0.000000e+00 802/839 (95%)
EPI514157 A/mallard/Sweden/58359/2006 (A/H0) segment 8 (NS) 1343.6 0.000000e+00 802/839 (95%)
EPI447398 A/mallard/Italy/3401/2005 (A/H5N1) segment 8 (NS) 1343.6 0.000000e+00 802/839 (95%)
EPI447396 A/mallard/Italy/3401/2005 (A/H5N1) segment 8 (NS) 1343.6 0.000000e+00 802/839 (95%)
EPI327321 A/mallard/Italy/3401/2005 (A/H5N1) segment 8 (NS) 1343.6 0.000000e+00 802/839 (95%)
EPI60376 A/mallard/Italy/3401/2005 (A/H5N1) segment 8 (NS) 1343.6 0.000000e+00 802/839 (95%)
EPI619282 A/mallard/Sweden/2834/2003 (A/H8N4) segment 8 (NS) 1338.1 0.000000e+00 801/839 (95%)
EPI619195 A/mallard/Sweden/3240/2003 (A/H8N4) segment 8 (NS) 1338.1 0.000000e+00 801/839 (95%)
EPI619143 A/mallard/Sweden/8005/2005 (A/H8N4) segment 8 (NS) 1338.1 0.000000e+00 801/839 (95%)
EPI514916 A/mallard/Sweden/274/2002 (A/H4N2) segment 8 (NS) 1338.1 0.000000e+00 801/839 (95%)
EPI514892 A/mallard/Sweden/1616/2002 (A/H4N6) segment 8 (NS) 1338.1 0.000000e+00 801/839 (95%)
EPI514885 A/mallard/Sweden/1544/2002 (A/H4N6) segment 8 (NS) 1338.1 0.000000e+00 801/839 (95%)
EPI514833 A/mallard/Sweden/1705/2002 (A/H4N6) segment 8 (NS) 1338.1 0.000000e+00 801/839 (95%)
EPI514826 A/mallard/Sweden/1677/2002 (A/H4N6) segment 8 (NS) 1338.1 0.000000e+00 801/839 (95%)
EPI514819 A/mallard/Sweden/1665/2002 (A/H4N6) segment 8 (NS) 1338.1 0.000000e+00 801/839 (95%)
EPI514812 A/mallard/Sweden/1656/2002 (A/H4N6) segment 8 (NS) 1338.1 0.000000e+00 801/839 (95%)
EPI514222 A/mallard/Sweden/52484/2006 (A/H4N6) segment 8 (NS) 1338.1 0.000000e+00 801/839 (95%)
EPI485934 A/mallard/Sweden/39/2002 (A/H5N3) segment 8 (NS) 1338.1 0.000000e+00 802/840 (95%)
EPI372420 A/teal/Egypt/01207-NAMRU3/2007 (A/H10N7) segment 8 (NS) 1338.1 0.000000e+00 801/839 (95%)
EPI327035 A/duck/Korea/JS49/2004 (A/H3N2) segment 8 (NS) 1338.1 0.000000e+00 801/839 (95%)
EPI296525 A/mallard/Netherlands/02/2000 (A/H10N7) segment 8 (NS) 1338.1 0.000000e+00 801/839 (95%)
EPI272784 A/mallard/PT/35910-2/2006 (A/H4N6) segment 8 (NS) 1338.1 0.000000e+00 801/839 (95%)
EPI268644 A/wild duck/Shantou/311/2001 (A/H6N9) segment 8 (NS) 1338.1 0.000000e+00 801/839 (95%)
EPI268623 A/mallard/Jiangxi/8341/2004 (A/H6N5) segment 8 (NS) 1338.1 0.000000e+00 801/839 (95%)
EPI268610 A/duck/Shantou/1090/2001 (A/H6N2) segment 8 (NS) 1338.1 0.000000e+00 801/839 (95%)
EPI251804 A/mallard/Sweden/8/2003 (A/H8N4) segment 8 (NS) 1338.1 0.000000e+00 801/839 (95%)
EPI251738 A/mallard/Sweden/50/2002 (A/H3N8) segment 8 (NS) 1338.1 0.000000e+00 801/839 (95%)
EPI238134 A/mallard/Netherlands/02/2000 (A/H10N7) segment 8 (NS) 1338.1 0.000000e+00 801/839 (95%)
EPI224485 A/mallard/Netherlands/2/2005 (A/H5N2) segment 8 (NS) 1338.1 0.000000e+00 801/839 (95%)
EPI174829 A/duck/Denmark/74-68425/2002 (A/H1N3) segment 8 (NS) 1338.1 0.000000e+00 801/839 (95%)
EPI102384 A/duck/Taiwan/WB459/04 (A/H6N5) segment 8 (NS) 1338.1 0.000000e+00 801/839 (95%)
EPI21460 A/mallard/Italy/43/2001 (A/H7N3) segment 8 (NS) 1338.1 0.000000e+00 801/839 (95%)
EPI21458 A/mallard/Italy/33/01 (A/H7N3) segment 8 (NS) 1338.1 0.000000e+00 801/839 (95%)
EPI619188 A/mallard/Sweden/2990/2003 (A/H8N4) segment 8 (NS) 1332.6 0.000000e+00 800/839 (95%)
EPI619136 A/mallard/Sweden/7996/2005 (A/H8N4) segment 8 (NS) 1332.6 0.000000e+00 800/839 (95%)
EPI619014 A/mallard/Sweden/4411/2004 (A/H10N4) segment 8 (NS) 1332.6 0.000000e+00 801/840 (95%)
EPI619002 A/mallard/Sweden/4401/2004 (A/H10N4) segment 8 (NS) 1332.6 0.000000e+00 801/840 (95%)
EPI618978 A/mallard/Sweden/766/2002 (A/H0) segment 8 (NS) 1332.6 0.000000e+00 800/839 (95%)
EPI600903 A/migratory duck/Jiangxi/21248/2009 (A/H10N8) segment 8 (NS) 1332.6 0.000000e+00 800/839 (95%)
EPI514930 A/mallard/Sweden/337/2002 (A/H4N6) segment 8 (NS) 1332.6 0.000000e+00 800/839 (95%)
EPI514923 A/mallard/Sweden/310/2002 (A/H4N6) segment 8 (NS) 1332.6 0.000000e+00 800/839 (95%)
EPI514878 A/mallard/Sweden/1195/2002 (A/H4N2) segment 8 (NS) 1332.6 0.000000e+00 800/839 (95%)
EPI514871 A/mallard/Sweden/1194/2002 (A/H4N6) segment 8 (NS) 1332.6 0.000000e+00 800/839 (95%)
EPI514857 A/mallard/Sweden/814/2002 (A/H4N9) segment 8 (NS) 1332.6 0.000000e+00 800/839 (95%)
EPI485744 A/mallard/Sweden/49/2002 (A/H5N9) segment 8 (NS) 1332.6 0.000000e+00 800/839 (95%)
EPI485572 A/mallard/Sweden/9/2003 (A/H2N5) segment 8 (NS) 1332.6 0.000000e+00 801/840 (95%)
EPI470704 A/wild waterfowl/Hong Kong/MPJ1815/2010 (A/H11N9) segment 8 (NS) 1332.6 0.000000e+00 800/839 (95%)
EPI470665 A/eurasian wigeon/Hong Kong/MPK653/2009 (A/H11N9) segment 8 (NS) 1332.6 0.000000e+00 800/839 (95%)
EPI470656 A/eurasian wigeon/Hong Kong/MPK655/2009 (A/H11N9) segment 8 (NS) 1332.6 0.000000e+00 800/839 (95%)
EPI447410 A/mallard/Italy/3401/2005 (A/H5N1) segment 8 (NS) 1332.6 0.000000e+00 800/839 (95%)
EPI447397 A/mallard/Italy/3401/2005 (A/H5N1) segment 8 (NS) 1332.6 0.000000e+00 800/839 (95%)
EPI377922 A/mallard/Sweden/103/2005 (A/H2N9) segment 8 (NS) 1332.6 0.000000e+00 800/839 (95%)
EPI377840 A/mallard/Sweden/9/2003 (A/H2N7) segment 8 (NS) 1332.6 0.000000e+00 801/840 (95%)
EPI377770 A/mallard/Sweden/30/2002 (A/H2N5) segment 8 (NS) 1332.6 0.000000e+00 801/840 (95%)
EPI377660 A/mallard/Sweden/6/2002 (A/H2N3) segment 8 (NS) 1332.6 0.000000e+00 801/840 (95%)
EPI377572 A/mallard/Sweden/88/2005 (A/H0) segment 8 (NS) 1332.6 0.000000e+00 800/839 (95%)
EPI363531 A/duck/Guizhou/1426/2006 (A/H6N1) segment 8 (NS) 1332.6 0.000000e+00 800/839 (95%)
EPI363523 A/duck/Guizhou/1084/2006 (A/H6N2) segment 8 (NS) 1332.6 0.000000e+00 800/839 (95%)
EPI327037 A/environment/Korea/CSM08/2004 (A/H3N3) segment 8 (NS) 1332.6 0.000000e+00 800/839 (95%)
EPI268622 A/mallard/Jiangxi/8346/2004 (A/H6N5) segment 8 (NS) 1332.6 0.000000e+00 800/839 (95%)
EPI268526 A/mallard/Jiangxi/8264/2004 (A/H6N2) segment 8 (NS) 1332.6 0.000000e+00 800/839 (95%)
EPI268502 A/duck/Hunan/491/2005 (A/H6N2) segment 8 (NS) 1332.6 0.000000e+00 800/839 (95%)
EPI268483 A/mallard/Jiangxi/227/2003 (A/H6N1) segment 8 (NS) 1332.6 0.000000e+00 800/839 (95%)
EPI251773 A/mallard/Sweden/6/2002 (A/H2N3) segment 8 (NS) 1332.6 0.000000e+00 801/840 (95%)
EPI251753 A/mallard/Sweden/55/2002 (A/H11N2) segment 8 (NS) 1332.6 0.000000e+00 800/839 (95%)
EPI243121 A/mallard/Denmark/64650/03 (A/H5N7) segment 8 (NS) 1332.6 0.000000e+00 800/839 (95%)
EPI242039 A/R(duck/Mongolia/54/01-duck/Mongolia/47/01) (A/H5N1) segment 8 (NS) 1332.6 0.000000e+00 800/839 (95%)
EPI236190 A/mallard/Sweden/49/2002 (A/H5N9) segment 8 (NS) 1332.6 0.000000e+00 800/839 (95%)
EPI181965 A/mallard/Netherlands/2/2005 (A/H4N2) segment 8 (NS) 1332.6 0.000000e+00 800/839 (95%)
EPI174815 A/mallard/Denmark/77-64650-G10/2005 (A/H1N1) segment 8 (NS) 1332.6 0.000000e+00 799/838 (95%)
EPI169707 A/duck/Mongolia/867/2002 (A/H7N1) segment 8 (NS) 1332.6 0.000000e+00 800/839 (95%)
EPI169539 A/Mallard/Sweden/S90735/2003 (A/H7N7) segment 8 (NS) 1332.6 0.000000e+00 800/839 (95%)
EPI118262 A/migratory duck/Jiang Xi/8624/2004 (A/H6N2) segment 8 (NS) 1332.6 0.000000e+00 800/839 (95%)
EPI118196 A/migratory duck/Hong Kong/MP206/2004 (A/H5N2) segment 8 (NS) 1332.6 0.000000e+00 800/839 (95%)
EPI25912 A/duck/Korea/S17/03 (A/H6N1) segment 8 (NS) 1332.6 0.000000e+00 800/839 (95%)
EPI619202 A/mallard/Sweden/3244/2003 (A/H8N4) segment 8 (NS) 1327.0 0.000000e+00 799/839 (95%)
EPI619122 A/mallard/Sweden/5389/2005 (A/H8N4) segment 8 (NS) 1327.0 0.000000e+00 798/838 (95%)
EPI618927 A/mallard/Sweden/52057/2006 (A/H0) segment 8 (NS) 1327.0 0.000000e+00 799/839 (95%)
EPI618919 A/mallard/Sweden/51933/2006 (A/H10N9) segment 8 (NS) 1327.0 0.000000e+00 799/839 (95%)
EPI618857 A/mallard/Sweden/5812/2005 (A/H10N9) segment 8 (NS) 1327.0 0.000000e+00 799/839 (95%)
EPI618847 A/mallard/Sweden/8023/2005 (A/H10N4) segment 8 (NS) 1327.0 0.000000e+00 799/839 (95%)
EPI618772 A/mallard/Sweden/52903/2006 (A/H10N9) segment 8 (NS) 1327.0 0.000000e+00 799/839 (95%)
EPI618759 A/mallard/Sweden/52837/2006 (A/H10N9) segment 8 (NS) 1327.0 0.000000e+00 799/839 (95%)
EPI618628 A/mallard/Sweden/343/2002 (A/H12N5) segment 8 (NS) 1327.0 0.000000e+00 799/839 (95%)
EPI618183 A/mallard/Sweden/1337/2002 (A/H7N7) segment 8 (NS) 1327.0 0.000000e+00 799/839 (95%)
EPI618169 A/mallard/Sweden/885/2002 (A/H7N7) segment 8 (NS) 1327.0 0.000000e+00 799/839 (95%)
EPI618082 A/mallard/Sweden/60065/2007 (A/H0) segment 8 (NS) 1327.0 0.000000e+00 799/839 (95%)
EPI618066 A/mallard/Sweden/8004/2005 (A/H10N4) segment 8 (NS) 1327.0 0.000000e+00 799/839 (95%)
EPI618040 A/domestic duck/Republic of Georgia/2/2010 (A/H10N7) segment 8 (NS) 1327.0 0.000000e+00 799/839 (95%)
EPI618026 A/domestic duck/Republic of Georgia/1/2010 (A/H10N7) segment 8 (NS) 1327.0 0.000000e+00 799/839 (95%)
EPI617097 A/mallard/Sweden/1682/2002 (A/H7N7) segment 8 (NS) 1327.0 0.000000e+00 799/839 (95%)
EPI617082 A/mallard/Sweden/1681/2002 (A/H7N7) segment 8 (NS) 1327.0 0.000000e+00 799/839 (95%)
EPI617070 A/mallard/Sweden/1678/2002 (A/H7N7) segment 8 (NS) 1327.0 0.000000e+00 799/839 (95%)
EPI617041 A/mallard/Sweden/1628/2002 (A/H7N7) segment 8 (NS) 1327.0 0.000000e+00 799/839 (95%)
EPI617027 A/mallard/Sweden/1448/2002 (A/H7N7) segment 8 (NS) 1327.0 0.000000e+00 799/839 (95%)
EPI545901 A/mallard/Jiangxi/1-15/2010 (A/H3N2) segment 8 (NS) 1327.0 0.000000e+00 799/839 (95%)
EPI514763 A/mallard/Sweden/5709/2005 (A/H4N2) segment 8 (NS) 1327.0 0.000000e+00 799/839 (95%)
EPI514595 A/mallard/Sweden/50041/2006 (A/H4N6) segment 8 (NS) 1327.0 0.000000e+00 799/839 (95%)
EPI508163 A/Northern shoveler/Korea/SD175/2008 (A/H7N3) segment 8 (NS) 1327.0 0.000000e+00 798/838 (95%)
EPI485850 A/mallard/Sweden/56/2002 (A/H7N7) segment 8 (NS) 1327.0 0.000000e+00 799/839 (95%)
EPI485692 A/mallard/Sweden/85/2002 (A/H7N7) segment 8 (NS) 1327.0 0.000000e+00 799/839 (95%)
EPI485688 A/mallard/Sweden/102/2002 (A/H7N7) segment 8 (NS) 1327.0 0.000000e+00 799/839 (95%)
EPI470698 A/wild duck/Guangdong/520/2001 (A/H1N9) segment 8 (NS) 1327.0 0.000000e+00 799/839 (95%)
EPI470670 A/duck/Guangdong/707/2000 (A/H2N9) segment 8 (NS) 1327.0 0.000000e+00 799/839 (95%)
EPI420071 A/mallard/California/2578V/2011 (A/H0) segment 8 (NS) 1327.0 0.000000e+00 799/839 (95%)
EPI419914 A/mallard/California/2555P/2011 (A/H11N9) segment 8 (NS) 1327.0 0.000000e+00 798/838 (95%)
EPI419907 A/mallard/California/2552V/2011 (A/H4N8) segment 8 (NS) 1327.0 0.000000e+00 799/839 (95%)
EPI387505 A/canvasback/Mongolia/2-69/2007 (A/H10) segment 8 (NS) 1327.0 0.000000e+00 799/839 (95%)
EPI377938 A/mallard/Sweden/5/2005 (A/H2N3) segment 8 (NS) 1327.0 0.000000e+00 798/838 (95%)
EPI377741 A/mallard/Sweden/111/2002 (A/H2N7) segment 8 (NS) 1327.0 0.000000e+00 799/839 (95%)
EPI377736 A/mallard/Sweden/109/2002 (A/H2N7) segment 8 (NS) 1327.0 0.000000e+00 799/839 (95%)
EPI377627 A/mallard/Netherlands/14/2007 (A/H2N2) segment 8 (NS) 1327.0 0.000000e+00 799/839 (95%)
EPI377556 A/mallard/Sweden/6/2003 (A/H2N3) segment 8 (NS) 1327.0 0.000000e+00 798/838 (95%)
EPI371010 A/wild duck/Shantou/992/2000 (A/H2N8) segment 8 (NS) 1327.0 0.000000e+00 799/839 (95%)
EPI363515 A/duck/Guizhou/888/2006 (A/H6N5) segment 8 (NS) 1327.0 0.000000e+00 799/839 (95%)
EPI327045 A/environment/Korea/CSM3/2002 (A/H3N6) segment 8 (NS) 1327.0 0.000000e+00 795/833 (95%)
EPI327036 A/environment/Korea/ESD18/2004 (A/H3N6) segment 8 (NS) 1327.0 0.000000e+00 799/839 (95%)
EPI296604 A/mallard/Netherlands/42/2006 (A/H11N9) segment 8 (NS) 1327.0 0.000000e+00 799/839 (95%)
EPI268642 A/duck/Shantou/2954/2003 (A/H6N8) segment 8 (NS) 1327.0 0.000000e+00 798/838 (95%)
EPI268479 A/duck/Hunan/177/2005 (A/H6N1) segment 8 (NS) 1327.0 0.000000e+00 799/839 (95%)
EPI251746 A/mallard/Sweden/52/2003 (A/H6N2) segment 8 (NS) 1327.0 0.000000e+00 799/839 (95%)
EPI251730 A/mallard/Sweden/48/2002 (A/H11N9) segment 8 (NS) 1327.0 0.000000e+00 798/838 (95%)
EPI236212 A/mallard/Sweden/85/2002 (A/H7N7) segment 8 (NS) 1327.0 0.000000e+00 799/839 (95%)
EPI236196 A/mallard/Sweden/56/2002 (A/H7N7) segment 8 (NS) 1327.0 0.000000e+00 799/839 (95%)
EPI185343 A/wild duck/Germany/WV2555/2006 (A/H3N2) segment 8 (NS) 1327.0 0.000000e+00 799/839 (95%)
EPI182408 A/duck/Primorie/2633/01 (A/H5N3) segment 8 (NS) 1327.0 0.000000e+00 799/839 (95%)
EPI182125 A/mallard/Netherlands/26/2005 (A/H11N2) segment 8 (NS) 1327.0 0.000000e+00 799/839 (95%)
EPI181949 A/mallard/Netherlands/14/2007 (A/H2N2) segment 8 (NS) 1327.0 0.000000e+00 799/839 (95%)
EPI174780 A/duck/Italy/73383/2006 (A/H10N7) segment 8 (NS) 1327.0 0.000000e+00 799/839 (95%)
EPI170823 A/duck/Primorie/2633/01 (A/H5N3) segment 8 (NS) 1327.0 0.000000e+00 799/839 (95%)
EPI169691 A/duck/Mongolia/47/01 (A/H7N1) segment 8 (NS) 1327.0 0.000000e+00 799/839 (95%)
EPI169377 A/mallard/Sweden/S90457/2005 (A/H10N4) segment 8 (NS) 1327.0 0.000000e+00 799/839 (95%)
EPI141392 A/duck/Italy/4609/2003 (A/H7N2) segment 8 (NS) 1327.0 0.000000e+00 800/840 (95%)
EPI118235 A/wild duck/Shantou/1411/2000 (A/H11N3) segment 8 (NS) 1327.0 0.000000e+00 799/839 (95%)
EPI118232 A/wild duck/Shantou/19988/2000 (A/H4N9) segment 8 (NS) 1327.0 0.000000e+00 799/839 (95%)
EPI89051 A/Duck/Nanchang/8-174/2000 (A/H3N6) segment 8 (NS) 1327.0 0.000000e+00 799/839 (95%)
EPI60300 A/turkey/Italy/1010/2003 (A/H7N3) segment 8 (NS) 1327.0 0.000000e+00 799/839 (95%)
EPI23398 A/WDk/ST/988/2000 (A/H4N9) segment 8 (NS) 1327.0 0.000000e+00 799/839 (95%)
EPI23395 A/WDk/ST/1411/2000 (A/H11N3) segment 8 (NS) 1327.0 0.000000e+00 799/839 (95%)
EPI7512 A/Duck/Hong Kong/T37/97 (A/H11N8) segment 8 (NS) 1327.0 0.000000e+00 799/839 (95%)
EPI3503 A/duck/Hokkaido/Vac-3/2007 (A/H5N1) segment 8 (NS) 1327.0 0.000000e+00 799/839 (95%)
EPI1659 A/duck/Hokkaido/Vac-1/04 (A/H5N1) segment 8 (NS) 1327.0 0.000000e+00 799/839 (95%)
EPI649340 A/duck/Zhejiang/D9/2013 (A/H4N6) segment 8 (NS) 1321.5 0.000000e+00 798/839 (95%)
EPI649333 A/duck/Zhejiang/413/2013 (A/H4N6) segment 8 (NS) 1321.5 0.000000e+00 798/839 (95%)
EPI618539 A/mallard/Sweden/101754/2009 (A/H0) segment 8 (NS) 1321.5 0.000000e+00 798/839 (95%)
EPI618521 A/mallard/Sweden/7146/2004 (A/H9N2) segment 8 (NS) 1321.5 0.000000e+00 798/839 (95%)
EPI618134 A/mallard/Sweden/6039/2005 (A/H10N4) segment 8 (NS) 1321.5 0.000000e+00 798/839 (95%)
EPI617998 A/mallard/Republic of Georgia/3/2010 (A/H7N3) segment 8 (NS) 1321.5 0.000000e+00 798/839 (95%)
EPI600934 A/migratory duck/Jiangxi/10974/2005 (A/H10N6) segment 8 (NS) 1321.5 0.000000e+00 798/839 (95%)
EPI600933 A/migratory duck/Jiangxi/9334/2005 (A/H10N6) segment 8 (NS) 1321.5 0.000000e+00 798/839 (95%)
EPI600932 A/migratory duck/Jiangxi/10861/2005 (A/H10N2) segment 8 (NS) 1321.5 0.000000e+00 798/839 (95%)
EPI600803 A/migratory duck/Jiangxi/7231/2003 (A/H10N5) segment 8 (NS) 1321.5 0.000000e+00 798/839 (95%)
EPI596448 A/muscovy duck/Vietnam/LBM201/2012 (A/H3N2) segment 8 (NS) 1321.5 0.000000e+00 798/839 (95%)
EPI588980 A/duck/Taiwan/a068/2015 (A/H5N8) segment 8 (NS) 1321.5 0.000000e+00 797/838 (95%)
EPI584049 A/environment/Kagoshima/KU-ngr-C/2012(H3N8) (A/H3N8) segment 8 (NS) 1321.5 0.000000e+00 797/838 (95%)
EPI574335 A/duck/Vietnam/LBM48/2011 (A/H3N2) segment 8 (NS) 1321.5 0.000000e+00 798/839 (95%)
EPI543893 A/turkey/Italy/9611/2002 (A/H7N3) segment 8 (NS) 1321.5 0.000000e+00 798/839 (95%)
EPI543869 A/turkey/Italy/8303/2002 (A/H7N3) segment 8 (NS) 1321.5 0.000000e+00 798/839 (95%)
EPI543861 A/turkey/Italy/7773/2002 (A/H7N3) segment 8 (NS) 1321.5 0.000000e+00 798/839 (95%)
EPI543805 A/turkey/Italy/17/2003 (A/H7N3) segment 8 (NS) 1321.5 0.000000e+00 798/839 (95%)
EPI533878 A/Caspian seal/Russia/1884/2002 (A/H4N6) segment 8 (NS) 1321.5 0.000000e+00 798/839 (95%)
EPI533802 A/Caspian seal/Russia/T1/2012 (A/H4N6) segment 8 (NS) 1321.5 0.000000e+00 798/839 (95%)
EPI515142 A/muscovy duck/Vietnam/LBM529/2013 (A/H3N8) segment 8 (NS) 1321.5 0.000000e+00 798/839 (95%)
EPI514735 A/mallard/Sweden/3715/2004 (A/H4N6) segment 8 (NS) 1321.5 0.000000e+00 799/840 (95%)
EPI514715 A/mallard/Sweden/5763/2005 (A/H4N6) segment 8 (NS) 1321.5 0.000000e+00 798/839 (95%)
EPI514708 A/mallard/Sweden/5755/2005 (A/H4N6) segment 8 (NS) 1321.5 0.000000e+00 798/839 (95%)
EPI514680 A/mallard/Sweden/5714/2005 (A/H4N6) segment 8 (NS) 1321.5 0.000000e+00 798/839 (95%)
EPI514367 A/mallard/Sweden/52039/2006 (A/H4N6) segment 8 (NS) 1321.5 0.000000e+00 798/839 (95%)
EPI514340 A/mallard/Sweden/52278/2006 (A/H4N6) segment 8 (NS) 1321.5 0.000000e+00 798/839 (95%)
EPI508164 A/mallard/Korea/NHG187/2008 (A/H7N7) segment 8 (NS) 1321.5 0.000000e+00 797/838 (95%)
EPI485844 A/mallard/Sweden/54/2002 (A/H4N6) segment 8 (NS) 1321.5 0.000000e+00 798/839 (95%)
EPI485736 A/mallard/Sweden/64/2002 (A/H5N2) segment 8 (NS) 1321.5 0.000000e+00 798/839 (95%)
EPI485631 A/northern pintail/Sweden/1/2003 (A/H2N3) segment 8 (NS) 1321.5 0.000000e+00 797/838 (95%)
EPI470718 A/wild duck/Jiangxi/10179/2005 (A/H7N3) segment 8 (NS) 1321.5 0.000000e+00 798/839 (95%)
EPI470605 A/goose/Guizhou/829/2012 (A/H10N7) segment 8 (NS) 1321.5 0.000000e+00 798/839 (95%)
EPI461815 A/environment/Hunan/S4350/2011 (A/H3N8) segment 8 (NS) 1321.5 0.000000e+00 798/839 (95%)
EPI451131 A/mallard/Netherlands/10-Nmkt/1999 (A/H0) segment 8 (NS) 1321.5 0.000000e+00 798/839 (95%)
EPI441015 A/muscovy duck/Vietnam/LBM198/2012 (A/H6N2) segment 8 (NS) 1321.5 0.000000e+00 798/839 (95%)
EPI439608 A/avian/Israel/445/2001 (A/H10N7) segment 8 (NS) 1321.5 0.000000e+00 798/839 (95%)
EPI420126 A/mallard/California/2594V/2011 (A/H4N6) segment 8 (NS) 1321.5 0.000000e+00 798/839 (95%)
EPI420119 A/mallard/California/2594P/2011 (A/H4N6) segment 8 (NS) 1321.5 0.000000e+00 798/839 (95%)
EPI419937 A/mallard/California/2555V/2011 (A/H11N9) segment 8 (NS) 1321.5 0.000000e+00 798/839 (95%)
EPI419853 A/mallard/California/2536V/2011 (A/H5N1) segment 8 (NS) 1321.5 0.000000e+00 798/839 (95%)
EPI419840 A/mallard/California/2536P/2011 (A/H5N1) segment 8 (NS) 1321.5 0.000000e+00 798/839 (95%)
EPI419833 A/mallard/California/2535V/2011 (A/H5N1) segment 8 (NS) 1321.5 0.000000e+00 798/839 (95%)
EPI419826 A/mallard/California/2535P/2011 (A/H5N1) segment 8 (NS) 1321.5 0.000000e+00 798/839 (95%)
EPI419784 A/mallard/California/2527V/2011 (A/H5N1) segment 8 (NS) 1321.5 0.000000e+00 798/839 (95%)
EPI418310 A/muscovy duck/Vietnam/LBM189/2012 (A/H3N2) segment 8 (NS) 1321.5 0.000000e+00 798/839 (95%)
EPI401798 A/canvasback/Xianghai/428/2011 (A/H5N2) segment 8 (NS) 1321.5 0.000000e+00 798/839 (95%)
EPI378014 A/mallard/Netherlands/12/2008 (A/H2N3) segment 8 (NS) 1321.5 0.000000e+00 798/839 (95%)
EPI377849 A/mallard/Sweden/53/2003 (A/H2N3) segment 8 (NS) 1321.5 0.000000e+00 798/839 (95%)
EPI377832 A/mallard/Sweden/84/2003 (A/H2N3) segment 8 (NS) 1321.5 0.000000e+00 797/838 (95%)
EPI377825 A/mallard/Sweden/81/2003 (A/H2N3) segment 8 (NS) 1321.5 0.000000e+00 797/838 (95%)
EPI377801 A/mallard/Sweden/70/2002 (A/H2N3) segment 8 (NS) 1321.5 0.000000e+00 798/839 (95%)
EPI377785 A/mallard/Sweden/33/2002 (A/H2N3) segment 8 (NS) 1321.5 0.000000e+00 798/839 (95%)
EPI377777 A/mallard/Sweden/32/2002 (A/H2N3) segment 8 (NS) 1321.5 0.000000e+00 798/839 (95%)
EPI377761 A/mallard/Sweden/113/2002 (A/H2N1) segment 8 (NS) 1321.5 0.000000e+00 798/839 (95%)
EPI377749 A/mallard/Sweden/112/2002 (A/H2N7) segment 8 (NS) 1321.5 0.000000e+00 798/839 (95%)
EPI377676 A/mallard/Sweden/99/2002 (A/H2N3) segment 8 (NS) 1321.5 0.000000e+00 799/840 (95%)
EPI372522 A/teal/Egypt/00677-NAMRU3/2004 (A/H1N1) segment 8 (NS) 1321.5 0.000000e+00 798/839 (95%)
EPI372452 A/shoveler/Egypt/01574-NAMRU3/2007 (A/H10N4) segment 8 (NS) 1321.5 0.000000e+00 798/839 (95%)
EPI372444 A/shoveler/Egypt/00017-NAMRU3/2007 (A/H7N3) segment 8 (NS) 1321.5 0.000000e+00 799/840 (95%)
EPI372285 A/shoveler/Egypt/00600-NAMRU3/2004 (A/H10N7) segment 8 (NS) 1321.5 0.000000e+00 798/839 (95%)
EPI370848 A/duck/Nanchang/4-190/2000 (A/H2N9) segment 8 (NS) 1321.5 0.000000e+00 798/839 (95%)
EPI370840 A/duck/Nanchang/2-0492/2000 (A/H2N9) segment 8 (NS) 1321.5 0.000000e+00 798/839 (95%)
EPI370832 A/duck/Nanchang/2-0485/2000 (A/H2N9) segment 8 (NS) 1321.5 0.000000e+00 798/839 (95%)
EPI367593 A/mallard/Czech Republic/15008-11K/2009 (A/H5N3) segment 8 (NS) 1321.5 0.000000e+00 799/840 (95%)
EPI363903 A/duck/Guangxi/1533/2007 (A/H6N2) segment 8 (NS) 1321.5 0.000000e+00 798/839 (95%)
EPI363483 A/duck/Guangxi/2140/2006 (A/H6N2) segment 8 (NS) 1321.5 0.000000e+00 798/839 (95%)
EPI345751 A/duck/Eastern China/50/2002 (A/H6N8) segment 8 (NS) 1321.5 0.000000e+00 799/840 (95%)
EPI345750 A/duck/Eastern China/51/2002 (A/H6N2) segment 8 (NS) 1321.5 0.000000e+00 798/839 (95%)
EPI345749 A/duck/Eastern China/52/2002 (A/H6N2) segment 8 (NS) 1321.5 0.000000e+00 798/839 (95%)
EPI345748 A/duck/Eastern China/53/2002 (A/H6N2) segment 8 (NS) 1321.5 0.000000e+00 798/839 (95%)
EPI345747 A/duck/Eastern China/54/2002 (A/H6N2) segment 8 (NS) 1321.5 0.000000e+00 798/839 (95%)
EPI345745 A/duck/Eastern China/57/2003 (A/H6N2) segment 8 (NS) 1321.5 0.000000e+00 798/839 (95%)
EPI345744 A/duck/Eastern China/58/2003 (A/H6N2) segment 8 (NS) 1321.5 0.000000e+00 798/839 (95%)
EPI338862 A/aquatic bird/Korea/W69/2005 (A/H6N5) segment 8 (NS) 1321.5 0.000000e+00 798/839 (95%)
EPI327328 A/turkey/Italy/8534/2002 (A/H7N3) segment 8 (NS) 1321.5 0.000000e+00 798/839 (95%)
EPI327034 A/duck/Korea/JS53/2004 (A/H3N2) segment 8 (NS) 1321.5 0.000000e+00 796/836 (95%)
EPI326686 A/turkey/Italy/8458/2002 (A/H7N3) segment 8 (NS) 1321.5 0.000000e+00 798/839 (95%)
EPI315052 A/duck/Vietnam/G119/2006 (A/H3N8) segment 8 (NS) 1321.5 0.000000e+00 797/838 (95%)
EPI296588 A/mute swan/Netherlands/1/2006 (A/H10N7) segment 8 (NS) 1321.5 0.000000e+00 798/839 (95%)
EPI296540 A/mallard/Netherlands/20/2005 (A/H12N8) segment 8 (NS) 1321.5 0.000000e+00 798/839 (95%)
EPI296532 A/mallard/Netherlands/4/2006 (A/H10N6) segment 8 (NS) 1321.5 0.000000e+00 798/839 (95%)
EPI284609 A/mallard/Bavaria/185-26/2008 (A/H1N1) segment 8 (NS) 1321.5 0.000000e+00 798/839 (95%)
EPI284601 A/mallard/Bavaria/185-8/2008 (A/H1N1) segment 8 (NS) 1321.5 0.000000e+00 798/839 (95%)
EPI268611 A/duck/Shantou/728/2001 (A/H6N2) segment 8 (NS) 1321.5 0.000000e+00 799/840 (95%)
EPI268605 A/duck/Shantou/1586/2001 (A/H6N2) segment 8 (NS) 1321.5 0.000000e+00 798/839 (95%)
EPI257232 A/Anas platyrhynchos/09-884/2008 (A/H5N3) segment 8 (NS) 1321.5 0.000000e+00 798/839 (95%)
EPI257224 A/Anas platyrhynchos/Belgium/09-762-P1/2008 (A/H5N1) segment 8 (NS) 1321.5 0.000000e+00 798/839 (95%)
EPI257216 A/Anas platyrhynchos/Belgium/09-762/2008 (A/H1N1) segment 8 (NS) 1321.5 0.000000e+00 798/839 (95%)
EPI251765 A/mallard/Sweden/58/2003 (A/H11N1) segment 8 (NS) 1321.5 0.000000e+00 798/839 (95%)
EPI251643 A/mallard/Netherlands/10/1999 (A/H1N8) segment 8 (NS) 1321.5 0.000000e+00 798/839 (95%)
EPI250103 A/tufted duck/Aktau/1456/2006 (A/H4N6) segment 8 (NS) 1321.5 0.000000e+00 798/839 (95%)
EPI248510 A/wild duck/Germany/WV30/06 (A/H1N1) segment 8 (NS) 1321.5 0.000000e+00 798/839 (95%)
EPI248495 A/mallard/Germany-RP/R193/09 (A/H1N1) segment 8 (NS) 1321.5 0.000000e+00 798/839 (95%)
EPI230001 A/mallard/France/061054/2006 (A/H5N3) segment 8 (NS) 1321.5 0.000000e+00 798/839 (95%)
EPI229985 A/duck/France/080032/2008 (A/H5N2) segment 8 (NS) 1321.5 0.000000e+00 798/839 (95%)
EPI222168 A/mallard/Altai/1208/2007 (A/H3N6) segment 8 (NS) 1321.5 0.000000e+00 798/839 (95%)
EPI181973 A/common teal/Netherlands/1/2005 (A/H8N4) segment 8 (NS) 1321.5 0.000000e+00 799/840 (95%)
EPI170782 A/Anas querquedula/Astrakhan/3091/2002 (A/H4N8) segment 8 (NS) 1321.5 0.000000e+00 798/839 (95%)
EPI169401 A/mallard/Sweden/S90807/2005 (A/H4N6) segment 8 (NS) 1321.5 0.000000e+00 798/839 (95%)
EPI169389 A/mallard/Sweden/S90748/2005 (A/H4N6) segment 8 (NS) 1321.5 0.000000e+00 798/839 (95%)
EPI169388 A/mallard/Sweden/S90739/2005 (A/H11N9) segment 8 (NS) 1321.5 0.000000e+00 798/839 (95%)
EPI169366 A/mallard/Sweden/S90406/2005 (A/H3N8) segment 8 (NS) 1321.5 0.000000e+00 797/838 (95%)
EPI131929 A/turkey/Italy/8535/02 (A/H7N3) segment 8 (NS) 1321.5 0.000000e+00 798/839 (95%)
EPI125345 A/duck/Jiangxi/1786/03 (A/H7N7) segment 8 (NS) 1321.5 0.000000e+00 799/840 (95%)
EPI125336 A/duck/Jiangxi/1742/03 (A/H7N7) segment 8 (NS) 1321.5 0.000000e+00 799/840 (95%)
EPI118256 A/migratory duck/Jiang Xi/7231/2004 (A/H10N5) segment 8 (NS) 1321.5 0.000000e+00 798/839 (95%)
EPI118229 A/wild duck/Shantou/1737/2000 (A/H6N8) segment 8 (NS) 1321.5 0.000000e+00 798/839 (95%)
EPI118202 A/duck/Jiang Xi/2374/2005 (A/H3N6) segment 8 (NS) 1321.5 0.000000e+00 798/839 (95%)
EPI88991 A/Duck/Nanchang/4-184/2000 (A/H2N9) segment 8 (NS) 1321.5 0.000000e+00 798/839 (95%)
EPI88974 A/Duck/Nanchang/2-0486/2000 (A/H2N9) segment 8 (NS) 1321.5 0.000000e+00 798/839 (95%)
EPI77397 A/turkey/Italy/9742/2002 (A/H7N3) segment 8 (NS) 1321.5 0.000000e+00 798/839 (95%)
EPI68170 A/duck/Italy/775/2004 (A/H5N3) segment 8 (NS) 1321.5 0.000000e+00 798/839 (95%)
EPI60642 A/quail/Italy/4610/2003 (A/H7N2) segment 8 (NS) 1321.5 0.000000e+00 798/839 (95%)
EPI58533 A/turkey/Italy/8912/2002 (A/H7N3) segment 8 (NS) 1321.5 0.000000e+00 798/839 (95%)
EPI23392 A/WDk/ST/1737/2000 (A/H6N8) segment 8 (NS) 1321.5 0.000000e+00 798/839 (95%)
EPI21466 A/turkey/Italy/220158/2002 (A/H7N3) segment 8 (NS) 1321.5 0.000000e+00 798/839 (95%)
EPI21462 A/turkey/Italy/214845/02 (A/H7N3) segment 8 (NS) 1321.5 0.000000e+00 798/839 (95%)
EPI12517 A/aquatic bird/Hong Kong/399/99 (A/H3N8) segment 8 (NS) 1321.5 0.000000e+00 798/839 (95%)
EPI1369 A/duck/Hokkaido/Vac-2/04 (A/H7N7) segment 8 (NS) 1321.5 0.000000e+00 798/839 (95%)
EPI584061 A/environment/Kagoshima/KU-ngr-F/2012(H4N8) (A/H4N8) segment 8 (NS) 1317.8 0.000000e+00 796/838 (94%)
EPI543925 A/guineafowl/Italy/9565/2002 (A/H7N3) segment 8 (NS) 1317.8 0.000000e+00 797/839 (94%)
EPI649339 A/duck/Zhejiang/D2-1/2013 (A/H4N6) segment 8 (NS) 1315.9 0.000000e+00 797/839 (94%)
EPI649338 A/duck/Zhejiang/D15/2013 (A/H4N6) segment 8 (NS) 1315.9 0.000000e+00 797/839 (94%)
EPI649337 A/duck/Zhejiang/D14/2013 (A/H4N6) segment 8 (NS) 1315.9 0.000000e+00 798/840 (95%)
EPI649336 A/duck/Zhejiang/422/2013 (A/H4N6) segment 8 (NS) 1315.9 0.000000e+00 797/839 (94%)
EPI649335 A/duck/Zhejiang/418/2013 (A/H4N6) segment 8 (NS) 1315.9 0.000000e+00 797/839 (94%)
EPI649334 A/duck/Zhejiang/414/2013 (A/H4N6) segment 8 (NS) 1315.9 0.000000e+00 798/840 (95%)
EPI649332 A/duck/Zhejiang/409/2013 (A/H4N6) segment 8 (NS) 1315.9 0.000000e+00 797/839 (94%)
EPI618991 A/mallard/Sweden/4258/2004 (A/H10N4) segment 8 (NS) 1315.9 0.000000e+00 797/839 (94%)
EPI618979 A/mallard/Sweden/3151/2003 (A/H10N7) segment 8 (NS) 1315.9 0.000000e+00 798/840 (95%)
EPI618951 A/mallard/Sweden/948/2002 (A/H10N9) segment 8 (NS) 1315.9 0.000000e+00 798/840 (95%)
EPI618825 A/mallard/Sweden/104746/2009 (A/H10N1) segment 8 (NS) 1315.9 0.000000e+00 797/839 (94%)
EPI618571 A/mallard/Portugal/83695/2009 (A/H9N2) segment 8 (NS) 1315.9 0.000000e+00 797/839 (94%)
EPI618558 A/mallard/Sweden/67860/2007 (A/H9N2) segment 8 (NS) 1315.9 0.000000e+00 797/839 (94%)
EPI618514 A/mallard/Sweden/101558/2009 (A/H0) segment 8 (NS) 1315.9 0.000000e+00 797/839 (94%)
EPI618391 A/mallard/Sweden/79983/2008 (A/H11N9) segment 8 (NS) 1315.9 0.000000e+00 797/839 (94%)
EPI618384 A/mallard/Sweden/79436/2008 (A/H11N9) segment 8 (NS) 1315.9 0.000000e+00 797/839 (94%)
EPI618377 A/mallard/Sweden/80011/2008 (A/H11N9) segment 8 (NS) 1315.9 0.000000e+00 797/839 (94%)
EPI618370 A/mallard/Sweden/80079/2008 (A/H11N9) segment 8 (NS) 1315.9 0.000000e+00 797/839 (94%)
EPI618263 A/mallard/Sweden/79416/2008 (A/H11N9) segment 8 (NS) 1315.9 0.000000e+00 797/839 (94%)
EPI618254 A/mallard/Sweden/79196/2008 (A/H0) segment 8 (NS) 1315.9 0.000000e+00 797/839 (94%)
EPI618233 A/mallard/Sweden/79369/2008 (A/H11N9) segment 8 (NS) 1315.9 0.000000e+00 797/839 (94%)
EPI618229 A/mallard/Sweden/79330/2008 (A/H11N9) segment 8 (NS) 1315.9 0.000000e+00 797/839 (94%)
EPI618127 A/mallard/Sweden/2823/2003 (A/H10N8) segment 8 (NS) 1315.9 0.000000e+00 797/839 (94%)
EPI618116 A/mallard/Sweden/936/2002 (A/H10N9) segment 8 (NS) 1315.9 0.000000e+00 798/840 (95%)
EPI618041 A/mallard/Republic of Georgia/12/2011 (A/H10N4) segment 8 (NS) 1315.9 0.000000e+00 797/839 (94%)
EPI617771 A/mallard/Republic of Georgia/15/2011 (A/H10N7) segment 8 (NS) 1315.9 0.000000e+00 797/839 (94%)
EPI617142 A/mallard/Sweden/1636/2002 (A/H3N8) segment 8 (NS) 1315.9 0.000000e+00 797/839 (94%)
EPI617135 A/mallard/Sweden/1621/2002 (A/H7N9) segment 8 (NS) 1315.9 0.000000e+00 796/838 (94%)
EPI600164 A/migratory duck/Jiangxi/31577/2013 (A/H10N5) segment 8 (NS) 1315.9 0.000000e+00 797/839 (94%)
EPI596454 A/muscovy duck/Vietnam/LBM348/2013 (A/H3N8) segment 8 (NS) 1315.9 0.000000e+00 797/839 (94%)
EPI596436 A/muscovy duck/Vietnam/LBM115/2012 (A/H3N2) segment 8 (NS) 1315.9 0.000000e+00 797/839 (94%)
EPI557663 A/duck/Zhejiang/D486/2013 (A/H9N2) segment 8 (NS) 1315.9 0.000000e+00 797/839 (94%)
EPI544059 A/turkey/Italy/9369/2002 (A/H7N3) segment 8 (NS) 1315.9 0.000000e+00 797/839 (94%)
EPI527757 A/mallard/San Jiang/275/2007 (A/H6N1) segment 8 (NS) 1315.9 0.000000e+00 797/839 (94%)
EPI525953 A/common goldeneye/Mongolia/1271/2010 (A/H7N1) segment 8 (NS) 1315.9 0.000000e+00 797/839 (94%)
EPI525904 A/wild bird/Mongolia/2066/2011 (A/H5N3) segment 8 (NS) 1315.9 0.000000e+00 797/839 (94%)
EPI514973 A/mallard/Sweden/80261/2008 (A/H4N9) segment 8 (NS) 1315.9 0.000000e+00 797/839 (94%)
EPI514942 A/mallard/Sweden/51880/2006 (A/H0) segment 8 (NS) 1315.9 0.000000e+00 797/839 (94%)
EPI514742 A/mallard/Sweden/4508/2004 (A/H4N6) segment 8 (NS) 1315.9 0.000000e+00 797/839 (94%)
EPI514656 A/mallard/Sweden/6134/2005 (A/H4N6) segment 8 (NS) 1315.9 0.000000e+00 797/839 (94%)
EPI514632 A/mallard/Sweden/51523/2006 (A/H4N6) segment 8 (NS) 1315.9 0.000000e+00 797/839 (94%)
EPI514624 A/mallard/Sweden/51284/2006 (A/H4N6) segment 8 (NS) 1315.9 0.000000e+00 797/839 (94%)
EPI514617 A/mallard/Sweden/51198/2006 (A/H4N6) segment 8 (NS) 1315.9 0.000000e+00 797/839 (94%)
EPI514609 A/mallard/Sweden/50709/2006 (A/H4N5) segment 8 (NS) 1315.9 0.000000e+00 797/839 (94%)

_________________
www.twitter.com/hniman


Top
 Profile  
 
Display posts from previous:  Sort by  
Post new topic Reply to topic  [ 11 posts ]  Go to page 1, 2  Next

All times are UTC - 5 hours [ DST ]


Who is online

Users browsing this forum: Google [Bot], Yahoo [Bot] and 57 guests


You cannot post new topics in this forum
You cannot reply to topics in this forum
You cannot edit your posts in this forum
You cannot delete your posts in this forum
You cannot post attachments in this forum

Search for:
Jump to:  
cron
Powered by phpBB® Forum Software © phpBB Group