Rhiza Labs FluTracker Forum

The place to discuss the flu
It is currently Thu Oct 19, 2017 12:13 pm

All times are UTC - 5 hours [ DST ]




Post new topic Reply to topic  [ 7 posts ] 
Author Message
PostPosted: Thu Jun 18, 2015 10:51 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
Institute for Medical Research in Kuala Lumpur released N gene sequence which was an exact match with Jeddah isolates.

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Thu Jun 18, 2015 10:51 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
LOCUS KP769415 1242 bp RNA linear VRL 15-JUN-2015
DEFINITION Middle East respiratory syndrome coronavirus isolate MyH010414
nucleocapsid (N) gene, complete cds.
ACCESSION KP769415
VERSION KP769415.1 GI:829620334
KEYWORDS .
SOURCE Middle East respiratory syndrome coronavirus (MERS-CoV)
ORGANISM Middle East respiratory syndrome coronavirus
Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA
stage; Nidovirales; Coronaviridae; Coronavirinae; Betacoronavirus;
unclassified Betacoronavirus.
REFERENCE 1 (bases 1 to 1242)
AUTHORS Mat-Rahim,N.A., Tengku Abdul Rashid,T.R., Suppiah,J., Thayan,R.,
Yusof,M.A. and Sa'at,Z.
TITLE Nucleocapsid gene analysis from an imported case of Middle East
respiratory syndrome coronavirus, Malaysia
JOURNAL Asian Pac J Trop Dis 5 (7) (2015) In press
REFERENCE 2 (bases 1 to 1242)
AUTHORS Mat-Rahim,N.A., Tengku Abdul Rashid,T.R., Suppiah,J., Thayan,R.,
Yusof,M.A. and Sa'at,Z.
TITLE Direct Submission
JOURNAL Submitted (11-FEB-2015) Virology Unit, Institute for Medical
Research, Jalan Pahang, Kuala Lumpur, Federal Territory 50588,
Malaysia
FEATURES Location/Qualifiers
source 1..1242
/organism="Middle East respiratory syndrome coronavirus"
/mol_type="genomic RNA"
/isolate="MyH010414"
/host="Homo sapiens"
/db_xref="taxon:1335626"
/country="Malaysia"
/collection_date="13-Apr-2014"
gene 1..1242
/gene="N"
CDS 1..1242
/gene="N"
/note="N protein"
/codon_start=1
/product="nucleocapsid"
/protein_id="AKL80590.1"
/db_xref="GI:829620335"
/translation="MASPAAPRAVSFADNNDITNTNLSRGRGRNPKPRAAPNNTVSWY
TGLTQHGKVPLTFPPGQGVPLNANSTPAQNAGYWRRQDRKINTGNGIKQLAPRWYFYY
TGTGPEAALPFRAVKDGIVWVHEHGATDAPSTFGTRNPNNDSAIVTQFAPGTKLPKNF
HIEGTGGNSQSSSRASSVSRNSSRSSSQGSRSGNSTRGTSPGPSGIGAVGGDLLYLDL
LNRLQALESGKVKQSQPKVITKKDAAAAKNKMRHKRTSTKSFNMVQAFGLRGPGDLQG
NFGDLQLNKLGTEDPRWPQIAELAPTASAFMGMSQFKLTHQNNDDHGNPVYFLRYSGA
IKLDPKNPNYNKWLELLEQNIDAYKTFPKKEKKQKAPKEESTDQMSEPPKEQRVQGSI
TQRTRTRPSVQPGPMIDVNTD"
ORIGIN
1 atggcatccc ctgctgcacc tcgtgctgtt tcctttgccg ataacaatga tataacaaat
61 acaaacctgt ctcgaggtag aggacgtaat ccaaaaccac gagctgcacc aaataacact
121 gtctcttggt acactgggct tacccaacac gggaaagtcc ctcttacctt tccacctggg
181 cagggtgtac ctcttaatgc caattccacc ccagcgcaaa atgctgggta ttggcggaga
241 caggacagaa aaattaatac cgggaatgga attaagcaac tggctcccag gtggtacttc
301 tactacactg gaaccggacc cgaagcagca ctcccattcc gggctgttaa ggatggcatc
361 gtttgggtcc atgaacatgg cgccactgat gctccttcaa cttttgggac gcggaaccct
421 aacaatgatt cagctattgt tacacaattc gcgcccggta ctaagcttcc taaaaacttc
481 cacattgagg ggactggagg caatagtcaa tcatcttcaa gagcctctag cgtaagcaga
541 aactcttcca gatctagttc acaaggttca agatcaggaa actctacccg cggcacttct
601 ccaggtccat ctggaatcgg agcagtagga ggtgatctac tttaccttga tcttctgaac
661 agactacaag cccttgagtc tggcaaagta aagcaatcgc agccaaaagt aatcactaag
721 aaagatgctg ctgctgctaa aaataagatg cgccacaagc gcacttccac caaaagtttc
781 aacatggtgc aagcttttgg tcttcgcgga ccaggagacc tccagggaaa ctttggtgat
841 cttcaattga ataaactcgg cactgaggac ccacgttggc cccaaattgc tgagcttgct
901 cctacagcca gtgcttttat gggtatgtcg caatttaaac ttacccatca gaacaatgat
961 gatcatggca accctgtgta cttccttcgg tacagtggag ccattaaact tgacccaaag
1021 aatcccaact acaataagtg gttggagctt cttgagcaaa atattgatgc ctacaaaacc
1081 ttccctaaga aggaaaagaa acaaaaggca ccaaaagaag aatcaacaga ccaaatgtct
1141 gaacctccta aggagcagcg tgtgcaaggt agcatcactc agcgcactcg cacccgtcca
1201 agtgttcagc ctggtccaat gattgatgtt aacactgatt ag

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Thu Jun 18, 2015 10:56 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
Middle East respiratory syndrome coronavirus isolate Florida/USA-2_Saudi Arabia_2014, complete genome 2241 2241 100% 0.0 100% KP223131.1
Select seq gb|KM027261.1| Middle East respiratory syndrome coronavirus isolate Makkah_C9355/KSA/Makkah/2014-04-15, complete genome 2241 2241 100% 0.0 100% KM027261.1
Select seq gb|KM027260.1| Middle East respiratory syndrome coronavirus isolate Jeddah_C10306/KSA/2014-04-20, complete genome 2241 2241 100% 0.0 100% KM027260.1
Select seq gb|KM027259.1| Middle East respiratory syndrome coronavirus isolate Jeddah_C9055/KSA/2014-04-14, complete genome 2241 2241 100% 0.0 100% KM027259.1
Select seq gb|KM027258.1| Middle East respiratory syndrome coronavirus isolate Jeddah_C8826/KSA/2014-04-12, complete genome 2241 2241 100% 0.0 100% KM027258.1
Select seq gb|KM027256.1| Middle East respiratory syndrome coronavirus isolate Jeddah_C7569/KSA/2014-04-03, complete genome 2241 2241 100% 0.0 100% KM027256.1
Select seq gb|KM027255.1| Middle East respiratory syndrome coronavirus isolate Jeddah_C7149/KSA/2014-04-05, complete genome 2241 2241 100% 0.0 100% KM027255.1
Select seq gb|KJ829365.1| Middle East respiratory syndrome coronavirus strain Florida/USA-2_Saudi Arabia_2014, complete genome 2241 2241 100% 0.0 100% KJ829365.1
Select seq gb|KM027257.1| Middle East respiratory syndrome coronavirus isolate Jeddah_C7770/KSA/2014-04-07, complete genome 2235 2235 100% 0.0 99% KM027257.1
Select seq gb|KJ782550.1| Middle East respiratory syndrome coronavirus strain Greece-Saudi Arabia_2014 N protein (N) gene, complete cds 2235 2235 100% 0.0 99% KJ782550.1
Select seq gb|KJ650098.1| Middle East respiratory syndrome coronavirus isolate Camel/Qatar_2_2014, complete genome 2235 2235 100% 0.0 99% KJ650098.1
Select seq gb|KJ713296.1| Middle East respiratory syndrome coronavirus isolate KSA-CAMEL-378, complete genome 2235 2235 100% 0.0 99% KJ713296.1
Select seq gb|KJ713295.1| Middle East respiratory syndrome coronavirus isolate KSA-CAMEL-505, complete genome 2232 2232 100% 0.0 99% KJ713295.1
Select seq gb|KJ156909.1| Middle East respiratory syndrome coronavirus isolate Al-Hasa_28h_2013 N protein and ORF8b genes, complete cds 2226 2226 100% 0.0 99% KJ156909.1
Select seq gb|KJ156939.1| Middle East respiratory syndrome coronavirus isolate Al-Hasa_27b_2013 ORF1ab gene, partial cds; and S protein, ORF3, ORF4a, ORF4b, ORF5, E protein, M protein, N protein, and ORF8b genes, complete cds 2226 2226 100% 0.0 99% KJ156939.1
Select seq gb|KJ156872.1| Middle East respiratory syndrome coronavirus isolate Al-Hasa_26c_2013 ORF1ab gene, partial cds; and S protein, ORF3, ORF4a, ORF4b, ORF5, E protein, M protein, N protein, and ORF8b genes, complete cds 2226 2226 100% 0.0 99% KJ156872.1
Select seq gb|KF600632.1| Middle East respiratory syndrome coronavirus isolate Al-Hasa_19_2013, complete genome 2226 2226 100% 0.0 99% KF600632.1
Select seq gb|KT036374.1| Middle East respiratory syndrome coronavirus isolate ChinaGD01 variant 2, partial genome 2223 2223 100% 0.0 99% KT036374.1
Select seq gb|KT036373.1| Middle East respiratory syndrome coronavirus isolate ChinaGD01 variant 1, partial genome 2223 2223 100% 0.0 99% KT036373.1
Select seq gb|KT036372.1| Middle East respiratory syndrome coronavirus isolate ChinaGD01, partial genome 2223 2223 100% 0.0 99% KT036372.1
Select seq gb|KT029139.1| Middle East respiratory syndrome coronavirus isolate MERS-CoV/KOR/KNIH/002_05_2015, complete genome 2223 2223 100% 0.0 99% KT029139.1
Select seq gb|KT026453.1| Middle East respiratory syndrome coronavirus strain Hu/Riyadh_KSA_2959_2015, complete genome 2223 2223 100% 0.0 99% KT026453.1
Select seq gb|KT006149.2| Middle East respiratory syndrome coronavirus strain ChinaGD01, complete genome 2223 2223 100% 0.0 99% KT006149.2
Select seq gb|KJ713297.1| Middle East respiratory syndrome coronavirus isolate KSA-CAMEL-503, complete genome 2223 2223 100% 0.0 99% KJ713297.1
Select seq gb|KJ156953.1| Middle East respiratory syndrome coronavirus isolate Riyadh_15f_2013 N protein and ORF8b genes, complete cds 2223 2223 100% 0.0 99% KJ156953.1
Select seq gb|KJ156902.1| Middle East respiratory syndrome coronavirus isolate Al-Hasa_24g_2013 N protein and ORF8b genes, complete cds 2223 2223 100% 0.0 99% KJ156902.1
Select seq gb|KJ156906.1| Middle East respiratory syndrome coronavirus isolate Taif_3g_2013 M protein gene, partial cds; and N protein and ORF8b genes, complete cds 2223 2223 100% 0.0 99% KJ156906.1
Select seq gb|KJ156871.1| Middle East respiratory syndrome coronavirus isolate Taif_4b_2013 M protein gene, partial cds; and N protein and ORF8b genes, complete cds 2223 2223 100% 0.0 99% KJ156871.1
Select seq gb|KJ156952.1| Middle East respiratory syndrome coronavirus isolate Riyadh_4_2013, complete genome 2223 2223 100% 0.0 99% KJ156952.1
Select seq gb|KJ156949.1| Middle East respiratory syndrome coronavirus isolate Taif_1_2013, complete genome 2223 2223 100% 0.0 99% KJ156949.1
Select seq gb|KJ156934.1| Middle East respiratory syndrome coronavirus isolate Riyadh_14_2013, complete genome 2223 2223 100% 0.0 99% KJ156934.1
Select seq gb|KJ156881.1| Middle East respiratory syndrome coronavirus isolate Wadi-Ad-Dawasir_1_2013, complete genome 2223 2223 100% 0.0 99% KJ156881.1
Select seq gb|KJ156866.1| Middle East respiratory syndrome coronavirus isolate Al-Hasa_25_2013, complete genome 2223 2223 100% 0.0 99% KJ156866.1
Select seq gb|KF600652.1| Middle East respiratory syndrome coronavirus isolate Riyadh_2_2012, complete genome 2223 2223 100% 0.0 99% KF600652.1
Select seq gb|KF600651.1| Middle East respiratory syndrome coronavirus isolate Al-Hasa_18_2013, complete genome 2223 2223 100% 0.0 99% KF600651.1
Select seq gb|KF600647.1| Middle East respiratory syndrome coronavirus isolate Al-Hasa_17_2013, complete genome 2223 2223 100% 0.0 99% KF600647.1
Select seq gb|KF600645.1| Middle East respiratory syndrome coronavirus isolate Al-Hasa_15_2013, complete genome 2223 2223 100% 0.0 99% KF600645.1
Select seq gb|KF600644.1| Middle East respiratory syndrome coronavirus isolate Al-Hasa_16_2013, complete genome 2223 2223 100% 0.0 99% KF600644.1
Select seq gb|KF600643.1| Middle East respiratory syndrome coronavirus isolate Al-Hasa_14b_2013, partial genome 2223 2223 100% 0.0 99% KF600643.1
Select seq gb|KF600639.1| Middle East respiratory syndrome coronavirus isolate Al-Hasa_9e_2013, partial genome 2223 2223 100% 0.0 99% KF600639.1
Select seq gb|KF600636.1| Middle East respiratory syndrome coronavirus isolate Al-Hasa_11c_2013, partial genome 2223 2223 100% 0.0 99% KF600636.1
Select seq gb|KF600635.1| Middle East respiratory syndrome coronavirus isolate Al-Hasa_8d_2013, partial genome 2223 2223 100% 0.0 99% KF600635.1
Select seq gb|KF600634.1| Middle East respiratory syndrome coronavirus isolate Al-Hasa_21_2013, complete genome 2223 2223 100% 0.0 99% KF600634.1
Select seq gb|KF600628.1| Middle East respiratory syndrome coronavirus isolate Hafr-Al-Batin_1_2013, complete genome 2223 2223 100% 0.0 99% KF600628.1
Select seq gb|KF600627.1| Middle East respiratory syndrome coronavirus isolate Al-Hasa_12_2013, complete genome 2223 2223 100% 0.0 99% KF600627.1
Select seq gb|KF600621.1| Middle East respiratory syndrome coronavirus isolate Al-Hasa_22f_2013, partial genome 2223 2223 100% 0.0 99% KF600621.1
Select seq gb|KF600620.1| Middle East respiratory syndrome coronavirus isolate Bisha_1_2012, complete genome 2223 2223 100% 0.0 99% KF600620.1
Select seq gb|KF600612.1| Middle East respiratory syndrome coronavirus isolate Riyadh_1_2012, complete genome 2223 2223 100% 0.0 99% KF600612.1
Select seq gb|KF192507.1| Middle East respiratory syndrome coronavirus, complete genome 2223 2223 100% 0.0 99% KF192507.1
Select seq gb|KF186565.1| Middle East respiratory syndrome coronavirus isolate Al-Hasa_3_2013, complete genome 2223 2223 100% 0.0 99% KF186565.1
Select seq gb|KF186567.1| Middle East respiratory syndrome coronavirus isolate Al-Hasa_1_2013, complete genome 2223 2223 100% 0.0 99% KF186567.1
Select seq gb|KF186566.1| Middle East respiratory syndrome coronavirus isolate Al-Hasa_2_2013, complete genome 2223 2223 100% 0.0 99% KF186566.1
Select seq gb|KF186564.1| Middle East respiratory syndrome coronavirus isolate Al-Hasa_4_2013, complete genome 2223 2223 100% 0.0 99% KF186564.1
Select seq gb|KJ156862.1| Middle East respiratory syndrome coronavirus isolate Al-Hasa_23e_2013 N protein and ORF8b genes, complete cds 2219 2219 100% 0.0 99% KJ156862.1
Select seq gb|KT026456.1| Middle East respiratory syndrome coronavirus isolate Hu/Riyadh_KSA_4050_2015, complete genome 2217 2217 100% 0.0 99% KT026456.1
Select seq gb|KT026454.1| Middle East respiratory syndrome coronavirus strain Hu/Riyadh_KSA_4050_2015, complete genome 2217 2217 100% 0.0 99% KT026454.1
Select seq gb|KJ361503.1| Middle East respiratory syndrome coronavirus isolate Hu-France - FRA2_130569-2013_Isolate_Sanger, complete genome 2217 2217 100% 0.0 99% KJ361503.1
Select seq gb|KJ361502.1| Middle East respiratory syndrome coronavirus isolate Hu-France - FRA2_130569-2013_InSpu_Sanger, complete genome 2217 2217 100% 0.0 99% KJ361502.1
Select seq gb|KJ361501.1| Middle East respiratory syndrome coronavirus isolate Hu-France - FRA2_130569-2013_IS_HTS, complete genome 2217 2217 100% 0.0 99% KJ361501.1
Select seq gb|KJ361500.1| Middle East respiratory syndrome coronavirus isolate Hu-France (UAE) - FRA1_1627-2013_BAL_Sanger, complete genome 2217 2217 100% 0.0 99% KJ361500.1
Select seq gb|KP719933.1| Middle East respiratory syndrome coronavirus isolate Camel/UAE/D1209/2014, complete genome 2217 2217 100% 0.0 99% KP719933.1
Select seq gb|KP719932.1| Middle East respiratory syndrome coronavirus isolate Camel/UAE/D1243.12/2014, complete genome 2217 2217 100% 0.0 99% KP719932.1
Select seq gb|KP719931.1| Middle East respiratory syndrome coronavirus isolate Camel/UAE/D1339.2/2014, complete genome 2217 2217 100% 0.0 99% KP719931.1
Select seq gb|KP719930.1| Middle East respiratory syndrome coronavirus isolate Camel/UAE/D1164.14/2014, complete genome 2217 2217 100% 0.0 99% KP719930.1
Select seq gb|KP719929.1| Middle East respiratory syndrome coronavirus isolate Camel/UAE/D1164.11/2014, complete genome 2217 2217 100% 0.0 99% KP719929.1
Select seq gb|KP719928.1| Middle East respiratory syndrome coronavirus isolate Camel/UAE/D1164.10/2014, complete genome 2217 2217 100% 0.0 99% KP719928.1
Select seq gb|KP719927.1| Middle East respiratory syndrome coronavirus isolate Camel/UAE/D1164.9/2014, complete genome 2217 2217 100% 0.0 99% KP719927.1
Select seq gb|KM210278.1| Middle East respiratory syndrome coronavirus isolate England/3/2013, complete genome 2217 2217 100% 0.0 99% KM210278.1
Select seq gb|KM210277.1| Middle East respiratory syndrome coronavirus isolate England/4/2013, complete genome 2217 2217 100% 0.0 99% KM210277.1
Select seq gb|KP209313.1| Middle East respiratory syndrome coronavirus strain Abu Dhabi_UAE_26_2014, complete genome 2217 2217 100% 0.0 99% KP209313.1
Select seq gb|KP209312.1| Middle East respiratory syndrome coronavirus strain Abu Dhabi_UAE_9_2013, complete genome 2217 2217 100% 0.0 99% KP209312.1
Select seq gb|KP209309.1| Middle East respiratory syndrome coronavirus strain Abu Dhabi_UAE_30_2014, complete genome 2217 2217 100% 0.0 99% KP209309.1
Select seq gb|KP209308.1| Middle East respiratory syndrome coronavirus strain Abu Dhabi_UAE_16_2014, complete genome 2217 2217 100% 0.0 99% KP209308.1
Select seq gb|KP209307.1| Middle East respiratory syndrome coronavirus strain Abu Dhabi_UAE_18_2014, complete genome 2217 2217 100% 0.0 99% KP209307.1
Select seq gb|KP209306.1| Middle East respiratory syndrome coronavirus strain Abu Dhabi_UAE_8_2014, complete genome 2217 2217 100% 0.0 99% KP209306.1
Select seq gb|KM027262.1| Middle East respiratory syndrome coronavirus isolate Riyadh_2014KSA_683/KSA/2014, complete genome 2217 2217 100% 0.0 99% KM027262.1
Select seq gb|KM015348.1| Middle East respiratory syndrome coronavirus isolate England/2/2013, complete genome 2217 2217 100% 0.0 99% KM015348.1
Select seq gb|KF811035.1| Middle East respiratory syndrome coronavirus strain Tunisia-Qatar_2013 nucleocapsid protein gene, complete cds 2217 2217 100% 0.0 99% KF811035.1
Select seq gb|KJ813439.1| Middle East respiratory syndrome coronavirus strain Indiana/USA-1_Saudi Arabia_2014, complete genome 2217 2217 100% 0.0 99% KJ813439.1
Select seq gb|KJ713298.1| Middle East respiratory syndrome coronavirus isolate KSA-CAMEL-363, complete genome 2217 2217 100% 0.0 99% KJ713298.1
Select seq gb|KF917527.1| Middle East respiratory syndrome coronavirus isolate MERS-CoV-Jeddah-Camel-1, complete genome 2217 2217 100% 0.0 99% KF917527.1
Select seq gb|KJ556336.1| Middle East respiratory syndrome coronavirus isolate Jeddah_1_2013, complete genome 2217 2217 100% 0.0 99% KJ556336.1
Select seq gb|KJ156927.1| Middle East respiratory syndrome coronavirus ORF4b, ORF5, E protein, M protein, N protein, and ORF8b genes, complete cds 2217 2217 100% 0.0 99% KJ156927.1
Select seq gb|KJ156865.1| Middle East respiratory syndrome coronavirus isolate Riyadh_17c_2013 ORF4a, ORF4b, ORF5, E protein, M protein, and N protein genes, complete cds; and ORF8b-like gene, complete sequence 2217 2217 100% 0.0 99% KJ156865.1
Select seq gb|KJ156883.1| Middle East respiratory syndrome coronavirus isolate Asir_1d_2013 N protein and ORF8b genes, complete cds 2217 2217 100% 0.0 99% KJ156883.1
Select seq gb|KJ156876.1| Middle East respiratory syndrome coronavirus isolate Taif_2b_2013 ORF1ab gene, partial cds; and S protein, ORF3, ORF4a, ORF4b, ORF5, E protein, M protein, N protein, and ORF8b genes, complete cds 2217 2217 100% 0.0 99% KJ156876.1
Select seq gb|KJ156932.1| Middle East respiratory syndrome coronavirus isolate Asir_2g_2013 M protein gene, partial cds; and N protein and ORF8b genes, complete cds 2217 2217 100% 0.0 99% KJ156932.1
Select seq gb|KJ156917.1| Middle East respiratory syndrome coronavirus isolate Madinah_1c_2013 M protein gene, partial cds; N protein gene, complete cds; and ORF8b-like gene, complete sequence 2217 2217 100% 0.0 99% KJ156917.1
Select seq gb|KJ156942.1| Middle East respiratory syndrome coronavirus isolate Riyadh_8b_2013, partial genome 2217 2217 100% 0.0 99% KJ156942.1
Select seq gb|KJ156916.1| Middle East respiratory syndrome coronavirus isolate Madinah_3b_2013, partial genome 2217 2217 100% 0.0 99% KJ156916.1
Select seq gb|KJ156944.1| Middle East respiratory syndrome coronavirus isolate Riyadh_5_2013, complete genome 2217 2217 100% 0.0 99% KJ156944.1
Select seq gb|KF961222.1| Middle East respiratory syndrome coronavirus isolate Qatar4, complete genome 2217 2217 100% 0.0 99% KF961222.1
Select seq gb|KF745068.1| Middle East respiratory syndrome coronavirus isolate FRA/UAE, complete genome 2217 4435 100% 0.0 99% KF745068.1
Select seq gb|KF600630.1| Middle East respiratory syndrome coronavirus isolate Buraidah_1_2013, complete genome 2217 2217 100% 0.0 99% KF600630.1
Select seq gb|KF600613.1| Middle East respiratory syndrome coronavirus isolate Riyadh_3_2013, complete genome 2217 2217 100% 0.0 99% KF600613.1
Select seq gb|KR011266.1| Middle East respiratory syndrome coronavirus strain Hu/Riyadh-KSA-2049/2015, complete genome 2214 2214 100% 0.0 99% KR011266.1
Select seq gb|KR011265.1| Middle East respiratory syndrome coronavirus strain Hu/Riyadh-KSA-2466/2015, complete genome 2214 2214 100% 0.0 99% KR011265.1
Select seq gb|KR011264.1| Middle East respiratory syndrome coronavirus strain Hu/Riyadh-KSA-2343/2015, complete genome 2214 2214 100% 0.0 99% KR011264.1
Select seq gb|KR011263.1| Middle East respiratory syndrome coronavirus strain Hu/Riyadh-KSA-2345/2015, complete genome 2214 2214 100% 0.0 99% KR011263.1

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Thu Jun 18, 2015 11:19 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
T28778A

Middle East respiratory syndrome coronavirus isolate Florida/USA-2_Saudi Arabia_2014, complete genome 30.2 246 100% 0.030 100% KP223131.1
Middle East respiratory syndrome coronavirus isolate Makkah_C9355/KSA/Makkah/2014-04-15, complete genome 30.2 246 100% 0.030 100% KM027261.1
Middle East respiratory syndrome coronavirus isolate Jeddah_C10306/KSA/2014-04-20, complete genome 30.2 246 100% 0.030 100% KM027260.1
Middle East respiratory syndrome coronavirus isolate Jeddah_C9055/KSA/2014-04-14, complete genome 30.2 246 100% 0.030 100% KM027259.1
Middle East respiratory syndrome coronavirus isolate Jeddah_C8826/KSA/2014-04-12, complete genome 30.2 246 100% 0.030 100% KM027258.1
Middle East respiratory syndrome coronavirus isolate Jeddah_C7770/KSA/2014-04-07, complete genome 30.2 246 100% 0.030 100% KM027257.1
Middle East respiratory syndrome coronavirus isolate Jeddah_C7569/KSA/2014-04-03, complete genome 30.2 246 100% 0.030 100% KM027256.1
Middle East respiratory syndrome coronavirus isolate Jeddah_C7149/KSA/2014-04-05, complete genome 30.2 246 100% 0.030 100% KM027255.1
Middle East respiratory syndrome coronavirus strain Florida/USA-2_Saudi Arabia_2014, complete genome 30.2 246 100% 0.030 100% KJ829365.1
Middle East respiratory syndrome coronavirus strain Greece-Saudi Arabia_2014 N protein (N) gene, complete cds 30.2 30.2 100% 0.030 100% KJ782550.1

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Thu Jun 18, 2015 11:25 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
T28880C
Middle East respiratory syndrome coronavirus isolate Florida/USA-2_Saudi Arabia_2014, complete genome 30.2 46.6 100% 0.030 100% KP223131.1
Middle East respiratory syndrome coronavirus isolate Makkah_C9355/KSA/Makkah/2014-04-15, complete genome 30.2 46.6 100% 0.030 100% KM027261.1
Middle East respiratory syndrome coronavirus isolate Jeddah_C10306/KSA/2014-04-20, complete genome 30.2 46.6 100% 0.030 100% KM027260.1
Middle East respiratory syndrome coronavirus isolate Jeddah_C9055/KSA/2014-04-14, complete genome 30.2 46.6 100% 0.030 100% KM027259.1
Middle East respiratory syndrome coronavirus isolate Jeddah_C8826/KSA/2014-04-12, complete genome 30.2 46.6 100% 0.030 100% KM027258.1
Middle East respiratory syndrome coronavirus isolate Jeddah_C7770/KSA/2014-04-07, complete genome 30.2 46.6 100% 0.030 100% KM027257.1
Middle East respiratory syndrome coronavirus isolate Jeddah_C7569/KSA/2014-04-03, complete genome 30.2 46.6 100% 0.030 100% KM027256.1
Middle East respiratory syndrome coronavirus isolate Jeddah_C7149/KSA/2014-04-05, complete genome 30.2 46.6 100% 0.030 100% KM027255.1
Middle East respiratory syndrome coronavirus isolate 82769-Kerman nucleoprotein (N) gene, partial cds 30.2 30.2 100% 0.030 100% KM044034.1
Middle East respiratory syndrome coronavirus isolate 80946-Kerman nucleoprotein (N) gene, partial cds 30.2 30.2 100% 0.030 100% KM044033.1
Middle East respiratory syndrome coronavirus isolate 82772-Kerman nucleoprotein (N) gene, partial cds 30.2 30.2 100% 0.030 100% KM044032.1
Middle East respiratory syndrome coronavirus strain Florida/USA-2_Saudi Arabia_2014, complete genome 30.2 46.6 100% 0.030 100% KJ829365.1
Middle East respiratory syndrome coronavirus strain Greece-Saudi Arabia_2014 N protein (N) gene, complete cds 30.2 30.2 100% 0.030 100% KJ782550.1
Middle East respiratory syndrome coronavirus isolate Camel/Qatar_2_2014, complete genome 30.2 46.6 100% 0.030 100% KJ650098.1
Middle East respiratory syndrome coronavirus isolate KSA-CAMEL-378, complete genome 30.2 46.6 100% 0.030 100% KJ713296.1
Middle East respiratory syndrome coronavirus isolate KSA-CAMEL-505, complete genome 30.2 46.6 100% 0.030 100% KJ713295.1

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Thu Jun 18, 2015 11:37 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
G28941C
Middle East respiratory syndrome coronavirus isolate Florida/USA-2_Saudi Arabia_2014, complete genome 30.2 97.6 100% 0.030 100% KP223131.1
Middle East respiratory syndrome coronavirus isolate Makkah_C9355/KSA/Makkah/2014-04-15, complete genome 30.2 97.6 100% 0.030 100% KM027261.1
Middle East respiratory syndrome coronavirus isolate Jeddah_C10306/KSA/2014-04-20, complete genome 30.2 97.6 100% 0.030 100% KM027260.1
Middle East respiratory syndrome coronavirus isolate Jeddah_C9055/KSA/2014-04-14, complete genome 30.2 97.6 100% 0.030 100% KM027259.1
Middle East respiratory syndrome coronavirus isolate Jeddah_C8826/KSA/2014-04-12, complete genome 30.2 97.6 100% 0.030 100% KM027258.1
Middle East respiratory syndrome coronavirus isolate Jeddah_C7770/KSA/2014-04-07, complete genome 30.2 97.6 100% 0.030 100% KM027257.1
Middle East respiratory syndrome coronavirus isolate Jeddah_C7569/KSA/2014-04-03, complete genome 30.2 97.6 100% 0.030 100% KM027256.1
Middle East respiratory syndrome coronavirus isolate Jeddah_C7149/KSA/2014-04-05, complete genome 30.2 97.6 100% 0.030 100% KM027255.1
Middle East respiratory syndrome coronavirus isolate 82769-Kerman nucleoprotein (N) gene, partial cds 30.2 30.2 100% 0.030 100% KM044034.1
Middle East respiratory syndrome coronavirus isolate 80946-Kerman nucleoprotein (N) gene, partial cds 30.2 30.2 100% 0.030 100% KM044033.1
Middle East respiratory syndrome coronavirus isolate 82772-Kerman nucleoprotein (N) gene, partial cds 30.2 30.2 100% 0.030 100% KM044032.1
Middle East respiratory syndrome coronavirus strain Florida/USA-2_Saudi Arabia_2014, complete genome 30.2 97.6 100% 0.030 100% KJ829365.1
Middle East respiratory syndrome coronavirus strain Greece-Saudi Arabia_2014 N protein (N) gene, complete cds 30.2 46.6 100% 0.030 100% KJ782550.1
Middle East respiratory syndrome coronavirus isolate Camel/Qatar_2_2014, complete genome 30.2 97.6 100% 0.030 100% KJ650098.1
Middle East respiratory syndrome coronavirus isolate KSA-CAMEL-378, complete genome 30.2 97.6 100% 0.030 100% KJ713296.1
Middle East respiratory syndrome coronavirus isolate KSA-CAMEL-505, complete genome 30.2 97.6 100% 0.030 100% KJ713295.1
Middle East respiratory syndrome coronavirus isolate Al-Hasa_28h_2013 N protein and ORF8b genes, complete cds 30.2 46.6 100% 0.030 100% KJ156909.1
Middle East respiratory syndrome coronavirus isolate Al-Hasa_27b_2013 ORF1ab gene, partial cds; and S protein, ORF3, ORF4a, ORF4b, ORF5, E protein, M protein, N protein, and ORF8b genes, complete cds 30.2 46.6 100% 0.030 100% KJ156939.1
Middle East respiratory syndrome coronavirus isolate Al-Hasa_26c_2013 ORF1ab gene, partial cds; and S protein, ORF3, ORF4a, ORF4b, ORF5, E protein, M protein, N protein, and ORF8b genes, complete cds 30.2 46.6 100% 0.030 100% KJ156872.1
Middle East respiratory syndrome coronavirus isolate Al-Hasa_19_2013, complete genome 30.2 97.6 100% 0.030 100% KF600632.1

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Thu Jun 18, 2015 11:46 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
A29714T
Middle East respiratory syndrome coronavirus isolate Florida/USA-2_Saudi Arabia_2014, complete genome 30.2 113 100% 0.030 100% KP223131.1
Middle East respiratory syndrome coronavirus isolate Riyadh_2014KSA_683/KSA/2014, complete genome 30.2 113 100% 0.030 100% KM027262.1
Middle East respiratory syndrome coronavirus isolate Makkah_C9355/KSA/Makkah/2014-04-15, complete genome 30.2 113 100% 0.030 100% KM027261.1
Middle East respiratory syndrome coronavirus isolate Jeddah_C10306/KSA/2014-04-20, complete genome 30.2 113 100% 0.030 100% KM027260.1
Middle East respiratory syndrome coronavirus isolate Jeddah_C9055/KSA/2014-04-14, complete genome 30.2 113 100% 0.030 100% KM027259.1
Middle East respiratory syndrome coronavirus isolate Jeddah_C8826/KSA/2014-04-12, complete genome 30.2 113 100% 0.030 100% KM027258.1
Middle East respiratory syndrome coronavirus isolate Jeddah_C7770/KSA/2014-04-07, complete genome 30.2 113 100% 0.030 100% KM027257.1
Middle East respiratory syndrome coronavirus isolate Jeddah_C7569/KSA/2014-04-03, complete genome 30.2 113 100% 0.030 100% KM027256.1
Middle East respiratory syndrome coronavirus isolate Jeddah_C7149/KSA/2014-04-05, complete genome 30.2 113 100% 0.030 100% KM027255.1
Middle East respiratory syndrome coronavirus isolate Jeddah-air-1-2014 N protein (N) gene, partial cds 30.2 30.2 100% 0.030 100% KJ741003.1
Middle East respiratory syndrome coronavirus isolate Netherlands_1_2014 nucleocapsid (N) gene, partial cds 30.2 30.2 100% 0.030 100% KJ858498.1
Middle East respiratory syndrome coronavirus strain Florida/USA-2_Saudi Arabia_2014, complete genome 30.2 113 100% 0.030 100% KJ829365.1
Middle East respiratory syndrome coronavirus strain Greece-Saudi Arabia_2014 N protein (N) gene, complete cds 30.2 46.6 100% 0.030 100% KJ782550.1
Middle East respiratory syndrome coronavirus strain Indiana/USA-1_Saudi Arabia_2014, complete genome 30.2 113 100% 0.030 100% KJ813439.1
Middle East respiratory syndrome coronavirus isolate Camel/Qatar_2_2014, complete genome 30.2 113 100% 0.030 100% KJ650098.1
Middle East respiratory syndrome coronavirus isolate KSA-CAMEL-378, complete genome 30.2 113 100% 0.030 100% KJ713296.1
Middle East respiratory syndrome coronavirus isolate KSA-CAMEL-505, complete genome 30.2 113 100% 0.030 100% KJ713295.1
Middle East respiratory syndrome coronavirus isolate MERS-CoV-Jeddah-Camel-1, complete genome 30.2 113 100% 0.030 100% KF917527.1
Middle East respiratory syndrome coronavirus isolate Jeddah_1_2013, complete genome 30.2 113 100% 0.030 100% KJ556336.1
Middle East respiratory syndrome coronavirus isolate Asir_1d_2013 N protein and ORF8b genes, complete cds 30.2 46.6 100% 0.030 100% KJ156883.1
Middle East respiratory syndrome coronavirus isolate Taif_3g_2013 M protein gene, partial cds; and N protein and ORF8b genes, complete cds 30.2 46.6 100% 0.030 100% KJ156906.1
Middle East respiratory syndrome coronavirus isolate Taif_4b_2013 M protein gene, partial cds; and N protein and ORF8b genes, complete cds 30.2 46.6 100% 0.030 100% KJ156871.1
Middle East respiratory syndrome coronavirus isolate Riyadh_4_2013, complete genome 30.2 113 100% 0.030 100% KJ156952.1
Middle East respiratory syndrome coronavirus isolate Taif_1_2013, complete genome 30.2 113 100% 0.030 100% KJ156949.1
Middle East respiratory syndrome coronavirus isolate Riyadh_5_2013, complete genome 30.2 113 100% 0.030 100% KJ156944.1
Middle East respiratory syndrome coronavirus isolate Wadi-Ad-Dawasir_1_2013, complete genome 30.2 113 100% 0.030 100% KJ156881.1
Middle East respiratory syndrome coronavirus isolate Riyadh_3_2013, complete genome 30.2 113 100% 0.030 100% KF600613.1
Human betacoronavirus 2c EMC/2012 strain Essen, partial genome 30.2 62.9 100% 0.030 100% KC875821.1

_________________
www.twitter.com/hniman


Top
 Profile  
 
Display posts from previous:  Sort by  
Post new topic Reply to topic  [ 7 posts ] 

All times are UTC - 5 hours [ DST ]


Who is online

Users browsing this forum: Google [Bot], Yahoo [Bot] and 47 guests


You cannot post new topics in this forum
You cannot reply to topics in this forum
You cannot edit your posts in this forum
You cannot delete your posts in this forum
You cannot post attachments in this forum

Search for:
Jump to:  
cron
Powered by phpBB® Forum Software © phpBB Group