Rhiza Labs FluTracker Forum

The place to discuss the flu
It is currently Mon Oct 16, 2017 10:00 pm

All times are UTC - 5 hours [ DST ]




Post new topic Reply to topic  [ 11 posts ]  Go to page 1, 2  Next
Author Message
PostPosted: Thu Jun 04, 2015 7:26 pm 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
CDC Release Full 2015 Riyadh MERS Sequences

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Thu Jun 04, 2015 7:26 pm 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
Middle East respiratory syndrome coronavirus strain Hu/Riyadh-KSA-2049/2015, complete genome
GenBank: KR011266.1
FASTA Graphics
Go to:
LOCUS KR011266 30096 bp RNA linear VRL 27-MAY-2015
DEFINITION Middle East respiratory syndrome coronavirus strain
Hu/Riyadh-KSA-2049/2015, complete genome.
ACCESSION KR011266
VERSION KR011266.1 GI:823104986
KEYWORDS .
SOURCE Middle East respiratory syndrome coronavirus (MERS-CoV)
ORGANISM Middle East respiratory syndrome coronavirus
Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA
stage; Nidovirales; Coronaviridae; Coronavirinae; Betacoronavirus;
unclassified Betacoronavirus.
REFERENCE 1 (bases 1 to 30096)
AUTHORS Lu,X., Saeed,A.A.B. and Erdman,D.D.
TITLE Direct Submission
JOURNAL Submitted (24-MAR-2015) Division of Viral Diseases, Centers for
Disease Control and Prevention, 1600 Clifton Rd., Atlanta, GA
30329, USA
COMMENT ##Assembly-Data-START##
Assembly Method :: Sequencher v. 5.2.4
Sequencing Technology :: Sanger dideoxy sequencing
##Assembly-Data-END##
FEATURES Location/Qualifiers
source 1..30096
/organism="Middle East respiratory syndrome coronavirus"
/mol_type="genomic RNA"
/strain="Hu/Riyadh-KSA-2049/2015"
/isolation_source="respiratory secretions"
/host="Homo sapiens"
/db_xref="taxon:1335626"
/country="Saudi Arabia"
/collection_date="06-Jan-2015"
CDS join(257..13411,13411..21492)
/ribosomal_slippage
/note="ORF1a protein"
/codon_start=1
/product="ORF1ab protein"
/protein_id="AKI29283.1"
/db_xref="GI:823104987"
/translation="MSFVAGVTAQGARGTYRAALNSEKHQDHVSLTVPLCGSGNLVEK
LSPWFIDGENAYEVVKAMLLKKEPLLYVPIRLAGHTRHLPGPRVYLVERLIACENPFM
VNQLAYSSSANGSLVGTTLQGKPIGMFFPYDIELVTGKQNILLRKYGRGGYHYTPFHY
ERDNTSCPEWMDDFEADPKGKYAQNLLKKLIGGDVTPVDQYMCGVDGKPISAYAFLMA
KDGITKLADVEADVAARADDEGFITLKNNLYRLVWHVERKDVPYPKQSIFTINSVVQK
DGVENTPPHYFTLGCKILTLTPRNKWSGVSDLSLKQKLLYTFYGKESLENPTYIYHSA
FIECGSCGNDSWLTGNAIQGFACGCGASYTANDVEVQSSGMIKPNALLCATCPFAKGD
SCSSNCKHSVAQLVSYLSERCNVIADPKSFTLIFGGVAYAYFGCEEGTMYFVPRAKSV
VSRIGDSVFTGCTGSWNKVTQIANMFLEQTQHSLNFVGEFVVNDVVLAILSGTTTNVD
KIRQLLKGVTLDKLRDYLADYDIAVTAGPFMDNAINVGGTGLQYAAITAPYVVLTGLG
ESFKKVATIPYKVCNSVKDTLTYYAHSVLYRVFPYDMDSGVSSFSELLFDCVDLSVAS
TYFLVRLLQDKAGDFMSTIITSCQTAVSKLLDTCFEATEATFNFLLDLAGLFRIFLRN
AYVYTSQGFVVVNGKVSTLVKQVLDLLNKGMQLLHTKVSWAGFNISAVIYSGRESLIF
PSGTYYCVTTKAKSVQQDLDVILPGEFSKKQLGLLQPTDNSTTVSVTVSSNMVETVVG
QLEQTNMHSPDVIVGDYVIISEKLFVRSKEEDGFAFYPACTNGHAVPTLFRLKGGAPV
KKVAFGGDQVHEVAAVRSVTVEYNIHAVLDTLLASSSLRTFVVDKSLSIEEFADVVKE
QVSDLLVKLLRGMPIPDFDLDDFIDAPCYCFNAEGDASWSSTMILSLHPVECDEECSE
VEASDLEEGESECISETSTEQVDVSHEISDDEWAAAVDEAFPLDEAEDVTESVQEEAQ
PVEVPVEDIAQVVIADTLQETPVVSDTVEVPPQVVKLPSEPQTIQPEVKEVAPVYEAD
TEQTQSVTVKPKRLRKKRNVDPLSNFEHKVITECVTIVLGDAIQVAKCYGESVLVNAA
NTHLKHGGGIAGAINAASKGAVQKESDEYILAKGPLQVGDSVLLQGHSLAKNILHVVG
PDARAKQDVSLLSKCYKAMNAYPLVVTPLVSAGIFGVKPAVSFDYLIREAKTRVLVVV
NSQDVYKSLTIVDIPQSLTFSYDGLRGAIRKAKDYGFTVFVCTDNSANTKVLRNKGVD
YTKKFFTVDGVQYYCYTSKDTLDDILQQANKSVGIISMPLGYVSHGLDLIQAGSVVRR
VNVPYVCLLANKEQEAILMSEDVKLNPSEDFIKHVRTNGGYNSWHLVEGELLVQDLRL
NKLLHWSDQTICYKDSVFYVVKNSTAFPFETLSACRAYLDSRTTQQLTIEVLVTVDGV
NFRTVVLNNKNTYRSQLGCVFFNGADISDTIPDEKQNGHSLYLADNLTADETKALKEL
YGPVDPTFLHRFYSLKAAVHKWKMVVCDKVRSLKLSDNNCYLNAVIMTLDLLKDIKFV
IPALQHAFMKHKGGDSTDFIALIMAYGNCTFGAPDDASRLLHTVLAKAELCCSARMVW
REWCNVCGIKDVVLQGLKACCYVGVQTVEDLRARMTYVCQCGGERHRQIVEHTTPWLL
LSGTPNEKLVTTSTAPDFVAFNVFQGIETAVGHYVHARLKGGLILKFDSGTVSKTSDW
KCKVTDVLFSGQKYSSDCNVVRYSLDGNFRTEVDPDLSAFYVKDGKYFTSEPPVTYSP
ATILAGSVYTNSCLVSSDGQPGGDAISLSFNNLLGFDSSKPVAKKYTYSFLPKEDGDV
LLAEFDTYDPIYKNGAMYKGKPILWVNKASYDTNLNKFNRASLRQIFDVAPIELENKF
TPLSVESTPVEPPTVDVVALQQEMTIVKCKGLNKPFVKDNVSFVADDSGTPVVEYLSK
EDLHTLYVDPKYQVIVLKDNVLSSMLRLHTVESGDINVVAASGSLTRKVKLLFRASFY
FKEFATRTFTATTAVGSCIKSVVRHLGVTKGILTGCFSFVKMLFMLPLAYFSDSKLGT
TEVKVSALKTAGVVTGNVVKQCCTAAVDLSMDKLRRVDWKSTLRLLLMLCTTMVLLSS
VYHLYVFNQVLSSDVMFEDAQGLKKFYKEVRAYLGISSACDGLASAYRANSFDVPTFC
ANRSAMCNWCLISQDSITHYPALKMVQTHLSHYVLNIDWLWFAFETGLAYMLYTSAFN
WLLLAGTLHYFFAQTSIFVDWRSYNYAVSSAFWLFTHIPMAGLVRMYNLLACLWLLRK
FYQHVINGCKDTACLLCYKRNRLTRVEASTVVCGGKRTFYITANGGISFCRRHNWNCV
DCDTAGVGNTFICEEVANDFTTALRRPINATDRSHYYVDSVTVKETVVQFNYRRDGQP
FYERFPLCAFTNLDKLKFKEVCKTTTGIPEYNFIIYDSSDRGQESLARSACVYYSQVL
CKSILLVDSSLVTSVGDSSEIATKMFDSFVNSFVSLYNVTRDKLEKLISTARDGVRRG
DNFHSVLTTFIDAARGPAGVESDVETNEIVDSVQYAHKHDIQITNESYNNYVPSYVKP
DSVSTSDLGSLIDCNAASVNQIVLRNSNGACIWNAAAYMKLSDALKRQIRIACRKCNL
AFRLTTSKLRANDNILSVRFTANKIVGGAPTWFNALRDFTLKGYVLATIIVFLCAVLM
YLCLPTFSMVPVEFYEDRILDFKVLDNGIIRDVNPDDKCFANKHRSFTQWYHEHVGGV
YDNSITCPLTVAVIAGVAGARIPDVPTTLAWLNNQIIFFVSRVFANTGSVCYTPIDEI
PYKSFSDSGCILPSECTMFRDAEGRMTPYCHDPTVLPGAFAYSQMRPHVRYDLYDGNM
FIKFPEVVFESTLRITRTLSTQYCRFGSCEYAQEGVCITTNGSWAIFNDHHLNRPGVY
CGSDFIDIVRRLAVSLFQPITYFQLTTSLVLGIGLCAFLTLLFYYINKVKRAFADYTQ
CAVIAVVAAVLNSLCICFVASIPLCIVPYTALYYYATFYFTNEPAFIMHVSWYIMFGP
IVPIWMTCVYTVAMCFRHFFWVLAYFSKKHVEVFTDGKLNCSFQDAASNIFVINKDTY
AALRNSLTNDAYSRFLGLFNKYKYFSGAMETAAYREAAACHLAKALQTYSETGSDLLY
QPPNCSITSGVLQSGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCP
ADQLSDPNYDALLISMTNHSFSVQKHIGAPANLRVVGHAMQGTLLKLTVDVANPSTPA
YTFTTVKPGAAFSVLACYNGRPTGTFTVVMRPNYTIKGSFLCGSCGSVGYTKEGSVIN
FCYMHQMELANGTHTGSAFDGTMYGAFMDKQVHQVQLTDKYCSVNVVAWLYAAILNGC
AWFVKPNRTSVVSFNEWALANQFTEFVGTQSVDMLAVKTGVAIEQLLYAIQQLYTGFQ
GKQILGSTMLEDEFTPEDVNMQIMGVVMQSGVRKVTYGTAHWLFATLVSTYVIILQAT
KFTLWNYLFETIPTQLFPLLFVTMAFVMLLVKHKHTFLTLFLLPVAICLTYANIVYEP
TTPISSALIAVANWLAPTNAYMRTTHTDIGVYISMSLVLVIVVKRLYNPSLSNFALAL
CSGVMWLYTYSIGEASSPIAYLVFVTTLTSDYTITVFVTVNLAKVCTYAIFAYSPQLT
LVFPEVKMILLLYTCLGFMCTCYFGVFSLLNLKLRAPMGVYDFKVSTQEFRFMTANNL
TAPRNSWEAMALNFKLIGIGGTPCIKVAAMQSKLTDLKCTSVVLLSVLQQLHLEANSR
AWAFCVKCHNDILAATDPSEAFEKFVSLFATLMTFSGNVDLDALASDIFDTPSVLQAT
LSEFSHLATFAELEAAQKAYQEAMDSGDTSPQVLKALQKAVNIAKNAYEKDKAVARKL
ERMADQAMTSMYKQARAEDKKAKIVSAMQTMLFGMIKKLDNDVLNGIISNARNGCIPL
SVIPLCASNKLRVVIPDFTVWNQVVTYPSLNYAGALWDITVINNVDNEIVKSSDVVDS
NENLTWPLVLECTRASTSAVKLQNNEIKPSGLKTMVVSAGQEQTNCNTSSLAYYEPVQ
GRKMLMALLSDNAYLKWARVEGKDGFVSVELQPPCKFLIAGPKGPEIRYLYFVKNLNN
LHRGQVLGHIAATVRLQAGSNTEFASNSSVLSLVNFTVDPQKAYLDFVNAGGAPLTNC
VKMLTPKTGTGIAISVKPESTADQETYGGASVCLYCRAHIEHPDVSGVCKYKGKFVQI
PAQCVRDPVGFCLSNTPCNVCQYWIGYGCNCDSLRQATLPQSKDSNFLNRVRGSIVNA
RIEPCSSGLSTDVVFRAFDICNYKAKVAGIGKYYKTNTCRFVELDDQGHHLDSYFVVK
RHTMENYELEKHCYDLLRDCDAVAPHDFFIFDVDKVKTPHIVRQRLTEYTMMDLVYAL
RHFDQNSEVLKAILVKYGCCDVTYFENKLWFDFVENPSVIGVYHKLGERVRQAILNTV
KFCDHMVKAGLVGVLTLDNQDLNGKWYDFGDFVITQPGSGVAIVDSYYSYLMPVLSMT
DCLAAETHRDCDFNKPLIEWPLTEYDFTDYKVQLFEKYFKYWDQTYHANCVNCTDDRC
VLHCANFNVLFAMTMPKTCFGPIVRKIFVDGVPFVVSCGYHYKELGLVMNMDVSLHRH
RLSLKELMMYAADPAMHIASSNAFLDLRTSCFSVAALTTGLTFQTVRPGNFNQDFYDF
VVSKGFFKEGSSVTLKHFFFAQDGNAAITDYNYYSYNLPTMCDIKQMLFCMEVVNKYF
EIYDGGCLNASEVVVNNLDKSAGHPFNKFGKARVYYESMSYQEQDELFAMTKRNVIPT
MTQMNLKYAISAKNRARTVAGVSILSTMTNRQYHQKMLKSMAATRGATCVIGTTKFYG
GWDFMLKTLYKDVDNPHLMGWDYPKCDRAMPNMCRIFASLILARKHATCCTTRDRFYR
LANECAQVLSEYVLCGGGYYVKPGGTSSGDATTAYANSVFNILQATTANVSALMGANG
NKIVDKEVKDMQFDLYVNVYRSTSPDPKFVDKYYAFLNKHFSMMILSDDGVVCYNSDY
AAKGYIAGIQNFKETLYYQNNVFMSEAKCWVETDLKKGPHEFCSQHTLYIKDGDDGYF
LPYPDPSRILSAGCFVDDIVKTDGTLMVERFVSLAIDAYPLTKHEDIEYQNVFWVYLQ
YIEKLYKDLTGHMLDSYSVMLCGDNSAKFWEEAFYRDLYSSPTTLQAVGSCVVCHSQT
SLRCGTCIRRPFLCCKCCYDHVIATPHKMVLSVSPYVCNAPGCGVSDVTKLYLGGMSY
FCVDHRPVCSFPLCANGLVFGLYKNMCTGSPSIVEFNRLATCDWTESGDYTLANTTTE
PLKLFAAETLRATEEASKQSYAIATIKEIVGERQLLLVWEAGKSKPPLNRNYVFTGYH
ITKNSKVQLGEYIFERIDYSDAVSYKSSTTYKLTVGDIFVLTSHSVATLTAPTIVNQE
RYVKITGLYPTITVPEEFASHVANFQKSGYSKYVTVQGPPGTGKSHFAIGLAIYYPTA
RVVYTACSHAAVDALCEKAFKYLNIAKCSRIIPAKARVECYDRFKVNETNSQYLFSTI
NALPETSADILVVDEVSMCTNYDLSIINARIKAKHIVYVGDPAQLPAPRTLLTRGTLE
PENFNSVTRLMCNLGPDIFLSMCYRCPKEIVSTVSALVYNNKLLAKKELSGQCFKILY
KGNVTHDASSAINRPQLTFVKNFITANPAWSKAVFISPYNSQNAVARSMLGLTTQTVD
SSQGSEYQYVIFCQTADTAHANNINRFNVAITRAQKGILCVMTSQALFESLEFTELSF
TNYKLQSQIVTGLFKDCSRETSGLSPAYAPTYVSVDDKYKTSDELCVNLNLPANVPYS
RVISRMGFKLDATVPGYPKLFITREEAVRQVRSWIGFDVEGAHASRNACGTNVPLQLG
FSTGVNFVVQPVGVVDTEWGNMLTGIAARPPPGEQFKHLVPLMHKGAAWPIVRRRIVQ
MLSDTLDKLSDYCTFVCWAHGFELTSASYFCKIGKEQKCCMCNRRAAAYSSPLQSYAC
WTHSCGYDYVYNPFFVDVQQWGYVGNLATNHDRYCSVHQGAHVASNDAIMTRCLAIHS
CFIERVDWDIEYPYISHEKKLNSCCRIVERNVVRAALLAGSFDKVYDIGNPKGIPIVD
DPVVDWHYFDAQPLTRKVQQLFYTEDMASRFADGLCLFWNCNVPKYPNNAIVCRFDTR
VHSEFNLPGCDGGSLYVNKHAFHTPAYDVSAFRDLKPLPFFYYSTTPCEVHGNGSMIE
DIDYVPLKSAVCITACNLGGAVCRKHATEYREYMEAYNLVSASGFRLWCYKTFDIYNL
WSTFTKVQGLENIAFNFVKQGHFIGVEGELPVAVVNDKIFTKSGVNDICMFENKTTLP
TNIAFELYAKRAVRSHPDFKLLHNLQADICYKFVLWDYERSNIYGTATIGVCKYTDID
VNSALNICFDIRDNGSLEKFMSTPNAIFISDRKIKKYPCMVGPDYAYFNGAIIRDSDV
VKQPVKFYLYKKVNNEFIDPTECIYTQSRSCSDFLPLSDMEKDFLSFDSDVFIKKYGL
ENYAFEHVVYGDFSHTTLGGLHLLIGLYKKQQEGHIIMEEMLKGSSTIHNYFITETNT
AAFKAVCSVIDLKLDDFVMILKSQDLGVVSKVVKVPIDLTMIEFMLWCKDGQVQTFYP
RLQASADWKPGHAMPSLFKVQNVNLERCELANYKQSIPMPRGVHMNIAKYMQLCQYLN
TCTLAVPANMRVIHFGAGSDKGIAPGTSVLRQWLPTDAIIIDNDLNEFVSDADITLFG
DCVTVRVGQQVDLVISDMYDPTTKNVTGSNESKALFFTYLCNLINNNLALGGSVAIKI
TEHSWSVELYELMGKFAWWTVFCTNANASSSEGFLLGINYLGTIKENIDGGAMHANYI
FWRNSTPMNLSTYSLFDLSKFQLKLKGTPVLQLKESQINELVISLLSQGKLLIRDNDT
LSVSTDVLVNTYRKLR"
CDS 257..13432
/codon_start=1
/product="ORF1a protein"
/protein_id="AKI29292.1"
/db_xref="GI:823104996"
/translation="MSFVAGVTAQGARGTYRAALNSEKHQDHVSLTVPLCGSGNLVEK
LSPWFIDGENAYEVVKAMLLKKEPLLYVPIRLAGHTRHLPGPRVYLVERLIACENPFM
VNQLAYSSSANGSLVGTTLQGKPIGMFFPYDIELVTGKQNILLRKYGRGGYHYTPFHY
ERDNTSCPEWMDDFEADPKGKYAQNLLKKLIGGDVTPVDQYMCGVDGKPISAYAFLMA
KDGITKLADVEADVAARADDEGFITLKNNLYRLVWHVERKDVPYPKQSIFTINSVVQK
DGVENTPPHYFTLGCKILTLTPRNKWSGVSDLSLKQKLLYTFYGKESLENPTYIYHSA
FIECGSCGNDSWLTGNAIQGFACGCGASYTANDVEVQSSGMIKPNALLCATCPFAKGD
SCSSNCKHSVAQLVSYLSERCNVIADPKSFTLIFGGVAYAYFGCEEGTMYFVPRAKSV
VSRIGDSVFTGCTGSWNKVTQIANMFLEQTQHSLNFVGEFVVNDVVLAILSGTTTNVD
KIRQLLKGVTLDKLRDYLADYDIAVTAGPFMDNAINVGGTGLQYAAITAPYVVLTGLG
ESFKKVATIPYKVCNSVKDTLTYYAHSVLYRVFPYDMDSGVSSFSELLFDCVDLSVAS
TYFLVRLLQDKAGDFMSTIITSCQTAVSKLLDTCFEATEATFNFLLDLAGLFRIFLRN
AYVYTSQGFVVVNGKVSTLVKQVLDLLNKGMQLLHTKVSWAGFNISAVIYSGRESLIF
PSGTYYCVTTKAKSVQQDLDVILPGEFSKKQLGLLQPTDNSTTVSVTVSSNMVETVVG
QLEQTNMHSPDVIVGDYVIISEKLFVRSKEEDGFAFYPACTNGHAVPTLFRLKGGAPV
KKVAFGGDQVHEVAAVRSVTVEYNIHAVLDTLLASSSLRTFVVDKSLSIEEFADVVKE
QVSDLLVKLLRGMPIPDFDLDDFIDAPCYCFNAEGDASWSSTMILSLHPVECDEECSE
VEASDLEEGESECISETSTEQVDVSHEISDDEWAAAVDEAFPLDEAEDVTESVQEEAQ
PVEVPVEDIAQVVIADTLQETPVVSDTVEVPPQVVKLPSEPQTIQPEVKEVAPVYEAD
TEQTQSVTVKPKRLRKKRNVDPLSNFEHKVITECVTIVLGDAIQVAKCYGESVLVNAA
NTHLKHGGGIAGAINAASKGAVQKESDEYILAKGPLQVGDSVLLQGHSLAKNILHVVG
PDARAKQDVSLLSKCYKAMNAYPLVVTPLVSAGIFGVKPAVSFDYLIREAKTRVLVVV
NSQDVYKSLTIVDIPQSLTFSYDGLRGAIRKAKDYGFTVFVCTDNSANTKVLRNKGVD
YTKKFFTVDGVQYYCYTSKDTLDDILQQANKSVGIISMPLGYVSHGLDLIQAGSVVRR
VNVPYVCLLANKEQEAILMSEDVKLNPSEDFIKHVRTNGGYNSWHLVEGELLVQDLRL
NKLLHWSDQTICYKDSVFYVVKNSTAFPFETLSACRAYLDSRTTQQLTIEVLVTVDGV
NFRTVVLNNKNTYRSQLGCVFFNGADISDTIPDEKQNGHSLYLADNLTADETKALKEL
YGPVDPTFLHRFYSLKAAVHKWKMVVCDKVRSLKLSDNNCYLNAVIMTLDLLKDIKFV
IPALQHAFMKHKGGDSTDFIALIMAYGNCTFGAPDDASRLLHTVLAKAELCCSARMVW
REWCNVCGIKDVVLQGLKACCYVGVQTVEDLRARMTYVCQCGGERHRQIVEHTTPWLL
LSGTPNEKLVTTSTAPDFVAFNVFQGIETAVGHYVHARLKGGLILKFDSGTVSKTSDW
KCKVTDVLFSGQKYSSDCNVVRYSLDGNFRTEVDPDLSAFYVKDGKYFTSEPPVTYSP
ATILAGSVYTNSCLVSSDGQPGGDAISLSFNNLLGFDSSKPVAKKYTYSFLPKEDGDV
LLAEFDTYDPIYKNGAMYKGKPILWVNKASYDTNLNKFNRASLRQIFDVAPIELENKF
TPLSVESTPVEPPTVDVVALQQEMTIVKCKGLNKPFVKDNVSFVADDSGTPVVEYLSK
EDLHTLYVDPKYQVIVLKDNVLSSMLRLHTVESGDINVVAASGSLTRKVKLLFRASFY
FKEFATRTFTATTAVGSCIKSVVRHLGVTKGILTGCFSFVKMLFMLPLAYFSDSKLGT
TEVKVSALKTAGVVTGNVVKQCCTAAVDLSMDKLRRVDWKSTLRLLLMLCTTMVLLSS
VYHLYVFNQVLSSDVMFEDAQGLKKFYKEVRAYLGISSACDGLASAYRANSFDVPTFC
ANRSAMCNWCLISQDSITHYPALKMVQTHLSHYVLNIDWLWFAFETGLAYMLYTSAFN
WLLLAGTLHYFFAQTSIFVDWRSYNYAVSSAFWLFTHIPMAGLVRMYNLLACLWLLRK
FYQHVINGCKDTACLLCYKRNRLTRVEASTVVCGGKRTFYITANGGISFCRRHNWNCV
DCDTAGVGNTFICEEVANDFTTALRRPINATDRSHYYVDSVTVKETVVQFNYRRDGQP
FYERFPLCAFTNLDKLKFKEVCKTTTGIPEYNFIIYDSSDRGQESLARSACVYYSQVL
CKSILLVDSSLVTSVGDSSEIATKMFDSFVNSFVSLYNVTRDKLEKLISTARDGVRRG
DNFHSVLTTFIDAARGPAGVESDVETNEIVDSVQYAHKHDIQITNESYNNYVPSYVKP
DSVSTSDLGSLIDCNAASVNQIVLRNSNGACIWNAAAYMKLSDALKRQIRIACRKCNL
AFRLTTSKLRANDNILSVRFTANKIVGGAPTWFNALRDFTLKGYVLATIIVFLCAVLM
YLCLPTFSMVPVEFYEDRILDFKVLDNGIIRDVNPDDKCFANKHRSFTQWYHEHVGGV
YDNSITCPLTVAVIAGVAGARIPDVPTTLAWLNNQIIFFVSRVFANTGSVCYTPIDEI
PYKSFSDSGCILPSECTMFRDAEGRMTPYCHDPTVLPGAFAYSQMRPHVRYDLYDGNM
FIKFPEVVFESTLRITRTLSTQYCRFGSCEYAQEGVCITTNGSWAIFNDHHLNRPGVY
CGSDFIDIVRRLAVSLFQPITYFQLTTSLVLGIGLCAFLTLLFYYINKVKRAFADYTQ
CAVIAVVAAVLNSLCICFVASIPLCIVPYTALYYYATFYFTNEPAFIMHVSWYIMFGP
IVPIWMTCVYTVAMCFRHFFWVLAYFSKKHVEVFTDGKLNCSFQDAASNIFVINKDTY
AALRNSLTNDAYSRFLGLFNKYKYFSGAMETAAYREAAACHLAKALQTYSETGSDLLY
QPPNCSITSGVLQSGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCP
ADQLSDPNYDALLISMTNHSFSVQKHIGAPANLRVVGHAMQGTLLKLTVDVANPSTPA
YTFTTVKPGAAFSVLACYNGRPTGTFTVVMRPNYTIKGSFLCGSCGSVGYTKEGSVIN
FCYMHQMELANGTHTGSAFDGTMYGAFMDKQVHQVQLTDKYCSVNVVAWLYAAILNGC
AWFVKPNRTSVVSFNEWALANQFTEFVGTQSVDMLAVKTGVAIEQLLYAIQQLYTGFQ
GKQILGSTMLEDEFTPEDVNMQIMGVVMQSGVRKVTYGTAHWLFATLVSTYVIILQAT
KFTLWNYLFETIPTQLFPLLFVTMAFVMLLVKHKHTFLTLFLLPVAICLTYANIVYEP
TTPISSALIAVANWLAPTNAYMRTTHTDIGVYISMSLVLVIVVKRLYNPSLSNFALAL
CSGVMWLYTYSIGEASSPIAYLVFVTTLTSDYTITVFVTVNLAKVCTYAIFAYSPQLT
LVFPEVKMILLLYTCLGFMCTCYFGVFSLLNLKLRAPMGVYDFKVSTQEFRFMTANNL
TAPRNSWEAMALNFKLIGIGGTPCIKVAAMQSKLTDLKCTSVVLLSVLQQLHLEANSR
AWAFCVKCHNDILAATDPSEAFEKFVSLFATLMTFSGNVDLDALASDIFDTPSVLQAT
LSEFSHLATFAELEAAQKAYQEAMDSGDTSPQVLKALQKAVNIAKNAYEKDKAVARKL
ERMADQAMTSMYKQARAEDKKAKIVSAMQTMLFGMIKKLDNDVLNGIISNARNGCIPL
SVIPLCASNKLRVVIPDFTVWNQVVTYPSLNYAGALWDITVINNVDNEIVKSSDVVDS
NENLTWPLVLECTRASTSAVKLQNNEIKPSGLKTMVVSAGQEQTNCNTSSLAYYEPVQ
GRKMLMALLSDNAYLKWARVEGKDGFVSVELQPPCKFLIAGPKGPEIRYLYFVKNLNN
LHRGQVLGHIAATVRLQAGSNTEFASNSSVLSLVNFTVDPQKAYLDFVNAGGAPLTNC
VKMLTPKTGTGIAISVKPESTADQETYGGASVCLYCRAHIEHPDVSGVCKYKGKFVQI
PAQCVRDPVGFCLSNTPCNVCQYWIGYGCNCDSLRQATLPQSKDSNFLNESGVLL"
CDS 21434..25495
/codon_start=1
/product="S protein"
/protein_id="AKI29284.1"
/db_xref="GI:823104988"
/translation="MIHSVFLLMFLLTPTESYVDVGPDSVKSACIEVDIQQTFFDKTW
PRPIDVSKADGIIYPQGRTYSNITITYQGLFPYQGDHGDMYVYSAGHATGTTPQKLFV
ANYSQDVKQFANGFVVRIGAAANSTGTVIISPSTSATIRKIYPAFMLGSSVGNFSDGK
MGRFFNHTLVLLPDGCGTLLRAFYCILEPRSGNHCPAGNSYTSFATYHTPATDCSDGN
YNRNASLNSFKEYFNLRNCTFMYTYNITEDEILEWFGITQTAQGVHLFSSRYVDLYGG
NMFQFATLPVYDTIKYYSIIPHSIRSIQSDRKAWAAFYVYKLQPLTFLLDFSVDGYIR
RAIDCGFNDLSQLHCSYESFDVESGVYSVSSFEAKPSGSVVEQAEGVECDFSPLLSGT
PPQVYNFKRLVFTNCNYNLTKLLSLFSVNDFTCSQISPAAIASNCYSSLILDYFSYPL
SMKSDLSVSSAGPISQFNYKQSFSNPTCLILATVPHNLTTITKPLKYSYINKCSRLLS
DDRTEVPQLVNANQYSPCVSIVPSTVWEDGDYYRKQLSPLEGGGWLVASGSTVAMTEQ
LQMGFGITVQYGTDTNSVCPKLEFANDTKIASQLGNCVEYSLYGVSGRGVFQNCTAVG
VRQQRFVYDAYQNLVGYYSDDGNYYCLRACVSVPVSVIYDKETKTHATLFGSVACEHI
SSTMSQYSRSTRSMLKRRDSTYGPLQTPVGCVLGLVNSSLFVEDCKLPLGQSLCALPD
TPSTLTPRSVRSVPGEMRLASIAFNHPIQVDQLNSSYFKLSIPTNFSFGVTQEYIQTT
IQKVTVDCKQYVCNGFQKCEQLLREYGQFCSKINQALHGANLRQDDSVRNLFASVKSS
QSSPIIPGFGGDFNLTLLEPVSISTGSRSARSAIEDLLFDKVTIADPGYMQGYDDCMQ
QGPASARDLICAQYVAGYKVLPPLMDVNMEAAYTSSLLGSIAGVGWTAGLSSFAAIPF
AQSIFYRLNGVGITQQVLSENQKLIANKFNQALGAMQTGFTTTNEAFRKVQDAVNNNA
QALSKLASELSNTFGAISASIGDIIQRLDVLEQDAQIDRLINGRLTTLNAFVAQQLVR
SESAALSAQLAKDKVNECVKAQSKRSGFCGQGTHIVSFVVNAPNGLYFMHVGYYPSNH
IEVVSAYGLCDAANPTNCIAPVNGYFIKTNNTRIVDEWSYTGSSFYAPEPITSLNTKY
VAPQVTYQNISTNLPPPLLGNSTGIDFQDELDEFFKNVSTSIPNFGSLTQINTTLLDL
TYEMLSLQQVVKALNESYIDLKELGNYTYYNKWPWYIWLGFIAGLVALALCAFFILCC
TGCGTNCMGKLKCNRCCDRYEEYDLEPHKVHVH"
CDS 25510..25821
/codon_start=1
/product="NS3A protein"
/protein_id="AKI29285.1"
/db_xref="GI:823104989"
/translation="MRVQRPPTLLLVFSLSLLVTAFSKPLYVPEHCQNYSGCMLRACI
KTAQADTAGLYTNFRIDVPSAESTGTQSVSVDRESTSTHDGPTEHVTSVNLFDVGYSV
N"
CDS 25830..26159
/codon_start=1
/product="NS3B protein"
/protein_id="AKI29286.1"
/db_xref="GI:823104990"
/translation="MDYVSLLNQIWQKYLNSPYTTCLYIPKPTAKYTPLVGTSLHPVL
WNCQLSFAGYTESAVNSTKALAKQDAAQRIAWLLHKDGGIPDGCSLYLRHSSLFAQSE
EEESFSN"
CDS 26071..26811
/codon_start=1
/product="NS3C protein"
/protein_id="AKI29287.1"
/db_xref="GI:823104991"
/translation="MEESLMDVPSTSGTQVYSRKARKRSHSPTKKLRYVKRRFSLLRP
EDLSVIVQPTHYVRVTFSDPNMWYLRSGHHLHSVHNWLKPYGGQPVSEYHITLALLNL
TDEDLARDFSPIALFLRNVRFELHEFALLRKTLVLNASEIYCANIHRFKPVYRVNTAI
PTIKDWLLVQGFSLYHSGLPLHMSISKLHALDDVTRNYIITMPCFRTYPQQMFVTPLA
VDVVSIRSSNQGNKQIVHSYPILHHPGF"
CDS 26818..27492
/codon_start=1
/product="NS3D protein"
/protein_id="AKI29288.1"
/db_xref="GI:823104992"
/translation="MAFSASLFKPVQLVPVSPAFHRIESTDSIVFTYIPASGYVAALA
VNVCLIPLLLLLRQDTCRRSIIRTMVLYFLVLYNFLLAIVLVNGVHYPTGSCLIAFLV
ILIILWFVDRIRFCLMLNSYIPLFDMRSHFIRVSTVSSHGMVPVIHTKPLFIRNFDQR
CSCSRCFYLHSSTYIECTYISRFSKISLVSVTDFSLNGNVSTVFVPATRDSVPLHIIA
PSSLIV"
CDS 27568..27816
/codon_start=1
/product="E protein"
/protein_id="AKI29289.1"
/db_xref="GI:823104993"
/translation="MLPFVQERIGLFIVNFFIFTVVCAITLLVCMAFLTATRLCVQCM
TGFNTLLVQPALYLYNTGRSVYVKFQDSKPPLPPDEWV"
CDS 27831..28490
/codon_start=1
/product="M protein"
/protein_id="AKI29290.1"
/db_xref="GI:823104994"
/translation="MSNMTQLTEAQIIAIIKDWNFAWSLIFLLITIVLQYGYPSRSMT
VYVFKMFVLWLLWPSSMALSIFSAIYPIDLASQIISGIVAAVSAMMWISYFVQSIRLF
MRTGSWWSFNPETNCLLNVPFGGTTVVRPLVEDSTSVTAVVTNGHLKMAGMHFGACDY
DRLPNEVTVAKPNVLIALKMVKRQSYGTNSGVAIYHRYKAGNYRSPPITADIELALLR
A"
CDS 28544..29785
/codon_start=1
/product="N protein"
/protein_id="AKI29291.1"
/db_xref="GI:823104995"
/translation="MASPAAPRAVSFADNNDITNTNLSRGRGRNPKPRAAPNNTVSWY
TGLTQHGKVPLTFPPGQGVPLNANSTPAQNAGYWRRQDRKINTGNGIKQLAPRWYFYY
TGTGPEAALPFRAVKDGIVWVHEDGATDAPSTFGTRNPNNDSAIVTQFAPGTKLPKNF
HIEGTGGNSQSSSRASSVSRNSSRSSSQGSRSGNSTRGTSPGPSGIGAVGGDLLYLDL
LNRLQALESGKVKQSQPKVITKKDAAAAKNKMRHKRTSTKSFNMVQAFGLRGPGDLQG
NFGDLQLNKLGTEDPRWPQIAELAPTASAFMGMSQFKLTHQNNDDHGNPVYFLRYSGA
IKLDPKNPNYNKWLELLEQNIDAYKTFPKKEKKQKAPKEESTDQMSEPPKEQRVQGSI
TQRIRTRPSVQPGPMIDVNTD"

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Thu Jun 04, 2015 7:27 pm 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
1 atctcacttc ccctcgttct cttgcagaac tttgatttta acgaacttaa ataaaagccc
61 tgttgtttag cgtattgttg cacttgtctg gtgggattgt ggcattaatt tgcctgctca
121 tctaggcagt ggacatatgc tcaacactgg gtataattct aattgaatac tatttttcag
181 ttagagcgtc gtgtctcttg tacgtctcgg tcacaataca cggtttcgtc cggtgcgtgg
241 caattcgggg cacatcatgt ctttcgtggc tggtgtgacc gcgcaaggtg cgcgcggtac
301 gtatcgagca gcgctcaact ctgaaaaaca tcaagaccat gtgtctctaa ctgtgccact
361 ctgtggttca ggaaacctgg ttgaaaaact ttcaccatgg ttcattgatg gcgaaaatgc
421 ctatgaagtg gtgaaggcca tgttacttaa aaaggagcca cttctctatg tgcccatccg
481 gctggctgga cacactagac acctcccagg tcctcgtgta tacctggttg agaggctcat
541 tgcttgtgaa aatccattca tggttaacca attggcttat agctctagtg caaatggcag
601 cttggttggc acaactttgc agggcaagcc tattggtatg ttcttccctt atgacatcga
661 acttgtcaca ggaaagcaaa atattctcct gcgcaagtat ggccgtggtg gttatcacta
721 caccccattc cactatgagc gagacaacac ctcttgccct gagtggatgg acgattttga
781 ggcggatcct aaaggcaaat atgcccagaa tctgcttaag aagttgattg gcggtgatgt
841 cactccagtt gaccaataca tgtgtggcgt tgatggaaaa cccattagtg cctacgcatt
901 tttaatggcc aaggatggaa taaccaaact ggctgatgtt gaagcggacg tcgcagcacg
961 tgctgatgac gaaggcttca tcacattaaa gaacaatcta tatagattgg tttggcatgt
1021 tgagcgtaaa gacgttccat atcctaagca atctattttt actattaata gtgtggtcca
1081 aaaggatggt gttgaaaaca ctcctcctca ctattttact cttggatgca aaattttaac
1141 gctcacccca cgcaacaagt ggagtggcgt ttctgacttg tccctcaaac aaaaactcct
1201 ttacaccttc tatggtaagg agtcacttga gaacccaacc tacatttacc actccgcatt
1261 cattgagtgt ggaagttgtg gtaatgattc ctggcttaca gggaatgcta tccaagggtt
1321 tgcctgtgga tgtggggcat catatacagc taatgatgtc gaagtccaat catctggcat
1381 gattaagcca aatgctcttc tttgtgctac ttgccccttt gctaagggtg atagctgttc
1441 ttctaattgc aaacattcag ttgctcagtt ggttagttac ctttctgaac gttgtaatgt
1501 tattgctgat cctaagtcct tcacacttat ctttggtggc gtagcttacg cctactttgg
1561 atgtgaggaa ggtactatgt actttgtgcc tagagctaag tctgttgtct caaggattgg
1621 agactccgtc tttacaggct gtactggctc ttggaacaag gttactcaaa ttgctaacat
1681 gttcttggaa cagactcagc attcccttaa ctttgtggga gagttcgttg tcaacgatgt
1741 tgtcctcgca attctctctg gaaccacaac taatgttgac aaaatacgcc agcttctcaa
1801 gggtgtcacc cttgacaagt tgcgtgatta tttagctgac tatgacatag cagtcactgc
1861 cggcccattc atggataatg ctattaatgt tggtggtaca ggattacagt atgccgccat
1921 tactgcacct tatgtagttc tcactggctt aggtgagtcc tttaagaaag ttgcaaccat
1981 accgtacaag gtttgcaact ctgttaagga tactctgact tattatgctc acagcgtgtt
2041 gtacagagtt tttccttatg acatggattc tggtgtgtca tcttttagtg aactactttt
2101 tgattgcgtt gatctttcag tagcttctac ctatttttta gtccgcctct tgcaagataa
2161 ggctggcgac tttatgtcta caattattac ttcctgccaa actgctgtta gtaagcttct
2221 agatacatgt tttgaagcta cagaagcaac atttaacttc ttgttagatt tggcaggatt
2281 gttcagaatc tttcttcgca atgcctatgt gtacacttca caagggtttg tggtggtcaa
2341 tggcaaagtt tctacacttg tcaaacaagt gttagacttg cttaataagg gtatgcaact
2401 tttgcataca aaggtctcct gggctggttt taatatcagt gctgttatct acagcggcag
2461 ggagtctcta atattcccat cgggaaccta ttactgtgtc accactaagg ctaagtccgt
2521 tcaacaagat cttgacgtta ttttgcctgg tgagttttcc aagaagcagt taggactgct
2581 ccaacctact gacaattcta caactgttag tgttactgta tccagtaaca tggttgaaac
2641 tgttgtgggt caacttgagc aaactaatat gcatagtcct gatgttatag taggtgacta
2701 tgtcattatt agtgaaaaat tgtttgtgcg tagtaaggaa gaagacggat ttgccttcta
2761 ccctgcttgc actaatggtc atgctgtacc gactctcttt agacttaagg gaggtgcacc
2821 tgtaaaaaaa gtagcctttg gcggtgatca agtacatgag gttgctgctg taagaagtgt
2881 tactgtcgag tacaacattc atgctgtatt agacacacta cttgcttctt ctagtcttag
2941 aacctttgtt gtagataagt ctttgtcaat tgaggagttt gctgacgtag taaaggaaca
3001 agtctcagac ttgcttgtta aattactgcg tggaatgccg attccagatt ttgatttaga
3061 cgattttatt gacgcaccat gctattgctt taacgctgag ggtgatgcat cttggtcttc
3121 tactatgatc ctctctcttc accccgtcga gtgtgacgag gagtgttctg aagtagaggc
3181 ttcagattta gaagaaggtg aatcagagtg catttctgag acttcaactg aacaagttga
3241 cgtttctcat gagatttctg acgacgagtg ggctgctgca gttgatgaag cgttccctct
3301 cgatgaagca gaagatgtta ctgaatctgt gcaagaagaa gcacaaccag tagaagtacc
3361 tgttgaagat attgcgcagg ttgtcatagc tgacacctta caggaaactc ctgttgtgtc
3421 tgatactgtt gaagtcccac cgcaagtggt gaaacttccg tctgaacctc agactatcca
3481 gcccgaggta aaagaagttg cacctgtcta tgaggctgat accgaacaga cacagagtgt
3541 tactgttaaa cctaagaggt tacgcaaaaa gcgtaatgtt gaccctttgt ccaattttga
3601 acataaggtt attacagagt gcgttaccat agttttaggt gacgcaattc aagtagccaa
3661 gtgctatggt gagtctgtgt tagttaatgc tgctaacaca catcttaagc atggcggtgg
3721 tatcgctggt gctattaatg cggcttcaaa aggggctgtc caaaaagagt cagatgagta
3781 tattctggct aaagggccgt tacaagtagg agattcagtt ctcttgcaag gccattctct
3841 agctaagaat atcctgcatg tcgtaggccc agatgcccgc gctaaacagg atgtttctct
3901 ccttagtaag tgctataagg ctatgaatgc atatcctctt gtagtcactc ctcttgtttc
3961 agcaggcata tttggtgtaa aaccagctgt gtcttttgat tatcttatta gagaggctaa
4021 gactagagtt ttagtcgtcg ttaattccca agatgtctat aagagtctta ccatagttga
4081 cattccacag agtttgactt tttcatatga tgggttacgt ggcgcaatac gtaaagctaa
4141 agattatggt tttactgttt ttgtgtgcac agacaactct gctaacacta aagttcttag
4201 gaacaagggt gttgattata ctaagaagtt ttttacagtt gacggtgtgc aatattattg
4261 ctacacgtct aaggacactt tagatgatat cttacaacag gctaataagt ctgttggtat
4321 tatatctatg cctttgggat atgtgtctca tggtttagac ttaattcaag cagggagtgt
4381 cgtgcgtaga gttaacgtgc cctacgtgtg tctcctagct aataaagagc aagaagctat
4441 tttgatgtct gaagacgtta agttaaaccc ttcagaagat tttataaagc acgtccgcac
4501 taatggtggt tacaattctt ggcatttagt cgagggtgaa ctattggtgc aagacttacg
4561 cttaaataag ctcctgcatt ggtctgatca aaccatatgc tacaaggata gtgtgtttta
4621 tgttgtaaag aatagtacag cttttccatt tgaaacactt tcagcatgtc gtgcgtattt
4681 ggattcacgc acgacacagc agttaacaat cgaagtctta gtgactgtcg atggtgtaaa
4741 ttttagaaca gtcgttctaa ataataagaa cacttataga tcacagcttg gatgcgtttt
4801 ctttaatggt gctgatattt ctgataccat tcctgatgag aaacagaatg gtcacagttt
4861 atatctagca gacaatttga ctgctgatga aacaaaggcg cttaaagagt tatatggccc
4921 cgttgatcct actttcttac acagattcta ttcacttaag gctgcagtcc ataagtggaa
4981 gatggttgtg tgtgataagg tacgttctct caaattgagt gataataatt gttatcttaa
5041 tgcagttatt atgacacttg atttattgaa ggacattaaa tttgttatac ctgctctaca
5101 gcatgcattt atgaaacata agggcggtga ttcaactgac ttcatagccc tcattatggc
5161 ttatggcaat tgcacatttg gtgctccaga tgatgcctct cggttacttc ataccgtgct
5221 tgcaaaggct gagttatgct gttctgcacg catggtttgg agagagtggt gcaatgtctg
5281 tggcataaaa gatgttgttc tacaaggctt aaaagcttgt tgttacgtgg gtgtgcaaac
5341 tgttgaagat ctgcgtgctc gtatgacata tgtatgccag tgtggtggtg aacgtcatcg
5401 gcaaatagtc gaacacacca ccccctggtt gctgctctca ggcacaccaa atgaaaaatt
5461 ggtgacaacc tccacggcgc ctgattttgt agcgtttaat gtctttcagg gcattgaaac
5521 ggctgttggc cattatgttc atgctcgcct gaagggtggt cttattttaa agtttgactc
5581 tggcaccgtt agcaagactt cagactggaa gtgcaaggtg acagatgtac ttttctccgg
5641 ccaaaaatac agtagcgatt gtaatgtcgt acggtattct ttggacggta atttcagaac
5701 agaggttgat cccgacctat ctgctttcta tgttaaggat ggtaaatact ttacaagtga
5761 accacccgta acatattcac cagctacaat tttagctggt agtgtctaca ctaatagctg
5821 ccttgtatcg tctgatggac aacctggcgg tgatgctatt agtttgagtt ttaataacct
5881 tttagggttt gattctagta aaccagtcgc taagaaatac acttactcct tcttgcctaa
5941 agaagacggc gatgtgttgt tggctgagtt tgacacttat gaccctattt ataagaatgg
6001 tgccatgtat aaaggcaaac caattctttg ggtcaacaaa gcatcttatg atactaatct
6061 taataagttc aatagagcta gtttgcgtca aatttttgac gtagccccca ttgaactcga
6121 aaataaattc acacctttga gtgtggagtc tacaccagtt gaacctccaa ctgtagatgt
6181 ggtagcactt caacaggaaa tgacaattgt caaatgtaag ggtttaaata aacctttcgt
6241 gaaggacaat gtcagtttcg ttgctgatga ctcaggtact cccgttgttg agtatctgtc
6301 taaagaagat ctacatacat tgtatgtaga ccctaagtat caagtcattg tcttaaaaga
6361 caatgtactt tcttctatgc ttagattgca caccgttgag tcaggtgata ttaacgttgt
6421 tgcagcttcc ggatctttga cacgtaaagt gaaattacta tttagggctt cattttattt
6481 caaagaattt gctacccgca ctttcactgc taccactgct gtaggtagtt gtataaagag
6541 tgtagtgcgg catctaggtg ttactaaagg catattgaca ggctgtttta gttttgtcaa
6601 gatgttattt atgcttccac tagcttactt tagtgattca aaactcggca ccacagaggt
6661 taaagtgagt gctttgaaaa cagctggcgt tgtgacaggt aatgttgtaa aacagtgttg
6721 cactgctgct gttgatttaa gtatggataa gttgcgccgt gtggattgga aatcaaccct
6781 acggttgtta cttatgttat gcacaactat ggtattgttg tcttctgtgt atcacttgta
6841 tgtcttcaat caggtcttat caagtgatgt tatgtttgaa gatgcccaag gtttgaaaaa
6901 gttctacaaa gaagttagag cttacctagg aatctcttct gcttgtgacg gtcttgcttc
6961 agcttatagg gcgaattcct ttgatgtacc tacattctgc gcaaaccgtt ctgcaatgtg
7021 taattggtgc ttgattagcc aagattccat aactcactac ccagctctta agatggttca
7081 aacacatctt agccactatg ttcttaacat agattggttg tggtttgcat ttgagactgg
7141 tttggcatac atgctctata cctcggcctt caactggttg ttgttggcag gtacattgca
7201 ttatttcttt gcacagactt ccatatttgt agactggcgg tcatacaatt atgctgtgtc
7261 tagtgccttc tggttattca cccacattcc aatggcgggt ttggtacgaa tgtataattt
7321 gttagcatgc ctttggcttt tacgcaagtt ttatcagcat gtaatcaatg gttgcaaaga
7381 tacggcatgc ttgctctgct ataagaggaa ccgacttact agagttgaag cttctaccgt
7441 tgtctgtggt ggaaaacgta cgttttatat cacagcaaat ggcggtattt cattctgtcg
7501 taggcataat tggaattgtg tggattgtga cactgcaggt gtggggaata ccttcatctg
7561 tgaagaagtc gcaaatgact tcactaccgc cctacgcagg cctattaacg ctacggatag
7621 atcacattat tatgtggatt ccgttacagt taaagagact gttgttcagt ttaattatcg
7681 tagagacggt caaccattct acgagcggtt tcccctctgc gcttttacaa atctagataa
7741 gttgaagttc aaagaggtct gtaaaactac tactggtata cctgaataca actttatcat
7801 ctacgactca tcagatcgtg gccaggaaag tttagctagg tctgcatgtg tttattattc
7861 tcaagtcttg tgtaaatcaa ttcttttggt tgactcaagt ttggttactt ctgttggtga
7921 ttctagtgaa atcgccacta aaatgtttga ttcctttgtt aatagtttcg tctcgctgta
7981 taatgtcaca cgcgataagt tggaaaaact tatctctact gctcgtgatg gcgtaaggcg
8041 aggcgataac ttccatagtg tcttaacaac attcattgac gcagcacgag gccccgcagg
8101 tgtggagtct gatgttgaga ccaatgaaat tgttgactct gtgcagtatg ctcataaaca
8161 tgacatacaa attactaatg agagttacaa taattatgta ccctcatatg ttaaacctga
8221 tagtgtgtct accagtgatt taggtagtct cattgattgt aatgcggctt cagttaacca
8281 aattgtcttg cgtaattcta atggtgcttg tatttggaac gctgctgcat atatgaaact
8341 ctcggatgca cttaaacgac agattcgcat tgcatgccgt aagtgtaatt tagctttccg
8401 gttaaccacc tcaaagctac gcgctaatga taatatctta tcagttagat tcactgctaa
8461 caaaattgtt ggtggtgctc ctacatggtt taatgcgttg cgtgacttta cgttaaaggg
8521 ttacgttctt gctaccatta ttgtgtttct gtgtgctgta ctgatgtatt tgtgtttacc
8581 tacattttct atggtacctg ttgaatttta tgaagaccgc atcttggact ttaaagttct
8641 tgataatggt atcattaggg atgtaaatcc tgatgataag tgctttgcta ataagcaccg
8701 gtccttcaca caatggtatc atgagcatgt tggtggtgtc tatgacaact ctatcacatg
8761 cccattgaca gttgcagtaa ttgctggagt tgctggtgct cgcattccag acgtacctac
8821 tacattggct tggttgaaca atcagataat tttctttgtt tctcgagtct ttgctaatac
8881 aggcagtgtt tgctacactc ctatagatga gataccctat aagagtttct ctgatagtgg
8941 ttgcattctt ccatctgagt gcactatgtt tagggatgca gagggccgta tgacaccata
9001 ctgccatgat cctactgttt tgcctggggc ttttgcgtac agtcagatga ggcctcatgt
9061 tcgttacgac ttgtatgatg gtaacatgtt tattaaattt cctgaagtag tatttgaaag
9121 tacacttagg attactagaa ctctgtcaac tcagtactgc cggttcggta gttgtgagta
9181 tgcacaagag ggtgtttgta ttaccacaaa tggctcgtgg gccattttta atgaccacca
9241 tcttaataga cctggtgtct attgtggctc tgattttatt gacattgtca ggcggttagc
9301 agtatcactg ttccagccta ttacttattt ccaattgact acctcattgg tcttgggtat
9361 aggtttgtgt gcgttcctga ctttgctctt ctattatatt aataaagtaa aacgtgcttt
9421 tgcagattac acccagtgtg ctgtaattgc tgttgttgct gctgttctta atagcttgtg
9481 catctgcttt gttgcctcta taccattgtg tatagtacct tacactgcat tgtactatta
9541 tgctacattc tattttacta atgagcctgc atttattatg catgtttctt ggtacattat
9601 gttcgggcct atcgttccca tatggatgac ctgcgtttat acagttgcaa tgtgctttag
9661 acacttcttc tgggttttag cttattttag taagaaacat gtagaagttt ttactgatgg
9721 taagcttaat tgtagtttcc aggacgctgc ctctaatatc tttgttatta acaaggacac
9781 ttatgcagct cttagaaact ctttaactaa tgatgcctat tcacgatttt tggggttgtt
9841 taacaagtat aagtacttct ctggtgctat ggaaacagcc gcttatcgtg aagctgcagc
9901 atgtcatctt gctaaagcct tacaaacata cagcgagact ggtagtgatc ttctttacca
9961 accacccaac tgtagcataa cctctggcgt gttgcaaagc ggtttggtga aaatgtcaca
10021 tcccagtgga gatgttgagg cttgtatggt tcaggttacc tgcggtagca tgactcttaa
10081 tggtctttgg cttgacaaca cagtctggtg cccacgacac gtaatgtgcc cggctgacca
10141 gttgtctgat cctaattatg atgccttgtt gatttctatg actaatcata gtttcagtgt
10201 gcaaaaacac attggcgctc cagcaaactt gcgtgttgtt ggtcatgcca tgcaaggcac
10261 tcttttgaag ttgactgtcg atgttgctaa ccctagcact ccagcctaca cttttacaac
10321 agtgaaacct ggcgcagcat ttagtgtgtt agcatgctat aatggtcgtc cgactggtac
10381 attcactgtt gtaatgcgcc ctaactacac aattaagggt tcctttctgt gtggttcttg
10441 tggtagtgtt ggttacacca aggagggtag tgtgatcaat ttttgttaca tgcatcaaat
10501 ggaacttgct aatggtacac ataccggttc agcatttgat ggtactatgt atggtgcctt
10561 tatggataaa caagtgcacc aagttcagtt aacagacaaa tactgcagtg ttaatgtagt
10621 agcttggctt tacgcagcaa tacttaatgg ttgcgcttgg tttgtaaaac ccaatcgcac
10681 tagtgttgtt tcttttaatg aatgggctct tgccaaccaa ttcactgaat ttgttggcac
10741 tcaatccgtt gacatgttag ctgtcaaaac aggcgttgct attgaacagc tgctttatgc
10801 gatccaacaa ctttatactg ggttccaggg aaagcaaatc cttggcagta ctatgttgga
10861 agatgaattc acacctgagg atgttaatat gcagattatg ggtgtggtta tgcagagtgg
10921 tgtgagaaaa gttacatatg gtactgcgca ttggttgttc gcgacccttg tctcaaccta
10981 tgtgataatc ttacaagcca ctaaatttac tttgtggaac tacttgtttg agactattcc
11041 cacacagttg ttcccactct tatttgtgac tatggccttc gttatgttgt tggttaaaca
11101 caaacacacc tttttgacac ttttcttgtt gcctgtggct atttgtttga cttatgcaaa
11161 catagtctac gagcccacta ctcccatttc gtcagcgctg attgcagttg caaattggct
11221 tgcccccact aatgcttata tgcgcactac acatactgat attggtgtct acattagtat
11281 gtcacttgta ttagtcattg tagtgaagag attgtacaac ccatcacttt ctaactttgc
11341 gttagcattg tgcagtggtg taatgtggtt gtacacttat agcattggag aagcctcaag
11401 ccccattgcc tatctggttt ttgtcactac actcactagt gattatacga ttacagtctt
11461 tgttactgtc aaccttgcaa aagtttgcac ttatgccatc tttgcttact caccacagct
11521 tacacttgtg tttccggaag tgaagatgat acttttatta tacacatgtt taggtttcat
11581 gtgtacttgc tattttggtg tcttctctct tttgaacctt aagcttagag cacctatggg
11641 tgtctatgac tttaaggtct caacacaaga gttcagattc atgactgcta acaatctaac
11701 tgcacctaga aattcttggg aggctatggc tctgaacttt aagttaatag gtattggcgg
11761 tacaccttgt ataaaggttg ctgctatgca gtctaaactt acagatctta aatgcacatc
11821 tgtggttctc ctctctgtgc tccaacagtt acacttagag gctaatagta gggcctgggc
11881 tttctgtgtt aaatgccata atgatatatt ggcagcaaca gaccccagtg aggctttcga
11941 gaaattcgta agtctctttg ccactttaat gactttttct ggtaatgtag atcttgatgc
12001 gttagctagt gatatttttg acactcctag cgtacttcaa gctactcttt ctgagttttc
12061 acacttagct acctttgctg agttggaagc tgcgcagaaa gcctatcagg aagctatgga
12121 ctctggtgac acctcaccac aagttcttaa ggctttgcag aaggctgtta atatagctaa
12181 aaacgcctat gagaaggata aggcagtggc ccgtaagtta gaacgtatgg ctgaccaggc
12241 tatgacttct atgtataagc aagcacgtgc tgaagacaag aaagcaaaaa ttgtcagtgc
12301 tatgcaaact atgttgtttg gtatgattaa gaagctcgac aacgatgttc ttaatggtat
12361 catttctaac gctaggaatg gttgtatacc tcttagtgtc attccactgt gtgcttcaaa
12421 taaacttcgc gttgtaattc ctgacttcac cgtctggaat caggtagtca catatccctc
12481 gcttaactac gctggggctt tgtgggacat tacagttata aacaatgtgg acaatgaaat
12541 tgttaagtct tcagatgttg tagacagcaa tgaaaattta acatggccac ttgttttaga
12601 atgcactagg gcatccactt ctgccgttaa gttgcaaaat aatgagatca aaccttcagg
12661 tttaaaaacc atggttgtgt ctgcaggtca agagcaaact aactgtaata ctagttcctt
12721 agcttattac gaacctgtgc agggtcgtaa aatgctgatg gctcttcttt ctgataatgc
12781 ctatctcaaa tgggcgcgtg ttgaaggtaa ggacggattt gttagtgtag agctacaacc
12841 tccttgcaaa ttcttgattg cgggaccaaa aggacctgaa atccgatatc tctattttgt
12901 taaaaatctt aacaaccttc atcgcgggca agtgttaggg cacattgctg cgactgttag
12961 attgcaagct ggttctaaca ccgagtttgc ctctaattct tcggtgttgt cacttgttaa
13021 cttcaccgtt gatcctcaaa aagcttatct cgatttcgtc aatgcgggag gtgccccatt
13081 gacaaattgt gttaagatgc ttactcctaa aactggtaca ggtatagcta tatctgttaa
13141 accagagagt acagctgatc aagagactta tggtggagct tcagtgtgtc tctattgccg
13201 tgcgcatata gaacatcctg atgtctctgg tgtttgtaaa tataagggta agtttgtcca
13261 aatccctgct cagtgtgtcc gtgaccctgt gggattttgt ttgtcaaata ccccctgtaa
13321 tgtctgtcaa tattggattg gatatgggtg caattgtgac tcgcttaggc aagcaacact
13381 gccccaatct aaagattcca attttttaaa cgagtccggg gttctattgt aaatgcccga
13441 atagaaccct gttcaagtgg tttgtccact gatgtcgttt ttagggcatt tgacatctgc
13501 aactataagg ctaaggttgc tggtattgga aaatactaca agactaatac ttgtaggttt
13561 gtagaattag atgaccaagg gcatcattta gactcctatt ttgtcgttaa gaggcatact
13621 atggagaatt atgaactaga gaagcactgt tacgatttgt tacgtgactg tgatgctgta
13681 gctccccatg atttcttcat ctttgatgta gacaaagtta aaacacctca tattgtacgt
13741 cagcgtttaa ctgagtacac tatgatggat cttgtatatg ccctgaggca ctttgatcaa
13801 aatagcgaag tgcttaaggc tatcttagtg aagtatggtt gctgtgatgt tacctacttt
13861 gaaaataaac tctggtttga tttcgttgaa aatcccagtg ttattggtgt ttatcataaa
13921 cttggagaac gtgtacgcca agctatctta aacactgtta aattttgtga ccacatggtc
13981 aaggctggtt tagtcggtgt gctcacacta gacaaccagg accttaatgg caagtggtat
14041 gattttggtg acttcgtaat cactcaacct ggttcaggag tagctatagt tgatagctac
14101 tattcttatt tgatgcctgt gctctcaatg accgattgtc tggccgctga gacacatagg
14161 gattgtgatt ttaataaacc actcattgag tggccactta ctgagtatga ttttactgat
14221 tataaggtac aactctttga gaagtacttt aaatattggg atcagacgta tcacgcaaat
14281 tgcgttaatt gtactgatga ccgttgtgtg ttacattgtg ctaatttcaa tgtattgttt
14341 gctatgacca tgcctaagac ttgtttcgga cccatagtcc gaaagatctt tgttgatggc
14401 gtgccatttg tagtatcttg tggttatcac tacaaagaat taggtttagt catgaatatg
14461 gatgttagtc tccatagaca taggctctct cttaaagagt tgatgatgta tgccgctgat
14521 ccagccatgc acattgcctc ctctaacgct tttcttgatt tgaggacatc atgttttagt
14581 gtcgctgcac ttacaactgg tttgactttt caaactgtgc ggcctggcaa ttttaaccaa
14641 gacttctatg atttcgtggt atctaaaggt ttctttaagg agggctcttc agtgacgctc
14701 aaacattttt tctttgctca agatggtaat gctgctatta cagattataa ttactattct
14761 tataatctgc ctactatgtg tgacatcaaa caaatgttgt tctgcatgga agttgtaaac
14821 aagtacttcg aaatctatga cggtggttgt cttaatgctt ctgaagtggt tgttaataat
14881 ttagacaaga gtgctggcca tccttttaat aagtttggca aagctcgtgt ctattatgag
14941 agcatgtctt accaggagca agatgaactc tttgccatga caaagcgtaa cgtcattcct
15001 accatgactc aaatgaatct aaaatatgct attagtgcta agaatagagc tcgcactgtt
15061 gcaggcgtgt ccatacttag cacaatgact aatcgccagt accatcagaa aatgcttaag
15121 tccatggctg caactcgtgg agcgacttgc gtcattggta ctacaaagtt ctatggtggc
15181 tgggatttca tgcttaaaac attgtacaaa gatgttgata atccgcatct tatgggttgg
15241 gattacccta agtgtgatag agctatgcct aatatgtgta gaatcttcgc ttcactcata
15301 ttagctcgta aacatgccac ttgttgtact acaagggaca gattttatcg cttggcaaat
15361 gagtgtgctc aggtgctaag cgaatatgtt ctatgtggtg gtggttacta cgtcaaacct
15421 ggaggtacca gtagcggaga tgccaccact gcatatgcca atagtgtctt taacattttg
15481 caggcgacaa ctgctaatgt cagtgcactt atgggtgcta atggcaacaa gattgttgac
15541 aaagaagtta aagacatgca gtttgatttg tatgtcaatg tttacaggag cactagccca
15601 gaccccaaat ttgttgataa atactatgct tttcttaata agcacttttc tatgatgata
15661 ctgtctgatg acggtgtcgt ttgctataat agtgattatg cagctaaggg ttacattgct
15721 ggaatacaga attttaagga aacgctgtat tatcagaaca atgtctttat gtctgaagct
15781 aaatgctggg tggaaaccga tctgaagaaa gggccacatg aattctgttc acagcatacg
15841 ctttatatta aggatggcga cgatggttac ttccttcctt atccagaccc ttcaagaatt
15901 ttgtctgccg gttgctttgt agatgatatc gttaagactg acggtacact catggtagag
15961 cggtttgtgt ctttggctat agatgcttac cctctcacaa agcatgaaga tatagaatac
16021 cagaatgtat tctgggtcta cttacagtat atagaaaaac tgtataaaga ccttacagga
16081 cacatgcttg acagttattc tgtcatgcta tgtggtgata attctgctaa gttttgggaa
16141 gaggcattct acagagatct ctatagttcg cctaccactt tgcaggctgt cggttcatgc
16201 gttgtatgcc attcacagac ttccctacgc tgtgggacat gcatccgtag accatttctc
16261 tgctgtaaat gctgctatga tcatgttata gcaactccac ataagatggt tttgtctgtt
16321 tctccttacg tttgtaatgc ccctggttgt ggcgtttcag acgttactaa gctatattta
16381 ggtggtatga gctacttttg tgtagatcat agacctgtgt gtagttttcc actttgcgct
16441 aatggtcttg tattcggctt atacaagaat atgtgcacag gtagtccttc tatagttgaa
16501 tttaataggt tggctacctg tgactggact gaaagtggtg attacaccct tgccaatact
16561 acaacagaac cactcaaact ttttgctgct gagactttac gtgccactga agaggcgtct
16621 aagcagtctt atgctattgc caccatcaaa gaaattgttg gtgagcgcca actattactt
16681 gtgtgggagg ctggcaagtc caaaccacca ctcaatcgta attatgtttt tactggttat
16741 catataacca aaaatagtaa agtgcagctc ggtgagtaca tcttcgagcg cattgattat
16801 agtgatgctg tatcctacaa gtctagtaca acgtataaac tgactgtagg tgacatcttc
16861 gtacttacct ctcactctgt ggctaccttg acggcgccca caattgtgaa tcaagagagg
16921 tatgttaaaa ttactgggtt gtacccaacc attacggtac ctgaagagtt cgcaagtcat
16981 gttgccaact tccaaaaatc aggttatagt aaatatgtca ctgttcaggg accacctggc
17041 actggcaaaa gtcactttgc tatagggtta gcgatttact accctacagc acgtgttgtt
17101 tatacagcat gttcacacgc agctgttgat gctttgtgtg aaaaagcttt taaatatttg
17161 aacattgcta aatgttcccg tattattcct gcaaaggcac gtgttgagtg ctatgacagg
17221 tttaaagtta atgagacaaa ttctcaatat ttgtttagta ctattaatgc tctaccagaa
17281 acttctgccg atattctggt ggttgatgag gttagtatgt gcactaatta tgatctttca
17341 attattaatg cacgtattaa agctaagcac attgtctatg taggagatcc agcacagttg
17401 ccagctccta ggactttgtt gactagaggc acattggaac cagaaaattt caatagtgtc
17461 actagattga tgtgtaactt aggtcctgac atatttttaa gtatgtgcta caggtgtcct
17521 aaggaaatag taagcactgt gagcgctctt gtctacaata ataaattgtt agccaagaag
17581 gagctttcag gccagtgctt taaaatactc tataagggca atgtgacgca tgatgctagc
17641 tctgccatta atagaccaca actcacattt gtgaagaatt ttattactgc caatccggca
17701 tggagtaagg cagtctttat ttcgccttat aattcacaga atgctgtggc tcgttcaatg
17761 ctgggtctta ctactcagac tgttgattcc tcacagggtt cagaatacca gtacgttatc
17821 ttctgtcaaa cagcagatac ggcacatgct aacaacatta acagatttaa tgttgcaatc
17881 actcgtgccc aaaaaggtat tctttgtgtt atgacatctc aggcactctt tgagtcctta
17941 gagtttactg aattgtcttt tactaattac aagctccagt ctcagattgt aactggcctt
18001 tttaaagatt gctctagaga aacttctggc ctctcacctg cttatgcacc aacatacgtt
18061 agtgttgatg acaagtataa gacgagtgat gagctttgcg tgaatcttaa tttacccgca
18121 aatgtcccat actctcgtgt tatttccagg atgggcttta aactcgatgc aacagttcct
18181 ggatatccta agcttttcat tactcgtgaa gaggctgtaa ggcaagttcg aagctggata
18241 ggcttcgatg ttgagggtgc tcatgcttcc cgtaatgcat gtggcaccaa tgtgcctcta
18301 caattaggat tttcaactgg tgtgaacttt gttgttcagc cagttggtgt tgtagacact
18361 gagtggggta acatgttaac gggcattgct gcccgtcctc caccaggtga acagtttaag
18421 cacctcgtgc ctcttatgca taagggggct gcgtggccta ttgttagacg acgtatagtg
18481 caaatgttgt cagacacttt agacaaattg tctgattact gtacgtttgt ttgttgggct
18541 catggctttg aattaacgtc tgcatcatac ttttgcaaga taggtaagga acagaagtgt
18601 tgcatgtgca atagacgcgc tgcagcgtac tcttcacctc tgcaatctta tgcctgctgg
18661 actcattcct gcggttatga ttatgtctac aaccctttct ttgtcgatgt tcaacagtgg
18721 ggttatgtag gcaatcttgc tactaatcac gatcgttatt gctctgtcca tcaaggagct
18781 catgtggctt ctaatgatgc aataatgact cgttgtttag ctattcattc ttgttttata
18841 gaacgtgtgg attgggatat agagtatcct tatatctcac atgaaaagaa attgaattcc
18901 tgttgtagaa tcgttgagcg caacgtcgta cgtgctgctc ttcttgccgg ttcatttgac
18961 aaagtctatg atattggcaa tcctaaagga attcctattg ttgatgaccc tgtggttgat
19021 tggcattatt ttgatgcaca gcccttgacc agaaaggtac aacagctttt ctatacagag
19081 gacatggcct caagatttgc tgatgggctc tgcttatttt ggaactgtaa tgtaccaaaa
19141 tatcctaata atgcaattgt atgcaggttt gacacacgtg tgcattctga gttcaatttg
19201 ccaggttgtg atggcggtag tttgtatgtt aacaagcacg cttttcatac accagcatat
19261 gatgtgagtg cattccgtga tctgaaacct ttaccattct tttattattc tactacacca
19321 tgtgaagtgc atggtaatgg tagtatgata gaggatattg attatgtacc cctaaaatct
19381 gcagtctgta ttacagcttg taatttaggg ggcgctgttt gtaggaagca tgctacagag
19441 tacagagagt atatggaagc atataatctt gtctctgcat caggtttccg cctttggtgt
19501 tataagacct ttgatattta taatctctgg tctactttta caaaagttca aggtttggaa
19561 aacattgctt ttaattttgt taaacaaggc cattttattg gtgttgaggg tgaactacct
19621 gtagctgtag tcaatgataa gatcttcacc aagagtggcg ttaatgacat ttgtatgttt
19681 gagaataaaa ccactttgcc tactaatata gcttttgaac tctatgctaa gcgtgctgta
19741 cgctcgcatc ccgatttcaa attgctacac aatttacaag cagacatttg ctacaagttc
19801 gtcctttggg attatgaacg tagcaatatt tatggtactg ctactattgg tgtatgtaag
19861 tacactgata ttgatgttaa ttcagctttg aatatatgtt ttgacatacg cgataatggt
19921 tcattggaga agttcatgtc tactcccaat gccatcttta tttctgatag aaaaattaag
19981 aaataccctt gtatggtagg tcctgattat gcttacttca atggtgctat catccgtgat
20041 agtgatgttg ttaaacaacc agtgaagttc tacttgtata agaaagtcaa taatgagttt
20101 attgatccta ctgagtgtat ttacactcag agtcgctctt gtagtgactt cctacccctg
20161 tctgacatgg agaaagactt tctatctttt gatagtgatg ttttcattaa gaagtatggc
20221 ttggaaaact atgcttttga gcacgtagtc tatggagact tctctcatac tacgttaggc
20281 ggtcttcact tgcttattgg tttatacaag aagcaacagg aaggtcatat tattatggaa
20341 gaaatgctaa aaggtagctc aactattcat aactatttta ttactgagac taacacagcg
20401 gcttttaagg cggtgtgttc tgttatagat ttaaagcttg acgactttgt tatgatttta
20461 aagagtcaag accttggcgt agtatccaag gttgtcaagg ttcctattga cttaacaatg
20521 attgagttta tgttatggtg taaggatgga caggttcaaa ccttctaccc tcgactccag
20581 gcttctgcag attggaaacc tggtcatgca atgccatccc tctttaaagt tcaaaatgta
20641 aaccttgaac gttgtgagct tgctaattac aagcaatcta ttcctatgcc tcgcggtgtg
20701 cacatgaaca tcgctaaata tatgcaattg tgccagtatt taaatacttg cacattagcc
20761 gtgcctgcca atatgcgtgt tatacatttt ggcgctggtt ctgataaagg tatcgctcct
20821 ggtacatcag ttttacgaca gtggcttcct acagatgcca ttattataga taatgattta
20881 aatgagttcg tgtcagatgc tgacataact ttatttggag attgtgtaac tgtacgtgtc
20941 ggccaacaag tggatcttgt tatttccgac atgtatgatc ctactactaa gaatgtaaca
21001 ggtagtaatg agtcaaaggc tttattcttt acttacctgt gtaacctcat taataataat
21061 cttgctcttg gtgggtctgt tgctattaaa ataacagaac actcttggag cgttgaactt
21121 tatgaactta tgggaaaatt tgcttggtgg actgttttct gcaccaatgc aaatgcatcc
21181 tcatctgaag gattcctctt aggtattaat tacttgggta ctattaaaga aaatatagat
21241 ggtggtgcta tgcacgccaa ctatatattt tggagaaatt ccactcctat gaatctgagt
21301 acttactcac tttttgattt atccaagttt caattaaaat taaaaggaac accagttctt
21361 caattaaagg agagtcaaat taacgaactc gtaatatctc tcctgtcgca gggtaagtta
21421 cttatccgtg acaatgatac actcagtgtt tctactgatg ttcttgttaa cacctacaga
21481 aagttacgtt gatgtagggc cagattctgt taagtctgct tgtattgagg ttgatataca
21541 acagactttc tttgataaaa cttggcctag gccaattgat gtttctaagg ctgacggtat
21601 tatataccct caaggccgta catattctaa cataactatc acttatcaag gtctttttcc
21661 ctatcaggga gaccatggtg atatgtatgt ttactctgca ggacatgcta caggcacaac
21721 tccacaaaag ttgtttgtag ctaactattc tcaggacgtc aaacagtttg ctaatgggtt
21781 tgtcgtccgt ataggagcag ctgccaattc cactggcact gttattatta gcccatctac
21841 cagcgctact atacgaaaaa tttaccctgc ttttatgctg ggttcttcag ttggtaattt
21901 ctcagatggt aaaatgggcc gcttcttcaa tcatactcta gttcttttgc ccgatggatg
21961 tggcacttta cttagagctt tttattgtat tctagagcct cgctctggaa atcattgtcc
22021 tgctggcaat tcctatactt cttttgccac ttatcacact cctgcaacag attgttctga
22081 tggcaattac aatcgtaatg ccagtctgaa ctcttttaag gagtatttta atttacgtaa
22141 ctgcaccttt atgtacactt ataacattac cgaagatgag attttagagt ggtttggcat
22201 tacacaaact gctcaaggtg ttcacctctt ctcatctcgg tatgttgatt tgtacggcgg
22261 caatatgttt caatttgcca ccttgcctgt ttatgatact attaagtatt attctatcat
22321 tcctcacagt attcgttcta tccaaagtga tagaaaagct tgggctgcct tctacgtata
22381 taaacttcaa ccgttaactt tcctgttgga tttttctgtt gatggttata tacgcagagc
22441 tatagactgt ggttttaatg atttgtcaca actccactgc tcatatgaat ccttcgatgt
22501 tgaatctgga gtttattcag tttcgtcttt cgaagcaaaa ccttctggct cagttgtgga
22561 acaggctgaa ggtgttgaat gtgatttttc acctcttctg tctggcacac ctcctcaggt
22621 ttataatttc aagcgtttgg tttttaccaa ttgcaattat aatcttacca aattgctttc
22681 acttttttct gtgaatgatt ttacttgtag tcaaatatct ccagcagcaa ttgctagcaa
22741 ctgttattct tcactgattt tggattattt ttcataccca cttagtatga aatccgatct
22801 cagtgttagt tctgctggtc caatatccca gtttaattat aaacagtcct tttctaatcc
22861 cacatgtttg attttagcga ctgttcctca taaccttact actattacta agcctcttaa
22921 gtacagctat attaacaagt gctctcgtct tctttctgat gatcgtactg aagtacctca
22981 gttagtgaac gctaatcaat actcaccctg tgtatccatt gtcccatcca ctgtgtggga
23041 agacggtgat tattatagga aacaactatc tccacttgaa ggtggtggct ggcttgttgc
23101 tagtggctca actgttgcca tgactgagca attacagatg ggctttggta ttacagttca
23161 atatggtaca gacaccaata gtgtttgccc caagcttgaa tttgctaatg acacaaaaat
23221 tgcctctcaa ttaggcaatt gcgtggaata ttccctctat ggtgtttcgg gccgtggtgt
23281 ttttcagaat tgcacagctg taggtgttcg acagcagcgc tttgtttatg atgcgtacca
23341 gaatttagtt ggctattatt ctgatgatgg caactactac tgtttgcgtg cttgtgttag
23401 tgttcctgtt tctgtcatct atgataaaga aactaaaacc cacgctactc tatttggtag
23461 tgttgcatgt gaacacattt cctctaccat gtctcaatac tcccgttcta cgcgatcaat
23521 gcttaaacgg cgagattcta catatggtcc ccttcagaca cctgttggtt gtgtcctagg
23581 acttgttaat tcctctttgt tcgtagagga ctgcaagttg cctcttggtc aatctctctg
23641 tgctcttcct gacacaccta gtactctcac acctcgcagt gtgcgctctg ttccaggtga
23701 aatgcgcttg gcatccattg cttttaatca tcctattcag gttgatcaac ttaatagtag
23761 ttattttaaa ttaagtatac ctactaattt ttcctttggt gtgactcagg agtacattca
23821 gacaaccatt cagaaagtta ctgttgattg taaacagtac gtttgcaatg gtttccagaa
23881 gtgtgagcaa ttactgcgcg agtatggcca gttttgttcc aaaataaacc aggctctcca
23941 tggtgccaat ttacgccagg atgattctgt acgtaatttg tttgcgagcg tgaaaagctc
24001 tcaatcatct cctatcatac caggttttgg aggtgacttt aatttgacac ttctagaacc
24061 tgtttctata tctactggca gtcgtagtgc acgtagtgct attgaggatt tgctatttga
24121 caaagtcact atagctgatc ctggttatat gcaaggttac gatgattgca tgcagcaagg
24181 tccagcatca gctcgtgatc ttatttgtgc tcaatatgtg gctggttaca aagtattacc
24241 tcctcttatg gatgttaata tggaagccgc gtatacctca tctttgcttg gcagcatagc
24301 aggtgttggc tggactgctg gcttatcctc ctttgctgct attccatttg cacagagtat
24361 cttttatagg ttaaacggtg ttggcattac tcaacaggtt ctttcagaga accaaaagct
24421 tattgccaat aagtttaatc aggctctggg agctatgcaa acaggcttca ctacaactaa
24481 tgaagctttt cggaaggttc aggatgctgt gaacaacaat gcacaggctc tatccaaatt
24541 agctagcgag ctatctaata cttttggtgc tatttccgcc tctattggag acatcataca
24601 acgtcttgat gttctcgaac aggacgccca aatagacaga cttattaatg gccgtttgac
24661 aacactaaat gcttttgttg cacagcagct tgttcgttcc gaatcagctg ctctttccgc
24721 tcaattggct aaagataaag tcaatgagtg tgtcaaggca caatccaagc gttctggatt
24781 ttgcggtcaa ggcacacata tagtgtcctt tgttgtaaat gcccctaatg gcctttactt
24841 catgcatgtt ggttattacc ctagcaacca cattgaggtt gtttctgctt atggtctttg
24901 cgatgcagct aaccctacta attgtatagc ccctgttaat ggctacttta ttaaaactaa
24961 taacactagg attgttgatg agtggtcata tactggctcg tccttctatg cacctgagcc
25021 catcacctct cttaatacta agtatgttgc accacaggtg acataccaaa acatttctac
25081 taacctccct cctcctcttc tcggcaattc caccgggatt gacttccaag atgagttgga
25141 tgagtttttc aaaaatgtta gcaccagtat acctaatttt ggttctctaa cacagattaa
25201 tactacatta ctcgatctta cctacgagat gttgtctctt caacaagttg ttaaagccct
25261 taatgagtct tacatagacc ttaaagagct tggcaattat acttattaca acaaatggcc
25321 gtggtacatt tggcttggtt tcattgctgg gcttgttgcc ttagctctat gcgccttctt
25381 catactgtgc tgcactggtt gtggcacaaa ctgtatggga aaacttaagt gtaatcgttg
25441 ttgtgataga tacgaggaat acgacctcga gccgcataag gttcatgttc actaattaac
25501 gaactatcaa tgagagttca aagaccaccc actctcttgt tagtgttctc actctctctt
25561 ttggtcactg cattttcaaa acctctctat gtacctgagc attgtcagaa ttattctggt
25621 tgcatgctta gggcttgtat taaaactgcc caagctgata cagctggtct ttatacaaat
25681 tttcgaattg acgtcccatc tgcagaatca actggtactc aatcagtttc tgtcgatcgt
25741 gagtcaactt caactcatga tggtcctacc gaacatgtta ctagtgtgaa tctttttgac
25801 gttggttact cagttaatta acgaactcta tggattacgt gtctctgctt aatcaaattt
25861 ggcagaagta ccttaattca ccgtatacta cttgtttgta tatccctaaa cccacagcta
25921 agtatacacc tttagttggc acttcattgc accctgtgct gtggaactgt cagctatcct
25981 ttgctggtta tactgaatct gctgttaatt ctacaaaagc tttggccaaa caggacgcag
26041 ctcagcgaat cgcttggttg ctacataagg atggaggaat ccctgatgga tgttccctct
26101 acctccggca ctcaagttta ttcgcgcaaa gcgaggaaga ggagtcattc tccaactaag
26161 aaactgcgct acgttaagcg tagattttct cttctgcgcc ctgaagacct tagtgttatt
26221 gtccaaccaa cacactatgt cagggttaca ttttcagacc ccaacatgtg gtatctacgt
26281 tcgggtcatc atttacactc agttcacaat tggcttaaac cttatggcgg ccaacctgtt
26341 tctgagtacc atattactct agctttgcta aatctcactg atgaagattt agctagagat
26401 ttttcaccca ttgcgctctt tttgcgcaat gtcagatttg agctacatga gttcgccttg
26461 ctgcgcaaaa ctcttgttct taatgcatca gagatctact gtgctaacat acatagattt
26521 aagcctgtgt atagagttaa cacggcaatc cctactatta aggattggct tctcgttcag
26581 ggattttccc tttaccatag tggcctccct ttacatatgt caatctctaa attgcatgca
26641 ctggatgatg ttactcgcaa ttacatcatt acaatgccat gctttagaac ttatcctcaa
26701 caaatgtttg ttactccttt ggccgtagat gttgtctcca tacggtcttc caatcagggt
26761 aataaacaaa ttgttcattc ttaccccatt ttacatcatc caggatttta acgaactatg
26821 gctttctcgg cgtctttatt taaacccgtc cagctagtcc cagtttctcc tgcatttcat
26881 cgcattgagt ctactgactc tattgttttc acatacattc ctgctagcgg ctatgtagct
26941 gctttagctg tcaatgtgtg tctcattccc ctattattac tgctacgtca agatacttgt
27001 cgtcgcagca ttatcagaac tatggttctc tatttccttg ttctgtataa ctttttatta
27061 gccattgtac tagtcaatgg tgtacattat ccaactggaa gttgcctgat agccttctta
27121 gttatcctca taatactttg gtttgtagat agaattcgtt tctgtctcat gctgaattcc
27181 tacattccac tgtttgacat gcgttctcac tttattcgtg ttagtacagt ttcttctcat
27241 ggtatggtcc ctgtcataca caccaaacca ttatttatta gaaacttcga tcagcgttgc
27301 agctgttctc gttgttttta tttgcactct tccacttata tagagtgcac ttatattagc
27361 cgttttagta agattagcct agtttctgta actgacttct ccttaaacgg caatgtttcc
27421 actgttttcg tgcctgcaac gcgcgattca gttcctcttc acataatcgc cccgagctcg
27481 cttatcgttt aagcagctct gcgctactat gggtcccgtg tagaggctaa tccattagtc
27541 tctctttgga catatggaaa acgaactatg ttaccctttg tccaagaacg aatagggttg
27601 ttcatagtaa actttttcat ttttaccgta gtatgtgcta taacactctt ggtgtgtatg
27661 gctttcctta cggctactag attatgtgtg caatgtatga caggcttcaa taccctgtta
27721 gttcagcccg cattatactt gtataatact ggacgttcag tctatgtaaa attccaggat
27781 agtaaacccc ctctaccacc tgacgagtgg gtttaacgaa ctccttcata atgtctaata
27841 tgacgcaact cactgaggcg cagattattg ccattattaa agactggaac tttgcatggt
27901 ccctgatctt tctcttaatt actatcgtac tacagtatgg atacccatcc cgtagtatga
27961 ctgtctatgt ctttaaaatg tttgttttat ggctcctatg gccatcttcc atggcgctat
28021 caatatttag cgccatttat ccaattgatc tagcttccca gataatctct ggcattgtag
28081 cagctgtttc agctatgatg tggatttcct actttgtgca gagtatccgg ctgtttatga
28141 gaactggatc atggtggtca ttcaatcctg agactaattg ccttttgaac gttccatttg
28201 gtggtacaac tgtcgtacgt ccactcgtag aggactctac cagtgtaact gctgttgtaa
28261 ccaatggcca cctcaaaatg gctggcatgc atttcggtgc ttgtgactac gacagacttc
28321 ctaatgaagt caccgtggcc aaacccaatg tgctgattgc tttaaaaatg gtgaagcggc
28381 aaagctacgg aactaattcc ggcgttgcca tttaccatag atataaggca ggtaattaca
28441 ggagtccgcc tattacggcg gatattgaac ttgcattgct tcgagcttag gctctttagt
28501 aagagtatct taattgattt taacgaatct caatttcatt gttatggcat cccctgctgc
28561 acctcgtgct gtttcctttg ccgataacaa tgatataaca aatacaaacc tgtctcgagg
28621 tagaggacgt aatccaaaac cacgagctgc accaaataac actgtctctt ggtacactgg
28681 gcttacccaa cacgggaaag tccctcttac ctttccacct gggcagggtg tacctcttaa
28741 tgccaattcc acccctgcgc aaaatgctgg gtattggcgg agacaggaca gaaaaattaa
28801 taccgggaat ggaattaagc aactggctcc caggtggtac ttctactaca ctggaactgg
28861 acccgaagca gcactcccat tccgggctgt taaggatggc atcgtttggg tccatgaaga
28921 tggcgccact gatgctcctt caacttttgg gacgcggaac cctaacaatg attcagctat
28981 tgttacacaa ttcgcgcccg gtactaagct tcctaaaaac ttccacattg aggggactgg
29041 aggcaatagt caatcatctt caagagcctc tagcgtaagc agaaactctt ccagatctag
29101 ttcacaaggt tcaagatcag gaaactctac ccgcggcact tctccaggtc catctggaat
29161 cggagcagta ggaggtgatc tactttacct tgatcttctg aacagactac aagcccttga
29221 gtctggcaaa gtaaagcaat cgcagccaaa agtaatcact aagaaggatg ctgctgctgc
29281 taaaaataag atgcgccaca agcgcacttc caccaaaagt ttcaacatgg tgcaagcttt
29341 tggtcttcgc ggaccaggag acctccaggg aaactttggt gatcttcaat tgaataaact
29401 cggcactgag gacccacgtt ggccccaaat tgctgagctt gctcctacag ccagtgcttt
29461 tatgggtatg tcgcaattta aacttaccca tcagaacaat gatgatcatg gcaaccctgt
29521 gtacttcctt cggtacagtg gagccattaa acttgaccca aagaatccca actacaataa
29581 gtggttggag cttcttgagc aaaatattga tgcctacaaa accttcccta agaaggaaaa
29641 gaaacaaaag gcaccaaaag aagaatcaac agaccaaatg tctgaacctc caaaggagca
29701 gcgtgtgcaa ggtagcatca ctcagcgcat tcgcacccgt ccaagtgttc agcctggtcc
29761 aatgattgat gttaacactg attagtgtca ctcaaagtaa caagatcgcg gcaatcgttt
29821 gtgtttggta accccatctc accatcgctt gtccactctt gcacagaatg gaatcatgtt
29881 gtaattacag tgcaataagg taattataac ccatttaatt gatagctatg ctttattaaa
29941 gtgtgtagct gtagagagaa tgttaaagac tgtcacctct gcgtgattgc aagtgaacag
30001 tgccccccgg gaagagctct acagtgtgaa atgtaaataa aaatagctat tattcaatta
30061 gattaggcta attagatgat ttgcaaaaaa aaaaaa

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Thu Jun 04, 2015 7:33 pm 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
LOCUS KR011265 30096 bp RNA linear VRL 27-MAY-2015
DEFINITION Middle East respiratory syndrome coronavirus strain
Hu/Riyadh-KSA-2466/2015, complete genome.
ACCESSION KR011265
VERSION KR011265.1 GI:823104975
KEYWORDS .
SOURCE Middle East respiratory syndrome coronavirus (MERS-CoV)
ORGANISM Middle East respiratory syndrome coronavirus
Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA
stage; Nidovirales; Coronaviridae; Coronavirinae; Betacoronavirus;
unclassified Betacoronavirus.
REFERENCE 1 (bases 1 to 30096)
AUTHORS Lu,X., Saeed,A.A.B. and Erdman,D.D.
TITLE Direct Submission
JOURNAL Submitted (24-MAR-2015) Division of Viral Diseases, Centers for
Disease Control and Prevention, 1600 Clifton Rd., Atlanta, GA
30329, USA
COMMENT ##Assembly-Data-START##
Assembly Method :: Sequencher v. 5.2.4
Sequencing Technology :: Sanger dideoxy sequencing
##Assembly-Data-END##
FEATURES Location/Qualifiers
source 1..30096
/organism="Middle East respiratory syndrome coronavirus"
/mol_type="genomic RNA"
/strain="Hu/Riyadh-KSA-2466/2015"
/isolation_source="respiratory secretions"
/host="Homo sapiens"
/db_xref="taxon:1335626"
/country="Saudi Arabia"
/collection_date="26-Jan-2015"
CDS join(257..13411,13411..21492)
/ribosomal_slippage
/codon_start=1
/product="ORF1ab protein"
/protein_id="AKI29273.1"
/db_xref="GI:823104976"
/translation="MSFVAGVTAQGARGTYRAALNSEKHQDHVSLTVPLCGSGNLVEK
LSPWFIDGENAYEVVKAMLLKKEPLLYVPIRLAGHTRHLPGPRVYLVERLIACENPFM
VNQLAYSSSANGSLVGTTLQGKPIGMFFPYDIELVTGKQNILLRKYGRGGYHYTPFHY
ERDNTSCPEWMDDFEADPKGKYAQNLLKKLIGGDVTPVDQYMCGVDGKPISAYAFLMA
KDGITKLADVEADVAARADDEGFITLKNNLYRLVWHVERKDVPYPKQSIFTINSVVQK
DGVENTPPHYFTLGCKILTLTPRNKWSGVSDLSLKQKLLYTFYGKESLENPTYIYHSA
FIECGSCGNDSWLTGNAIQGFACGCGASYTANDVEVQSSGMIKPNALLCATCPFAKGD
SCSSNCKHSVAQLVSYLSERCNVIADPKSFTLIFGGVAYAYFGCEEGTMYFVPRAKSV
VSRIGDSVFTGCTGSWNKVTQIANMFLEQTQHSLNFVGEFVVNDVVLAILSGTTTNVD
KIRQLLKGVTLDKLRDYLADYDIAVTAGPFMDNAINVGGTGLQYAAITAPYVVLTGLG
ESFKKVATIPYKVCNSVKDTLTYYAHSVLYRVFPYDMDSGVSSFSELLFDCVDLSVAS
TYFLVRLLQDKAGDFMSTIITSCQTAVSKLLDTCFEATEATFNFLLDLAGLFRIFLRN
AYVYTSQGFVVVNGKVSTLVKQVLDLLNKGMQLLHTKVSWAGFNISAVIYSGRESLIF
PSGTYYCVTTKAKSVQQDLDVILPGEFSKKQLGLLQPTDNSTTVSVTVSSNMVETVVG
QLEQTNMHSPDVIVGDYVIISEKLFVRSKEEDGFAFYPACTNGHAVPTLFRLKGGAPV
KKVAFGGDQVHEVAAVRSVTVEYNIHAVLDTLLASSSLRTFVVDKSLSIEEFADVVKE
QVSDLLVKLLRGMPIPDFDLDDFIDAPCYCFNAEGDASWSSTMILSLHPVECDEECSE
VEASDLEEGESECISETSTEQVDVSHEISDDEWAAAVDEAFPLDEAEDVTESVQEEAQ
PVEVPVEDIAQVVIADTLQETPVVSDTVEVPPQVVKLPSEPQTIQPEVKEVAPVYEAD
TEQTQSVTVKPKRLRKKRNVDPLSNFEHKVITECVTIVLGDAIQVAKCYGESVLVNAA
NTHLKHGGGIAGAINAASKGAVQKESDEYILAKGPLQVGDSVLLQGHSLAKNILHVVG
PDARAKQDVSLLSKCYKAMNAYPLVVTPLVSAGIFGVKPAVSFDYLIREAKTRVLVVV
NSQDVYKSLTIVDIPQSLTFSYDGLRGAIRKAKDYGFTVFVCTDNSANTKVLRNKGVD
YTKKFFTVDGVQYYCYTSKDTLDDILQQANKSVGIISMPLGYVSHGLDLIQAGSVVRR
VNVPYVCLLANKEQEAILMSEDVKLNPSEDFIKHVRTNGGYNSWHLVEGELLVQDLRL
NKLLHWSDQTICYKDSVFYVVKNSTAFPFETLSACRAYLDSRTTQQLTIEVLVTVDGV
NFRTVVLNNKNTYRSQLGCVFFNGADISDTIPDEKQNGHSLYLADNLTADETKALKEL
YGPVDPTFLHRFYSLKAAVHKWKMVVCDKVRSLKLSDNNCYLNAVIMTLDLLKDIKFV
IPALQHAFMKHKGGDSTDFIALIMAYGNCTFGAPDDASRLLHTVLAKAELCCSARMVW
REWCNVCGIKDVVLQGLKACCYVGVQTVEDLRARMTYVCQCGGERHRQIVEHTTPWLL
LSGTPNEKLVTTSTAPDFVAFNVFQGIETAVGHYVHARLKGGLILKFDSGTVSKTSDW
KCKVTDVLFSGQKYSSDCNVVRYSLDGNFRTEVDPDLSAFYVKDGKYFTSEPPVTYSP
ATILAGSVYTNSCLVSSDGQPGGDAISLSFNNLLGFDSSKPVAKKYTYSFLPKEDGDV
LLAEFDTYDPIYKNGAMYKGKPILWVNKASYDTNLNKFNRASLRQIFDVAPIELENKF
TPLSVESTPVEPPTVDVVALQQEMTIVKCKGLNKPFVKDNVSFVADDSGTPVVEYLSK
EDLHTLYVDPKYQVIVLKDNVLSSMLRLHTVESGDINVVAASGSLTRKVKLLFRASFY
FKEFATRTFTATTAVGSCIKSVVRHLGVTKGILTGCFSFVKMLFMLPLAYFSDSKLGT
TEVKVSALKTAGVVTGNVVKQCCTAAVDLSMDKLRRVDWKSTLRLLLMLCTTMVLLSS
VYHLYVFNQVLSSDVMFEDAQGLKKFYKEVRAYLGISSACDGLASAYRANSFDVPTFC
ANRSAMCNWCLISQDSITHYPALKMVQTHLSHYVLNIDWLWFAFETGLAYMLYTSAFN
WLLLAGTLHYFFAQTSIFVDWRSYNYAVSSAFWLFTHIPMAGLVRMYNLLACLWLLRK
FYQHVINGCKDTACLLCYKRNRLTRVEASTVVCGGKRTFYITANGGISFCRRHNWNCV
DCDTAGVGNTFICEEVANDFTTALRRPINATDRSHYYVDSVTVKETVVQFNYRRDGQP
FYERFPLCAFTNLDKLKFKEVCKTTTGIPEYNFIIYDSSDRGQESLARSACVYYSQVL
CKSILLVDSSLVTSVGDSSEIATKMFDSFVNSFVSLYNVTRDKLEKLISTARDGVRRG
DNFHSVLTTFIDAARGPAGVESDVETNEIVDSVQYAHKHDIQITNESYNNYVPSYVKP
DSVSTSDLGSLIDCNAASVNQIVLRNSNGACIWNAAAYMKLSDALKRQIRIACRKCNL
AFRLTTSKLRANDNILSVRFTANKIVGGAPTWFNALRDFTLKGYVLATIIVFLCAVLM
YLCLPTFSMVPVEFYEDRILDFKVLDNGIIRDVNPDDKCFANKHRSFTQWYHEHVGGV
YDNSITCPLTVAVIAGVAGARIPDVPTTLAWLNNQIIFFVSRVFANTGSVCYTPIDEI
PYKSFSDSGCILPSECTMFRDAEGRMTPYCHDPTVLPGAFAYSQMRPHVRYDLYDGNM
FIKFPEVVFESTLRITRTLSTQYCRFGSCEYAQEGVCITTNGSWAIFNDHHLNRPGVY
CGSDFIDIVRRLAVSLFQPITYFQLTTSLVLGIGLCAFLTLLFYYINKVKRAFADYTQ
CAVIAVVAAVLNSLCICFVASIPLCIVPYTALYYYATFYFTNEPAFIMHVSWYIMFGP
IVPIWMTCVYTVAMCFRHFFWVLAYFSKKHVEVFTDGKLNCSFQDAASNIFVINKDTY
AALRNSLTNDAYSRFLGLFNKYKYFSGAMETAAYREAAACHLAKALQTYSETGSDLLY
QPPNCSITSGVLQSGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCP
ADQLSDPNYDALLISMTNHSFSVQKHIGAPANLRVVGHAMQGTLLKLTVDVANPSTPA
YTFTTVKPGAAFSVLACYNGRPTGTFTVVMRPNYTIKGSFLCGSCGSVGYTKEGSVIN
FCYMHQMELANGTHTGSAFDGTMYGAFMDKQVHQVQLTDKYCSVNVVAWLYAAILNGC
AWFVKPNRTSVVSFNEWALANQFTEFVGTQSVDMLAVKTGVAIEQLLYAIQQLYTGFQ
GKQILGSTMLEDEFTPEDVNMQIMGVVMQSGVRKVTYGTAHWLFATLVSTYVIILQAT
KFTLWNYLFETIPTQLFPLLFVTMAFVMLLVKHKHTFLTLFLLPVAICLTYANIVYEP
TTPISSALIAVANWLAPTNAYMRTTHTDIGVYISMSLVLVIVVKRLYNPSLSNFALAL
CSGVMWLYTYSIGEASSPIAYLVFVTTLTSDYTITVFVTVNLAKVCTYAIFAYSPQLT
LVFPEVKMILLLYTCLGFMCTCYFGVFSLLNLKLRAPMGVYDFKVSTQEFRFMTANNL
TAPRNSWEAMALNFKLIGIGGTPCIKVAAMQSKLTDLKCTSVVLLSVLQQLHLEANSR
AWAFCVKCHNDILAATDPSEAFEKFVSLFATLMTFSGNVDLDALASDIFDTPSVLQAT
LSEFSHLATFAELEAAQKAYQEAMDSGDTSPQVLKALQKAVNIAKNAYEKDKAVARKL
ERMADQAMTSMYKQARAEDKKAKIVSAMQTMLFGMIKKLDNDVLNGIISNARNGCIPL
SVIPLCASNKLRVVIPDFTVWNQVVTYPSLNYAGALWDITVINNVDNEIVKSSDVVDS
NENLTWPLVLECTRASTSAVKLQNNEIKPSGLKTMVVSAGQEQTNCNTSSLAYYEPVQ
GRKMLMALLSDNAYLKWARVEGKDGFVSVELQPPCKFLIAGPKGPEIRYLYFVKNLNN
LHRGQVLGHIAATVRLQAGSNTEFASNSSVLSLVNFTVDPQKAYLDFVNAGGAPLTNC
VKMLTPKTGTGIAISVKPESTADQETYGGASVCLYCRAHIEHPDVSGVCKYKGKFVQI
PAQCVRDPVGFCLSNTPCNVCQYWIGYGCNCDSLRQATLPQSKDSNFLNRVRGSIVNA
RIEPCSSGLSTDVVFRAFDICNYKAKVAGIGKYYKTNTCRFVELDDQGHHLDSYFVVK
RHTMENYELEKHCYDLLRDCDAVAPHDFFIFDVDKVKTPHIVRQRLTEYTMMDLVYAL
RHFDQNSEVLKAILVKYGCCDVTYFENKLWFDFVENPSVIGVYHKLGERVRQAILNTV
KFCDHMVKAGLVGVLTLDNQDLNGKWYDFGDFVITQPGSGVAIVDSYYSYLMPVLSMT
DCLAAETHRDCDFNKPLIEWPLTEYDFTDYKVQLFEKYFKYWDQTYHANCVNCTDDRC
VLHCANFNVLFAMTMPKTCFGPIVRKIFVDGVPFVVSCGYHYKELGLVMNMDVSLHRH
RLSLKELMMYAADPAMHIASSNAFLDLRTSCFSVAALTTGLTFQTVRPGNFNQDFYDF
VVSKGFFKEGSSVTLKHFFFAQDGNAAITDYNYYSYNLPTMCDIKQMLFCMEVVNKYF
EIYDGGCLNASEVVVNNLDKSAGHPFNKFGKARVYYESMSYQEQDELFAMTKRNVIPT
MTQMNLKYAISAKNRARTVAGVSILSTMTNRQYHQKMLKSMAATRGATCVIGTTKFYG
GWDFMLKTLYKDVDNPHLMGWDYPKCDRAMPNMCRIFASLILARKHATCCTTRDRFYR
LANECAQVLSEYVLCGGGYYVKPGGTSSGDATTAYANSVFNILQATTANVSALMGANG
NKIVDKEVKDMQFDLYVNVYRSTSPDPKFVDKYYAFLNKHFSMMILSDDGVVCYNSDY
AAKGYIAGIQNFKETLYYQNNVFMSEAKCWVETDLKKGPHEFCSQHTLYIKDGDDGYF
LPYPDPSRILSAGCFVDDIVKTDGTLMVERFVSLAIDAYPLTKHEDIEYQNVFWVYLQ
YIEKLYKDLTGHMLDSYSVMLCGDNSAKFWEEAFYRDLYSSPTTLQAVGSCVVCHSQT
SLRCGTCIRRPFLCCKCCYDHVIATPHKMVLSVSPYVCNAPGCGVSDVTKLYLGGMSY
FCVDHRPVCSFPLCANGLVFGLYKNMCTGSPSIVEFNRLATCDWTESGDYTLANTTTE
PLKLFAAETLRATEEASKQSYAIATIKEIVGERQLLLVWEAGKSKPPLNRNYVFTGYH
ITKNSKVQLGEYIFERIDYSDAVSYKSSTTYKLTVGDIFVLTSHSVATLTAPTIVNQE
RYVKITGLYPTITVPEEFASHVANFQKSGYSKYVTVQGPPGTGKSHFAIGLAIYYPTA
RVVYTACSHAAVDALCEKAFKYLNIAKCSRIIPAKARVECYDRFKVNETNSQYLFSTI
NALPETSADILVVDEVSMCTNYDLSIINARIKAKHIVYVGDPAQLPAPRTLLTRGTLE
PENFNSVTRLMCNLGPDIFLSMCYRCPKEIVSTVSALVYNNKLLAKKELSGQCFKILY
KGNVTHDASSAINRPQLTFVKNFITANPAWSKAVFISPYNSQNAVARSMLGLTTQTVD
SSQGSEYQYVIFCQTADTAHANNINRFNVAITRAQKGILCVMTSQALFESLEFTELSF
TNYKLQSQIVTGLFKDCSRETSGLSPAYAPTYVSVDDKYKTSDELCVNLNLPANVPYS
RVISRMGFKLDATVPGYPKLFITREEAVRQVRSWIGFDVEGAHASRNACGTNVPLQLG
FSTGVNFVVQPVGVVDTEWGNMLTGIAARPPPGEQFKHLVPLMHKGAAWPIVRRRIVQ
MLSDTLDKLSDYCTFVCWAHGFELTSASYFCKIGKEQKCCMCNRRAAAYSSPLQSYAC
WTHSCGYDYVYNPFFVDVQQWGYVGNLATNHDRYCSVHQGAHVASNDAIMTRCLAIHS
CFIERVDWDIEYPYISHEKKLNSCCRIVERNVVRAALLAGSFDKVYDIGNPKGIPIVD
DPVVDWHYFDAQPLTRKVQQLFYTEDMASRFADGLCLFWNCNVPKYPNNAIVCRFDTR
VHSEFNLPGCDGGSLYVNKHAFHTPAYDVSAFRDLKPLPFFYYSTTPCEVHGNGSMIE
DIDYVPLKSAVCITACNLGGAVCRKHATEYREYMEAYNLVSASGFRLWCYKTFDIYNL
WSTFTKVQGLENIAFNFVKQGHFIGVEGELPVAVVNDKIFTKSGVNDICMFENKTTLP
TNIAFELYAKRAVRSHPDFKLLHNLQADICYKFVLWDYERSNIYGTATIGVCKYTDID
VNSALNICFDIRDNGSLEKFMSTPNAIFISDRKIKKYPCMVGPDYAYFNGAIIRDSDV
VKQPVKFYLYKKVNNEFIDPTECIYTQSRSCSDFLPLSDMEKDFLSFDSDVFIKKYGL
ENYAFEHVVYGDFSHTTLGGLHLLIGLYKKQQEGHIIMEEMLKGSSTIHNYFITETNT
AAFKAVCSVIDLKLDDFVMILKSQDLGVVSKVVKVPIDLTMIEFMLWCKDGQVQTFYP
RLQASADWKPGHAMPSLFKVQNVNLERCELANYKQSIPMPRGVHMNIAKYMQLCQYLN
TCTLAVPANMRVIHFGAGSDKGIAPGTSVLRQWLPTDAIIIDNDLNEFVSDADITLFG
DCVTVRVGQQVDLVISDMYDPTTKNVTGSNESKALFFTYLCNLINNNLALGGSVAIKI
TEHSWSVELYELMGKFAWWTVFCTNANASSSEGFLLGINYLGTIKENIDGGAMHANYI
FWRNSTPMNLSTYSLFDLSKFQLKLKGTPVLQLKESQINELVISLLSQGKLLIRDNDT
LSVSTDVLVNTYRKLR"
CDS 257..13432
/codon_start=1
/product="ORF1a protein"
/protein_id="AKI29274.1"
/db_xref="GI:823104977"
/translation="MSFVAGVTAQGARGTYRAALNSEKHQDHVSLTVPLCGSGNLVEK
LSPWFIDGENAYEVVKAMLLKKEPLLYVPIRLAGHTRHLPGPRVYLVERLIACENPFM
VNQLAYSSSANGSLVGTTLQGKPIGMFFPYDIELVTGKQNILLRKYGRGGYHYTPFHY
ERDNTSCPEWMDDFEADPKGKYAQNLLKKLIGGDVTPVDQYMCGVDGKPISAYAFLMA
KDGITKLADVEADVAARADDEGFITLKNNLYRLVWHVERKDVPYPKQSIFTINSVVQK
DGVENTPPHYFTLGCKILTLTPRNKWSGVSDLSLKQKLLYTFYGKESLENPTYIYHSA
FIECGSCGNDSWLTGNAIQGFACGCGASYTANDVEVQSSGMIKPNALLCATCPFAKGD
SCSSNCKHSVAQLVSYLSERCNVIADPKSFTLIFGGVAYAYFGCEEGTMYFVPRAKSV
VSRIGDSVFTGCTGSWNKVTQIANMFLEQTQHSLNFVGEFVVNDVVLAILSGTTTNVD
KIRQLLKGVTLDKLRDYLADYDIAVTAGPFMDNAINVGGTGLQYAAITAPYVVLTGLG
ESFKKVATIPYKVCNSVKDTLTYYAHSVLYRVFPYDMDSGVSSFSELLFDCVDLSVAS
TYFLVRLLQDKAGDFMSTIITSCQTAVSKLLDTCFEATEATFNFLLDLAGLFRIFLRN
AYVYTSQGFVVVNGKVSTLVKQVLDLLNKGMQLLHTKVSWAGFNISAVIYSGRESLIF
PSGTYYCVTTKAKSVQQDLDVILPGEFSKKQLGLLQPTDNSTTVSVTVSSNMVETVVG
QLEQTNMHSPDVIVGDYVIISEKLFVRSKEEDGFAFYPACTNGHAVPTLFRLKGGAPV
KKVAFGGDQVHEVAAVRSVTVEYNIHAVLDTLLASSSLRTFVVDKSLSIEEFADVVKE
QVSDLLVKLLRGMPIPDFDLDDFIDAPCYCFNAEGDASWSSTMILSLHPVECDEECSE
VEASDLEEGESECISETSTEQVDVSHEISDDEWAAAVDEAFPLDEAEDVTESVQEEAQ
PVEVPVEDIAQVVIADTLQETPVVSDTVEVPPQVVKLPSEPQTIQPEVKEVAPVYEAD
TEQTQSVTVKPKRLRKKRNVDPLSNFEHKVITECVTIVLGDAIQVAKCYGESVLVNAA
NTHLKHGGGIAGAINAASKGAVQKESDEYILAKGPLQVGDSVLLQGHSLAKNILHVVG
PDARAKQDVSLLSKCYKAMNAYPLVVTPLVSAGIFGVKPAVSFDYLIREAKTRVLVVV
NSQDVYKSLTIVDIPQSLTFSYDGLRGAIRKAKDYGFTVFVCTDNSANTKVLRNKGVD
YTKKFFTVDGVQYYCYTSKDTLDDILQQANKSVGIISMPLGYVSHGLDLIQAGSVVRR
VNVPYVCLLANKEQEAILMSEDVKLNPSEDFIKHVRTNGGYNSWHLVEGELLVQDLRL
NKLLHWSDQTICYKDSVFYVVKNSTAFPFETLSACRAYLDSRTTQQLTIEVLVTVDGV
NFRTVVLNNKNTYRSQLGCVFFNGADISDTIPDEKQNGHSLYLADNLTADETKALKEL
YGPVDPTFLHRFYSLKAAVHKWKMVVCDKVRSLKLSDNNCYLNAVIMTLDLLKDIKFV
IPALQHAFMKHKGGDSTDFIALIMAYGNCTFGAPDDASRLLHTVLAKAELCCSARMVW
REWCNVCGIKDVVLQGLKACCYVGVQTVEDLRARMTYVCQCGGERHRQIVEHTTPWLL
LSGTPNEKLVTTSTAPDFVAFNVFQGIETAVGHYVHARLKGGLILKFDSGTVSKTSDW
KCKVTDVLFSGQKYSSDCNVVRYSLDGNFRTEVDPDLSAFYVKDGKYFTSEPPVTYSP
ATILAGSVYTNSCLVSSDGQPGGDAISLSFNNLLGFDSSKPVAKKYTYSFLPKEDGDV
LLAEFDTYDPIYKNGAMYKGKPILWVNKASYDTNLNKFNRASLRQIFDVAPIELENKF
TPLSVESTPVEPPTVDVVALQQEMTIVKCKGLNKPFVKDNVSFVADDSGTPVVEYLSK
EDLHTLYVDPKYQVIVLKDNVLSSMLRLHTVESGDINVVAASGSLTRKVKLLFRASFY
FKEFATRTFTATTAVGSCIKSVVRHLGVTKGILTGCFSFVKMLFMLPLAYFSDSKLGT
TEVKVSALKTAGVVTGNVVKQCCTAAVDLSMDKLRRVDWKSTLRLLLMLCTTMVLLSS
VYHLYVFNQVLSSDVMFEDAQGLKKFYKEVRAYLGISSACDGLASAYRANSFDVPTFC
ANRSAMCNWCLISQDSITHYPALKMVQTHLSHYVLNIDWLWFAFETGLAYMLYTSAFN
WLLLAGTLHYFFAQTSIFVDWRSYNYAVSSAFWLFTHIPMAGLVRMYNLLACLWLLRK
FYQHVINGCKDTACLLCYKRNRLTRVEASTVVCGGKRTFYITANGGISFCRRHNWNCV
DCDTAGVGNTFICEEVANDFTTALRRPINATDRSHYYVDSVTVKETVVQFNYRRDGQP
FYERFPLCAFTNLDKLKFKEVCKTTTGIPEYNFIIYDSSDRGQESLARSACVYYSQVL
CKSILLVDSSLVTSVGDSSEIATKMFDSFVNSFVSLYNVTRDKLEKLISTARDGVRRG
DNFHSVLTTFIDAARGPAGVESDVETNEIVDSVQYAHKHDIQITNESYNNYVPSYVKP
DSVSTSDLGSLIDCNAASVNQIVLRNSNGACIWNAAAYMKLSDALKRQIRIACRKCNL
AFRLTTSKLRANDNILSVRFTANKIVGGAPTWFNALRDFTLKGYVLATIIVFLCAVLM
YLCLPTFSMVPVEFYEDRILDFKVLDNGIIRDVNPDDKCFANKHRSFTQWYHEHVGGV
YDNSITCPLTVAVIAGVAGARIPDVPTTLAWLNNQIIFFVSRVFANTGSVCYTPIDEI
PYKSFSDSGCILPSECTMFRDAEGRMTPYCHDPTVLPGAFAYSQMRPHVRYDLYDGNM
FIKFPEVVFESTLRITRTLSTQYCRFGSCEYAQEGVCITTNGSWAIFNDHHLNRPGVY
CGSDFIDIVRRLAVSLFQPITYFQLTTSLVLGIGLCAFLTLLFYYINKVKRAFADYTQ
CAVIAVVAAVLNSLCICFVASIPLCIVPYTALYYYATFYFTNEPAFIMHVSWYIMFGP
IVPIWMTCVYTVAMCFRHFFWVLAYFSKKHVEVFTDGKLNCSFQDAASNIFVINKDTY
AALRNSLTNDAYSRFLGLFNKYKYFSGAMETAAYREAAACHLAKALQTYSETGSDLLY
QPPNCSITSGVLQSGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCP
ADQLSDPNYDALLISMTNHSFSVQKHIGAPANLRVVGHAMQGTLLKLTVDVANPSTPA
YTFTTVKPGAAFSVLACYNGRPTGTFTVVMRPNYTIKGSFLCGSCGSVGYTKEGSVIN
FCYMHQMELANGTHTGSAFDGTMYGAFMDKQVHQVQLTDKYCSVNVVAWLYAAILNGC
AWFVKPNRTSVVSFNEWALANQFTEFVGTQSVDMLAVKTGVAIEQLLYAIQQLYTGFQ
GKQILGSTMLEDEFTPEDVNMQIMGVVMQSGVRKVTYGTAHWLFATLVSTYVIILQAT
KFTLWNYLFETIPTQLFPLLFVTMAFVMLLVKHKHTFLTLFLLPVAICLTYANIVYEP
TTPISSALIAVANWLAPTNAYMRTTHTDIGVYISMSLVLVIVVKRLYNPSLSNFALAL
CSGVMWLYTYSIGEASSPIAYLVFVTTLTSDYTITVFVTVNLAKVCTYAIFAYSPQLT
LVFPEVKMILLLYTCLGFMCTCYFGVFSLLNLKLRAPMGVYDFKVSTQEFRFMTANNL
TAPRNSWEAMALNFKLIGIGGTPCIKVAAMQSKLTDLKCTSVVLLSVLQQLHLEANSR
AWAFCVKCHNDILAATDPSEAFEKFVSLFATLMTFSGNVDLDALASDIFDTPSVLQAT
LSEFSHLATFAELEAAQKAYQEAMDSGDTSPQVLKALQKAVNIAKNAYEKDKAVARKL
ERMADQAMTSMYKQARAEDKKAKIVSAMQTMLFGMIKKLDNDVLNGIISNARNGCIPL
SVIPLCASNKLRVVIPDFTVWNQVVTYPSLNYAGALWDITVINNVDNEIVKSSDVVDS
NENLTWPLVLECTRASTSAVKLQNNEIKPSGLKTMVVSAGQEQTNCNTSSLAYYEPVQ
GRKMLMALLSDNAYLKWARVEGKDGFVSVELQPPCKFLIAGPKGPEIRYLYFVKNLNN
LHRGQVLGHIAATVRLQAGSNTEFASNSSVLSLVNFTVDPQKAYLDFVNAGGAPLTNC
VKMLTPKTGTGIAISVKPESTADQETYGGASVCLYCRAHIEHPDVSGVCKYKGKFVQI
PAQCVRDPVGFCLSNTPCNVCQYWIGYGCNCDSLRQATLPQSKDSNFLNESGVLL"
CDS 21434..25495
/codon_start=1
/product="S protein"
/protein_id="AKI29275.1"
/db_xref="GI:823104978"
/translation="MIHSVFLLMFLLTPTESYVDVGPDSVKSACIEVDIQQTFFDKTW
PRPIDVSKADGIIYPQGRTYSNITITYQGLFPYQGDHGDMYVYSAGHATGTTPQKLFV
ANYSQDVKQFANGFVVRIGAAANSTGTVIISPSTSATIRKIYPAFMLGSSVGNFSDGK
MGRFFNHTLVLLPDGCGTLLRAFYCILEPRSGNHCPAGNSYTSFATYHTPATDCSDGN
YNRNASLNSFKEYFNLRNCTFMYTYNITEDEILEWFGITQTAQGVHLFSSRYVDLYGG
NMFQFATLPVYDTIKYYSIIPHSIRSIQSDRKAWAAFYVYKLQPLTFLLDFSVDGYIR
RAIDCGFNDLSQLHCSYESFDVESGVYSVSSFEAKPSGSVVEQAEGVECDFSPLLSGT
PPQVYNFKRLVFTNCNYNLTKLLSLFSVNDFTCSQISPAAIASNCYSSLILDYFSYPL
SMKSDLSVSSAGPISQFNYKQSFSNPTCLILATVPHNLTTITKPLKYSYINKCSRLLS
DDRTEVPQLVNANQYSPCVSIVPSTVWEDGDYYRKQLSPLEGGGWLVASGSTVAMTEQ
LQMGFGITVQYGTDTNSVCPKLEFANDTKIASQLGNCVEYSLYGVSGRGVFQNCTAVG
VRQQRFVYDAYQNLVGYYSDDGNYYCLRACVSVPVSVIYDKETKTHATLFGSVACEHI
SSTMSQYSRSTRSMLKRRDSTYGPLQTPVGCVLGLVNSSLFVEDCKLPLGQSLCALPD
TPSTLTPRSVRSVPGEMRLASIAFNHPIQVDQLNSSYFKLSIPTNFSFGVTQEYIQTT
IQKVTVDCKQYVCNGFQKCEQLLREYGQFCSKINQALHGANLRQDDSVRNLFASVKSS
QSSPIIPGFGGDFNLTLLEPVSISTGSRSARSAIEDLLFDKVTIADPGYMQGYDDCMQ
QGPASARDLICAQYVAGYKVLPPLMDVNMEAAYTSSLLGSIAGVGWTAGLSSFAAIPF
AQSIFYRLNGVGITQQVLSENQKLIANKFNQALGAMQTGFTTTNEAFRKVQDAVNNNA
QALSKLASELSNTFGAISASIGDIIQRLDVLEQDAQIDRLINGRLTTLNAFVAQQLVR
SESAALSAQLAKDKVNECVKAQSKRSGFCGQGTHIVSFVVNAPNGLYFMHVGYYPSNH
IEVVSAYGLCDAANPTNCIAPVNGYFIKTNNTRIVDEWSYTGSSFYAPEPITSLNTKY
VAPQVTYQNISTNLPPPLLGNSTGIDFQDELDEFFKNVSTSIPNFGSLTQINTTLLDL
TYEMLSLQQVVKALNESYIDLKELGNYTYYNKWPWYIWLGFIAGLVALALCAFFILCC
TGCGTNCMGKLKCNRCCDRYEEYDLEPHKVHVH"
CDS 25510..25821
/codon_start=1
/product="NS3A protein"
/protein_id="AKI29276.1"
/db_xref="GI:823104979"
/translation="MRVQRPPTLLLVFSLSLLVTAFSKPLYVPEHCQNYSGCMLRACI
KTAQADTAGLYTNFRIDVPSAESTGTQSVSVDRESTSTHDGPTEHVTSVNLFDVGYSV
N"
CDS 25830..26159
/codon_start=1
/product="NS3B protein"
/protein_id="AKI29277.1"
/db_xref="GI:823104980"
/translation="MDYVSLLNQIWQKYLNSPYTTCLYIPKPTAKYTPLVGTSLHPVL
WNCQLSFAGYTESAVNSTKALAKQDAAQRIAWLLHKDGGIPDGCSLYLRHSSLFAQSE
EEESFSN"
CDS 26071..26811
/codon_start=1
/product="NS3C protein"
/protein_id="AKI29278.1"
/db_xref="GI:823104981"
/translation="MEESLMDVPSTSGTQVYSRKARKRSHSPTKKLRYVKRRFSLLRP
EDLSVIVQPTHYVRVTFSDPNMWYLRSGHHLHSVHNWLKPYGGQPVSEYHITLALLNL
TDEDLARDFSPIALFLRNVRFELHEFALLRKTLVLNASEIYCANIHRFKPVYRVNTAI
PTIKDWLLVQGFSLYHSGLPLHMSISKLHALDDVTRNYIITMPCFRTYPQQMFVTPLA
VDVVSIRSSNQGNKQIVHSYPILHHPGF"
CDS 26818..27492
/codon_start=1
/product="NS3D protein"
/protein_id="AKI29279.1"
/db_xref="GI:823104982"
/translation="MAFSASLFKPVQLVPVSPAFHRIESTDSIVFTYIPASGYVAALA
VNVCLIPLLLLLRQDTCRRSIIRTMVLYFLVLYNFLLAIVLVNGVHYPTGSCLIAFLV
ILIILWFVDRIRFCLMLNSYIPLFDMRSHFIRVSTVSSHGMVPVIHTKPLFIRNFDQR
CSCSRCFYLHSSTYIECTYISRFSKISLVSVTDFSLNGNVSTVFVPATRDSVPLHIIA
PSSLIV"
CDS 27568..27816
/codon_start=1
/product="E protein"
/protein_id="AKI29280.1"
/db_xref="GI:823104983"
/translation="MLPFVQERIGLFIVNFFIFTVVCAITLLVCMAFLTATRLCVQCM
TGFNTLLVQPALYLYNTGRSVYVKFQDSKPPLPPDEWV"
CDS 27831..28490
/codon_start=1
/product="M protein"
/protein_id="AKI29281.1"
/db_xref="GI:823104984"
/translation="MSNMTQLTEAQIIAIIKDWNFAWSLIFLLITIVLQYGYPSRSMT
VYVFKMFVLWLLWPSSMALSIFSAIYPIDLASQIISGIVAAVSAMMWISYFVQSIRLF
MRTGSWWSFNPETNCLLNVPFGGTTVVRPLVEDSTSVTAVVTNGHLKMAGMHFGACDY
DRLPNEVTVAKPNVLIALKMVKRQSYGTNSGVAIYHRYKAGNYRSPPITADIELALLR
A"
CDS 28544..29785
/codon_start=1
/product="N protein"
/protein_id="AKI29282.1"
/db_xref="GI:823104985"
/translation="MASPAAPRAVSFADNNDITNTNLSRGRGRNPKPRAAPNNTVSWY
TGLTQHGKVPLTFPPGQGVPLNANSTPAQNAGYWRRQDRKINTGNGIKQLAPRWYFYY
TGTGPEAALPFRAVKDGIVWVHEDGATDAPSTFGTRNPNNDSAIVTQFAPGTKLPKNF
HIEGTGGNSQSSSRASSVSRNSSRSSSQGSRSGNSTRGTSPGPSGIGAVGGDLLYLDL
LNRLQALESGKVKQSQPKVITKKDAAAAKNKMRHKRTSTKSFNMVQAFGLRGPGDLQG
NFGDLQLNKLGTEDPRWPQIAELAPTASAFMGMSQFKLTHQNNDDHGNPVYFLRYSGA
IKLDPKNPNYNKWLELLEQNIDAYKTFPKKEKKQKAPKEESTDQMSEPPKEQRVQGSI
TQRIRTRPSVQPGPMIDVNTD"

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Thu Jun 04, 2015 7:34 pm 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
1 atctcacttc ccctcgttct cttgcagaac tttgatttta acgaacttaa ataaaagccc
61 tgttgtttag cgtattgttg cacttgtctg gtgggattgt ggcattaatt tgcctgctca
121 tctaggcagt ggacatatgc tcaacactgg gtataattct aattgaatac tatttttcag
181 ttagagcgtc gtgtctcttg tacgtctcgg tcacaataca cggtttcgtc cggtgcgtgg
241 caattcgggg cacatcatgt ctttcgtggc tggtgtgacc gcgcaaggtg cgcgcggtac
301 gtatcgagca gcgctcaact ctgaaaaaca tcaagaccat gtgtctctaa ctgtgccact
361 ctgtggttca ggaaacctgg ttgaaaaact ttcaccatgg ttcattgatg gcgaaaatgc
421 ctatgaagtg gtgaaggcca tgttacttaa aaaggagcca cttctctatg tgcccatccg
481 gctggctgga cacactagac acctcccagg tcctcgtgta tacctggttg agaggctcat
541 tgcttgtgaa aatccattca tggttaacca attggcttat agctctagtg caaatggcag
601 cttggttggc acaactttgc agggcaagcc tattggtatg ttcttccctt atgacatcga
661 acttgtcaca ggaaagcaaa atattctcct gcgcaagtat ggccgtggtg gttatcacta
721 caccccattc cactatgagc gagacaacac ctcttgccct gagtggatgg acgattttga
781 ggcggatcct aaaggcaaat atgcccagaa tctgcttaag aagttgattg gcggtgatgt
841 cactccagtt gaccaataca tgtgtggcgt tgatggaaaa cccattagtg cctacgcatt
901 tttaatggcc aaggatggaa taaccaaact ggctgatgtt gaagcggacg tcgcagcacg
961 tgctgatgac gaaggcttca tcacattaaa gaacaatcta tatagattgg tttggcatgt
1021 tgagcgtaaa gacgttccat atcctaagca atctattttt actattaata gtgtggtcca
1081 aaaggatggt gttgaaaaca ctcctcctca ctattttact cttggatgca aaattttaac
1141 gctcacccca cgcaacaagt ggagtggcgt ttctgacttg tccctcaaac aaaaactcct
1201 ttacaccttc tatggtaagg agtcacttga gaacccaacc tacatttacc actccgcatt
1261 cattgagtgt ggaagttgtg gtaatgattc ctggcttaca gggaatgcta tccaagggtt
1321 tgcctgtgga tgtggggcat catatacagc taatgatgtc gaagtccaat catctggcat
1381 gattaagcca aatgctcttc tttgtgctac ttgccccttt gctaagggtg atagctgttc
1441 ttctaattgc aaacattcag ttgctcagtt ggttagttac ctttctgaac gttgtaatgt
1501 tattgctgat cctaagtcct tcacacttat ctttggtggc gtagcttacg cctactttgg
1561 atgtgaggaa ggtactatgt actttgtgcc tagagctaag tctgttgtct caaggattgg
1621 agactccgtc tttacaggct gtactggctc ttggaacaag gttactcaaa ttgctaacat
1681 gttcttggaa cagactcagc attcccttaa ctttgtggga gagttcgttg tcaacgatgt
1741 tgtcctcgca attctctctg gaaccacaac taatgttgac aaaatacgcc agcttctcaa
1801 gggtgtcacc cttgacaagt tgcgtgatta tttagctgac tatgacatag cagtcactgc
1861 cggcccattc atggataatg ctattaatgt tggtggtaca ggattacagt atgccgccat
1921 tactgcacct tatgtagttc tcactggctt aggtgagtcc tttaagaaag ttgcaaccat
1981 accgtacaag gtttgcaact ctgttaagga tactctgact tattatgctc acagcgtgtt
2041 gtacagagtt tttccttatg acatggattc tggtgtgtca tcttttagtg aactactttt
2101 tgattgcgtt gatctttcag tagcttctac ctatttttta gtccgcctct tgcaagataa
2161 ggctggcgac tttatgtcta caattattac ttcctgccaa actgctgtta gtaagcttct
2221 agatacatgt tttgaagcta cagaagcaac atttaacttc ttgttagatt tggcaggatt
2281 gttcagaatc tttcttcgca atgcctatgt gtacacttca caagggtttg tggtggtcaa
2341 tggcaaagtt tctacacttg tcaaacaagt gttagacttg cttaataagg gtatgcaact
2401 tttgcataca aaggtctcct gggctggttt taatatcagt gctgttatct acagcggcag
2461 ggagtctcta atattcccat cgggaaccta ttactgtgtc accactaagg ctaagtccgt
2521 tcaacaagat cttgacgtta ttttgcctgg tgagttttcc aagaagcagt taggactgct
2581 ccaacctact gacaattcta caactgttag tgttactgta tccagtaaca tggttgaaac
2641 tgttgtgggt caacttgagc aaactaatat gcatagtcct gatgttatag taggtgacta
2701 tgtcattatt agtgaaaaat tgtttgtgcg tagtaaggaa gaagacggat ttgccttcta
2761 ccctgcttgc actaatggtc atgctgtacc gactctcttt agacttaagg gaggtgcacc
2821 tgtaaaaaaa gtagcctttg gcggtgatca agtacatgag gttgctgctg taagaagtgt
2881 tactgtcgag tacaacattc atgctgtatt agacacacta cttgcttctt ctagtcttag
2941 aacctttgtt gtagataagt ctttgtcaat tgaggagttt gctgacgtag taaaggaaca
3001 agtctcagac ttgcttgtta aattactgcg tggaatgccg attccagatt ttgatttaga
3061 cgattttatt gacgcaccat gctattgctt taacgctgag ggtgatgcat cttggtcttc
3121 tactatgatc ctctctcttc accccgtcga gtgtgacgag gagtgttctg aagtagaggc
3181 ttcagattta gaagaaggtg aatcagagtg catttctgag acttcaactg aacaagttga
3241 cgtttctcat gagatttctg acgacgagtg ggctgctgca gttgatgaag cgttccctct
3301 cgatgaagca gaagatgtta ctgaatctgt gcaagaagaa gcacaaccag tagaagtacc
3361 tgttgaagat attgcgcagg ttgtcatagc tgacacctta caggaaactc ctgttgtgtc
3421 tgatactgtt gaagtcccac cgcaagtggt gaaacttccg tctgaacctc agactatcca
3481 gcccgaggta aaagaagttg cacctgtcta tgaggctgat accgaacaga cacagagtgt
3541 tactgttaaa cctaagaggt tacgcaaaaa gcgtaatgtt gaccctttgt ccaattttga
3601 acataaggtt attacagagt gcgttaccat agttttaggt gacgcaattc aagtagccaa
3661 gtgctatggt gagtctgtgt tagttaatgc tgctaacaca catcttaagc atggcggtgg
3721 tatcgctggt gctattaatg cggcttcaaa aggggctgtc caaaaagagt cagatgagta
3781 tattctggct aaagggccgt tacaagtagg agattcagtt ctcttgcaag gccattctct
3841 agctaagaat atcctgcatg tcgtaggccc agatgcccgc gctaaacagg atgtttctct
3901 ccttagtaag tgctataagg ctatgaatgc atatcctctt gtagtcactc ctcttgtttc
3961 agcaggcata tttggtgtaa aaccagctgt gtcttttgat tatcttatta gagaggctaa
4021 gactagagtt ttagtcgtcg ttaattccca agatgtctat aagagtctta ccatagttga
4081 cattccacag agtttgactt tttcatatga tgggttacgt ggcgcaatac gtaaagctaa
4141 agattatggt tttactgttt ttgtgtgcac agacaactct gctaacacta aagttcttag
4201 gaacaagggt gttgattata ctaagaagtt ttttacagtt gacggtgtgc aatattattg
4261 ctacacgtct aaggacactt tagatgatat cttacaacag gctaataagt ctgttggtat
4321 tatatctatg cctttgggat atgtgtctca tggtttagac ttaattcaag cagggagtgt
4381 cgtgcgtaga gttaacgtgc cctacgtgtg tctcctagct aataaagagc aagaagctat
4441 tttgatgtct gaagacgtta agttaaaccc ttcagaagat tttataaagc acgtccgcac
4501 taatggtggt tacaattctt ggcatttagt cgagggtgaa ctattggtgc aagacttacg
4561 cttaaataag ctcctgcatt ggtctgatca aaccatatgc tacaaggata gtgtgtttta
4621 tgttgtaaag aatagtacag cttttccatt tgaaacactt tcagcatgtc gtgcgtattt
4681 ggattcacgc acgacacagc agttaacaat cgaagtctta gtgactgtcg atggtgtaaa
4741 ttttagaaca gtcgttctaa ataataagaa cacttataga tcacagcttg gatgcgtttt
4801 ctttaatggt gctgatattt ctgataccat tcctgatgag aaacagaatg gtcacagttt
4861 atatctagca gacaatttga ctgctgatga aacaaaggcg cttaaagagt tatatggccc
4921 cgttgatcct actttcttac acagattcta ttcacttaag gctgcagtcc ataagtggaa
4981 gatggttgtg tgtgataagg tacgttctct caaattgagt gataataatt gttatcttaa
5041 tgcagttatt atgacacttg atttattgaa ggacattaaa tttgttatac ctgctctaca
5101 gcatgcattt atgaaacata agggcggtga ttcaactgac ttcatagccc tcattatggc
5161 ttatggcaat tgcacatttg gtgctccaga tgatgcctct cggttacttc ataccgtgct
5221 tgcaaaggct gagttatgct gttctgcacg catggtttgg agagagtggt gcaatgtctg
5281 tggcataaaa gatgttgttc tacaaggctt aaaagcttgt tgttacgtgg gtgtgcaaac
5341 tgttgaagat ctgcgtgctc gtatgacata tgtatgccag tgtggtggtg aacgtcatcg
5401 gcaaatagtc gaacacacca ccccctggtt gctgctctca ggcacaccaa atgaaaaatt
5461 ggtgacaacc tccacggcgc ctgattttgt agcgtttaat gtctttcagg gcattgaaac
5521 ggctgttggc cattatgttc atgctcgcct gaagggtggt cttattttaa agtttgactc
5581 tggcaccgtt agcaagactt cagactggaa gtgcaaggtg acagatgtac ttttctccgg
5641 ccaaaaatac agtagcgatt gtaatgtcgt acggtattct ttggacggta atttcagaac
5701 agaggttgat cccgacctat ctgctttcta tgttaaggat ggtaaatact ttacaagtga
5761 accacccgta acatattcac cagctacaat tttagctggt agtgtctaca ctaatagctg
5821 ccttgtatcg tctgatggac aacctggcgg tgatgctatt agtttgagtt ttaataacct
5881 tttagggttt gattctagta aaccagtcgc taagaaatac acttactcct tcttgcctaa
5941 agaagacggc gatgtgttgt tggctgagtt tgacacttat gaccctattt ataagaatgg
6001 tgccatgtat aaaggcaaac caattctttg ggtcaacaaa gcatcttatg atactaatct
6061 taataagttc aatagagcta gtttgcgtca aatttttgac gtagccccca ttgaactcga
6121 aaataaattc acacctttga gtgtggagtc tacaccagtt gaacctccaa ctgtagatgt
6181 ggtagcactt caacaggaaa tgacaattgt caaatgtaag ggtttaaata aacctttcgt
6241 gaaggacaat gtcagtttcg ttgctgatga ctcaggtact cccgttgttg agtatctgtc
6301 taaagaagat ctacatacat tgtatgtaga ccctaagtat caagtcattg tcttaaaaga
6361 caatgtactt tcttctatgc ttagattgca caccgttgag tcaggtgata ttaacgttgt
6421 tgcagcttcc ggatctttga cacgtaaagt gaaattacta tttagggctt cattttattt
6481 caaagaattt gctacccgca ctttcactgc taccactgct gtaggtagtt gtataaagag
6541 tgtagtgcgg catctaggtg ttactaaagg catattgaca ggctgtttta gttttgtcaa
6601 gatgttattt atgcttccac tagcttactt tagtgattca aaactcggca ccacagaggt
6661 taaagtgagt gctttgaaaa cagctggcgt tgtgacaggt aatgttgtaa aacagtgttg
6721 cactgctgct gttgatttaa gtatggataa gttgcgccgt gtggattgga aatcaaccct
6781 acggttgtta cttatgttat gcacaactat ggtattgttg tcttctgtgt atcacttgta
6841 tgtcttcaat caggtcttat caagtgatgt tatgtttgaa gatgcccaag gtttgaaaaa
6901 gttctacaaa gaagttagag cttacctagg aatctcttct gcttgtgacg gtcttgcttc
6961 agcttatagg gcgaattcct ttgatgtacc tacattctgc gcaaaccgtt ctgcaatgtg
7021 taattggtgc ttgattagcc aagattccat aactcactac ccagctctta agatggttca
7081 aacacatctt agccactatg ttcttaacat agattggttg tggtttgcat ttgagactgg
7141 tttggcatac atgctctata cctcggcctt caactggttg ttgttggcag gtacattgca
7201 ttatttcttt gcacagactt ccatatttgt agactggcgg tcatacaatt atgctgtgtc
7261 tagtgccttc tggttattca cccacattcc aatggcgggt ttggtacgaa tgtataattt
7321 gttagcatgc ctttggcttt tacgcaagtt ttatcagcat gtaatcaatg gttgcaaaga
7381 tacggcatgc ttgctctgct ataagaggaa ccgacttact agagttgaag cttctaccgt
7441 tgtctgtggt ggaaaacgta cgttttatat cacagcaaat ggcggtattt cattctgtcg
7501 taggcataat tggaattgtg tggattgtga cactgcaggt gtggggaata ccttcatctg
7561 tgaagaagtc gcaaatgact tcactaccgc cctacgcagg cctattaacg ctacggatag
7621 atcacattat tatgtggatt ccgttacagt taaagagact gttgttcagt ttaattatcg
7681 tagagacggt caaccattct acgagcggtt tcccctctgc gcttttacaa atctagataa
7741 gttgaagttc aaagaggtct gtaaaactac tactggtata cctgaataca actttatcat
7801 ctacgactca tcagatcgtg gccaggaaag tttagctagg tctgcatgtg tttattattc
7861 tcaagtcttg tgtaaatcaa ttcttttggt tgactcaagt ttggttactt ctgttggtga
7921 ttctagtgaa atcgccacta aaatgtttga ttcctttgtt aatagtttcg tctcgctgta
7981 taatgtcaca cgcgataagt tggaaaaact tatctctact gctcgtgatg gcgtaaggcg
8041 aggcgataac ttccatagtg tcttaacaac attcattgac gcagcacgag gccccgcagg
8101 tgtggagtct gatgttgaga ccaatgaaat tgttgactct gtgcagtatg ctcataaaca
8161 tgacatacaa attactaatg agagttacaa taattatgta ccctcatatg ttaaacctga
8221 tagtgtgtct accagtgatt taggtagtct cattgattgt aatgcggctt cagttaacca
8281 aattgtcttg cgtaattcta atggtgcttg tatttggaac gctgctgcat atatgaaact
8341 ctcggatgca cttaaacgac agattcgcat tgcatgccgt aagtgtaatt tagctttccg
8401 gttaaccacc tcaaagctac gcgctaatga taatatctta tcagttagat tcactgctaa
8461 caaaattgtt ggtggtgctc ctacatggtt taatgcgttg cgtgacttta cgttaaaggg
8521 ttacgttctt gctaccatta ttgtgtttct gtgtgctgta ctgatgtatt tgtgtttacc
8581 tacattttct atggtacctg ttgaatttta tgaagaccgc atcttggact ttaaagttct
8641 tgataatggt atcattaggg atgtaaatcc tgatgataag tgctttgcta ataagcaccg
8701 gtccttcaca caatggtatc atgagcatgt tggtggtgtc tatgacaact ctatcacatg
8761 cccattgaca gttgcagtaa ttgctggagt tgctggtgct cgcattccag acgtacctac
8821 tacattggct tggttgaaca atcagataat tttctttgtt tctcgagtct ttgctaatac
8881 aggcagtgtt tgctacactc ctatagatga gataccctat aagagtttct ctgatagtgg
8941 ttgcattctt ccatctgagt gcactatgtt tagggatgca gagggccgta tgacaccata
9001 ctgccatgat cctactgttt tgcctggggc ttttgcgtac agtcagatga ggcctcatgt
9061 tcgttacgac ttgtatgatg gtaacatgtt tattaaattt cctgaagtag tatttgaaag
9121 tacacttagg attactagaa ctctgtcaac tcagtactgc cggttcggta gttgtgagta
9181 tgcacaagag ggtgtttgta ttaccacaaa tggctcgtgg gccattttta atgaccacca
9241 tcttaataga cctggtgtct attgtggctc tgattttatt gacattgtca ggcggttagc
9301 agtatcactg ttccagccta ttacttattt ccaattgact acctcattgg tcttgggtat
9361 aggtttgtgt gcgttcctga ctttgctctt ctattatatt aataaagtaa aacgtgcttt
9421 tgcagattac acccagtgtg ctgtaattgc tgttgttgct gctgttctta atagcttgtg
9481 catctgcttt gttgcctcta taccattgtg tatagtacct tacactgcat tgtactatta
9541 tgctacattc tattttacta atgagcctgc atttattatg catgtttctt ggtacattat
9601 gttcgggcct atcgttccca tatggatgac ctgcgtttat acagttgcaa tgtgctttag
9661 acacttcttc tgggttttag cttattttag taagaaacat gtagaagttt ttactgatgg
9721 taagcttaat tgtagtttcc aggacgctgc ctctaatatc tttgttatta acaaggacac
9781 ttatgcagct cttagaaact ctttaactaa tgatgcctat tcacgatttt tggggttgtt
9841 taacaagtat aagtacttct ctggtgctat ggaaacagcc gcttatcgtg aagctgcagc
9901 atgtcatctt gctaaagcct tacaaacata cagcgagact ggtagtgatc ttctttacca
9961 accacccaac tgtagcataa cctctggcgt gttgcaaagc ggtttggtga aaatgtcaca
10021 tcccagtgga gatgttgagg cttgtatggt tcaggttacc tgcggtagca tgactcttaa
10081 tggtctttgg cttgacaaca cagtctggtg cccacgacac gtaatgtgcc cggctgacca
10141 gttgtctgat cctaattatg atgccttgtt gatttctatg actaatcata gtttcagtgt
10201 gcaaaaacac attggcgctc cagcaaactt gcgtgttgtt ggtcatgcca tgcaaggcac
10261 tcttttgaag ttgactgtcg atgttgctaa ccctagcact ccagcctaca cttttacaac
10321 agtgaaacct ggcgcagcat ttagtgtgtt agcatgctat aatggtcgtc cgactggtac
10381 attcactgtt gtaatgcgcc ctaactacac aattaagggt tcctttctgt gtggttcttg
10441 tggtagtgtt ggttacacca aggagggtag tgtgatcaat ttttgttaca tgcatcaaat
10501 ggaacttgct aatggtacac ataccggttc agcatttgat ggtactatgt atggtgcctt
10561 tatggataaa caagtgcacc aagttcagtt aacagacaaa tactgcagtg ttaatgtagt
10621 agcttggctt tacgcagcaa tacttaatgg ttgcgcttgg tttgtaaaac ccaatcgcac
10681 tagtgttgtt tcttttaatg aatgggctct tgccaaccaa ttcactgaat ttgttggcac
10741 tcaatccgtt gacatgttag ctgtcaaaac aggcgttgct attgaacagc tgctttatgc
10801 gatccaacaa ctttatactg ggttccaggg aaagcaaatc cttggcagta ctatgttgga
10861 agatgaattc acacctgagg atgttaatat gcagattatg ggtgtggtta tgcagagtgg
10921 tgtgagaaaa gttacatatg gtactgcgca ttggttgttc gcgacccttg tctcaaccta
10981 tgtgataatc ttacaagcca ctaaatttac tttgtggaac tacttgtttg agactattcc
11041 cacacagttg ttcccactct tatttgtgac tatggccttc gttatgttgt tggttaaaca
11101 caaacacacc tttttgacac ttttcttgtt gcctgtggct atttgtttga cttatgcaaa
11161 catagtctac gagcccacta ctcccatttc gtcagcgctg attgcagttg caaattggct
11221 tgcccccact aatgcttata tgcgcactac acatactgat attggtgtct acattagtat
11281 gtcacttgta ttagtcattg tagtgaagag attgtacaac ccatcacttt ctaactttgc
11341 gttagcattg tgcagtggtg taatgtggtt gtacacttat agcattggag aagcctcaag
11401 ccccattgcc tatctggttt ttgtcactac actcactagt gattatacga ttacagtctt
11461 tgttactgtc aaccttgcaa aagtttgcac ttatgccatc tttgcttact caccacagct
11521 tacacttgtg tttccggaag tgaagatgat acttttatta tacacatgtt taggtttcat
11581 gtgtacttgc tattttggtg tcttctctct tttgaacctt aagcttagag cacctatggg
11641 tgtctatgac tttaaggtct caacacaaga gttcagattc atgactgcta acaatctaac
11701 tgcacctaga aattcttggg aggctatggc tctgaacttt aagttaatag gtattggcgg
11761 tacaccttgt ataaaggttg ctgctatgca gtctaaactt acagatctta aatgcacatc
11821 tgtggttctc ctctctgtgc tccaacagtt acacttagag gctaatagta gggcctgggc
11881 tttctgtgtt aaatgccata atgatatatt ggcagcaaca gaccccagtg aggctttcga
11941 gaaattcgta agtctctttg ccactttaat gactttttct ggtaatgtag atcttgatgc
12001 gttagctagt gatatttttg acactcctag cgtacttcaa gctactcttt ctgagttttc
12061 acacttagct acctttgctg agttggaagc tgcgcagaaa gcctatcagg aagctatgga
12121 ctctggtgac acctcaccac aagttcttaa ggctttgcag aaggctgtta atatagctaa
12181 aaacgcctat gagaaggata aggcagtggc ccgtaagtta gaacgtatgg ctgaccaggc
12241 tatgacttct atgtataagc aagcacgtgc tgaagacaag aaagcaaaaa ttgtcagtgc
12301 tatgcaaact atgttgtttg gtatgattaa gaagctcgac aacgatgttc ttaatggtat
12361 catttctaac gctaggaatg gttgtatacc tcttagtgtc attccactgt gtgcttcaaa
12421 taaacttcgc gttgtaattc ctgacttcac cgtctggaat caggtagtca catatccctc
12481 gcttaactac gctggggctt tgtgggacat tacagttata aacaatgtgg acaatgaaat
12541 tgttaagtct tcagatgttg tagacagcaa tgaaaattta acatggccac ttgttttaga
12601 atgcactagg gcatccactt ctgccgttaa gttgcaaaat aatgagatca aaccttcagg
12661 tttaaaaacc atggttgtgt ctgcaggtca agagcaaact aactgtaata ctagttcctt
12721 agcttattac gaacctgtgc agggtcgtaa aatgctgatg gctcttcttt ctgataatgc
12781 ctatctcaaa tgggcgcgtg ttgaaggtaa ggacggattt gttagtgtag agctacaacc
12841 tccttgcaaa ttcttgattg cgggaccaaa aggacctgaa atccgatatc tctattttgt
12901 taaaaatctt aacaaccttc atcgcgggca agtgttaggg cacattgctg cgactgttag
12961 attgcaagct ggttctaaca ccgagtttgc ctctaattct tcggtgttgt cacttgttaa
13021 cttcaccgtt gatcctcaaa aagcttatct cgatttcgtc aatgcgggag gtgccccatt
13081 gacaaattgt gttaagatgc ttactcctaa aactggtaca ggtatagcta tatctgttaa
13141 accagagagt acagctgatc aagagactta tggtggagct tcagtgtgtc tctattgccg
13201 tgcgcatata gaacatcctg atgtctctgg tgtttgtaaa tataagggta agtttgtcca
13261 aatccctgct cagtgtgtcc gtgaccctgt gggattttgt ttgtcaaata ccccctgtaa
13321 tgtctgtcaa tattggattg gatatgggtg caattgtgac tcgcttaggc aagcaacact
13381 gccccaatct aaagattcca attttttaaa cgagtccggg gttctattgt aaatgcccga
13441 atagaaccct gttcaagtgg tttgtccact gatgtcgttt ttagggcatt tgacatctgc
13501 aactataagg ctaaggttgc tggtattgga aaatactaca agactaatac ttgtaggttt
13561 gtagaattag atgaccaagg gcatcattta gactcctatt ttgtcgttaa gaggcatact
13621 atggagaatt atgaactaga gaagcactgt tacgatttgt tacgtgactg tgatgctgta
13681 gctccccatg atttcttcat ctttgatgta gacaaagtta aaacacctca tattgtacgt
13741 cagcgtttaa ctgagtacac tatgatggat cttgtatatg ccctgaggca ctttgatcaa
13801 aatagcgaag tgcttaaggc tatcttagtg aagtatggtt gctgtgatgt tacctacttt
13861 gaaaataaac tctggtttga tttcgttgaa aatcccagtg ttattggtgt ttatcataaa
13921 cttggagaac gtgtacgcca agctatctta aacactgtta aattttgtga ccacatggtc
13981 aaggctggtt tagtcggtgt gctcacacta gacaaccagg accttaatgg caagtggtat
14041 gattttggtg acttcgtaat cactcaacct ggttcaggag tagctatagt tgatagctac
14101 tattcttatt tgatgcctgt gctctcaatg accgattgtc tggccgctga gacacatagg
14161 gattgtgatt ttaataaacc actcattgag tggccactta ctgagtatga ttttactgat
14221 tataaggtac aactctttga gaagtacttt aaatattggg atcagacgta tcacgcaaat
14281 tgcgttaatt gtactgatga ccgttgtgtg ttacattgtg ctaatttcaa tgtattgttt
14341 gctatgacca tgcctaagac ttgtttcgga cccatagtcc gaaagatctt tgttgatggc
14401 gtgccatttg tagtatcttg tggttatcac tacaaagaat taggtttagt catgaatatg
14461 gatgttagtc tccatagaca taggctctct cttaaagagt tgatgatgta tgccgctgat
14521 ccagccatgc acattgcctc ctctaacgct tttcttgatt tgaggacatc atgttttagt
14581 gtcgctgcac ttacaactgg tttgactttt caaactgtgc ggcctggcaa ttttaaccaa
14641 gacttctatg atttcgtggt atctaaaggt ttctttaagg agggctcttc agtgacgctc
14701 aaacattttt tctttgctca agatggtaat gctgctatta cagattataa ttactattct
14761 tataatctgc ctactatgtg tgacatcaaa caaatgttgt tctgcatgga agttgtaaac
14821 aagtacttcg aaatctatga cggtggttgt cttaatgctt ctgaagtggt tgttaataat
14881 ttagacaaga gtgctggcca tccttttaat aagtttggca aagctcgtgt ctattatgag
14941 agcatgtctt accaggagca agatgaactc tttgccatga caaagcgtaa cgtcattcct
15001 accatgactc aaatgaatct aaaatatgct attagtgcta agaatagagc tcgcactgtt
15061 gcaggcgtgt ccatacttag cacaatgact aatcgccagt accatcagaa aatgcttaag
15121 tccatggctg caactcgtgg agcgacttgc gtcattggta ctacaaagtt ctatggtggc
15181 tgggatttca tgcttaaaac attgtacaaa gatgttgata atccgcatct tatgggttgg
15241 gattacccta agtgtgatag agctatgcct aatatgtgta gaatcttcgc ttcactcata
15301 ttagctcgta aacatgccac ttgttgtact acaagggaca gattttatcg cttggcaaat
15361 gagtgtgctc aggtgctaag cgaatatgtt ctatgtggtg gtggttacta cgtcaaacct
15421 ggaggtacca gtagcggaga tgccaccact gcatatgcca atagtgtctt taacattttg
15481 caggcgacaa ctgctaatgt cagtgcactt atgggtgcta atggcaacaa gattgttgac
15541 aaagaagtta aagacatgca gtttgatttg tatgtcaatg tttacaggag cactagccca
15601 gaccccaaat ttgttgataa atactatgct tttcttaata agcacttttc tatgatgata
15661 ctgtctgatg acggtgtcgt ttgctataat agtgattatg cagctaaggg ttacattgct
15721 ggaatacaga attttaagga aacgctgtat tatcagaaca atgtctttat gtctgaagct
15781 aaatgctggg tggaaaccga tctgaagaaa gggccacatg aattctgttc acagcatacg
15841 ctttatatta aggatggcga cgatggttac ttccttcctt atccagaccc ttcaagaatt
15901 ttgtctgccg gttgctttgt agatgatatc gttaagactg acggtacact catggtagag
15961 cggtttgtgt ctttggctat agatgcttac cctctcacaa agcatgaaga tatagaatac
16021 cagaatgtat tctgggtcta cttacagtat atagaaaaac tgtataaaga ccttacagga
16081 cacatgcttg acagttattc tgtcatgcta tgtggtgata attctgctaa gttttgggaa
16141 gaggcattct acagagatct ctatagttcg cctaccactt tgcaggctgt cggttcatgc
16201 gttgtatgcc attcacagac ttccctacgc tgtgggacat gcatccgtag accatttctc
16261 tgctgtaaat gctgctatga tcatgttata gcaactccac ataagatggt tttgtctgtt
16321 tctccttacg tttgtaatgc ccctggttgt ggcgtttcag acgttactaa gctatattta
16381 ggtggtatga gctacttttg tgtagatcat agacctgtgt gtagttttcc actttgcgct
16441 aatggtcttg tattcggctt atacaagaat atgtgcacag gtagtccttc tatagttgaa
16501 tttaataggt tggctacctg tgactggact gaaagtggtg attacaccct tgccaatact
16561 acaacagaac cactcaaact ttttgctgct gagactttac gtgccactga agaggcgtct
16621 aagcagtctt atgctattgc caccatcaaa gaaattgttg gtgagcgcca actattactt
16681 gtgtgggagg ctggcaagtc caaaccacca ctcaatcgta attatgtttt tactggttat
16741 catataacca aaaatagtaa agtgcagctc ggtgagtaca tcttcgagcg cattgattat
16801 agtgatgctg tatcctacaa gtctagtaca acgtataaac tgactgtagg tgacatcttc
16861 gtacttacct ctcactctgt ggctaccttg acggcgccca caattgtgaa tcaagagagg
16921 tatgttaaaa ttactgggtt gtacccaacc attacggtac ctgaagagtt cgcaagtcat
16981 gttgccaact tccaaaaatc aggttatagt aaatatgtca ctgttcaggg accacctggc
17041 actggcaaaa gtcactttgc tatagggtta gcgatttact accctacagc acgtgttgtt
17101 tatacagcat gttcacacgc agctgttgat gctttgtgtg aaaaagcttt taaatatttg
17161 aacattgcta aatgttcccg tattattcct gcaaaggcac gtgttgagtg ctatgacagg
17221 tttaaagtta atgagacaaa ttctcaatat ttgtttagta ctattaatgc tctaccagaa
17281 acttctgccg atattctggt ggttgatgag gttagtatgt gcactaatta tgatctttca
17341 attattaatg cacgtattaa agctaagcac attgtctatg taggagatcc agcacagttg
17401 ccagctccta ggactttgtt gactagaggc acattggaac cagaaaattt caatagtgtc
17461 actagattga tgtgtaactt aggtcctgac atatttttaa gtatgtgcta caggtgtcct
17521 aaggaaatag taagcactgt gagcgctctt gtctacaata ataaattgtt agccaagaag
17581 gagctttcag gccagtgctt taaaatactc tataagggca atgtgacgca tgatgctagc
17641 tctgccatta atagaccaca actcacattt gtgaagaatt ttattactgc caatccggca
17701 tggagtaagg cagtctttat ttcgccttat aattcacaga atgctgtggc tcgttcaatg
17761 ctgggtctta ctactcagac tgttgattcc tcacagggtt cagaatacca gtacgttatc
17821 ttctgtcaaa cagcagatac ggcacatgct aacaacatta acagatttaa tgttgcaatc
17881 actcgtgccc aaaaaggtat tctttgtgtt atgacatctc aggcactctt tgagtcctta
17941 gagtttactg aattgtcttt tactaattac aagctccagt ctcagattgt aactggcctt
18001 tttaaagatt gctctagaga aacttctggc ctctcacctg cttatgcacc aacatacgtt
18061 agtgttgatg acaagtataa gacgagtgat gagctttgcg tgaatcttaa tttacccgca
18121 aatgtcccat actctcgtgt tatttccagg atgggcttta aactcgatgc aacagttcct
18181 ggatatccta agcttttcat tactcgtgaa gaggctgtaa ggcaagttcg aagctggata
18241 ggcttcgatg ttgagggtgc tcatgcttcc cgtaatgcat gtggcaccaa tgtgcctcta
18301 caattaggat tttcaactgg tgtgaacttt gttgttcagc cagttggtgt tgtagacact
18361 gagtggggta acatgttaac gggcattgct gcccgtcctc caccaggtga acagtttaag
18421 cacctcgtgc ctcttatgca taagggggct gcgtggccta ttgttagacg acgtatagtg
18481 caaatgttgt cagacacttt agacaaattg tctgattact gtacgtttgt ttgttgggct
18541 catggctttg aattaacgtc tgcatcatac ttttgcaaga taggtaagga acagaagtgt
18601 tgcatgtgca atagacgcgc tgcagcgtac tcttcacctc tgcaatctta tgcctgctgg
18661 actcattcct gcggttatga ttatgtctac aaccctttct ttgtcgatgt tcaacagtgg
18721 ggttatgtag gcaatcttgc tactaatcac gatcgttatt gctctgtcca tcaaggagct
18781 catgtggctt ctaatgatgc aataatgact cgttgtttag ctattcattc ttgttttata
18841 gaacgtgtgg attgggatat agagtatcct tatatctcac atgaaaagaa attgaattcc
18901 tgttgtagaa tcgttgagcg caacgtcgta cgtgctgctc ttcttgccgg ttcatttgac
18961 aaagtctatg atattggcaa tcctaaagga attcctattg ttgatgaccc tgtggttgat
19021 tggcattatt ttgatgcaca gcccttgacc agaaaggtac aacagctttt ctatacagag
19081 gacatggcct caagatttgc tgatgggctc tgcttatttt ggaactgtaa tgtaccaaaa
19141 tatcctaata atgcaattgt atgcaggttt gacacacgtg tgcattctga gttcaatttg
19201 ccaggttgtg atggcggtag tttgtatgtt aacaagcacg cttttcatac accagcatat
19261 gatgtgagtg cattccgtga tctgaaacct ttaccattct tttattattc tactacacca
19321 tgtgaagtgc atggtaatgg tagtatgata gaggatattg attatgtacc cctaaaatct
19381 gcagtctgta ttacagcttg taatttaggg ggcgctgttt gtaggaagca tgctacagag
19441 tacagagagt atatggaagc atataatctt gtctctgcat caggtttccg cctttggtgt
19501 tataagacct ttgatattta taatctctgg tctactttta caaaagttca aggtttggaa
19561 aacattgctt ttaattttgt taaacaaggc cattttattg gtgttgaggg tgaactacct
19621 gtagctgtag tcaatgataa gatcttcacc aagagtggcg ttaatgacat ttgtatgttt
19681 gagaataaaa ccactttgcc tactaatata gcttttgaac tctatgctaa gcgtgctgta
19741 cgctcgcatc ccgatttcaa attgctacac aatttacaag cagacatttg ctacaagttc
19801 gtcctttggg attatgaacg tagcaatatt tatggtactg ctactattgg tgtatgtaag
19861 tacactgata ttgatgttaa ttcagctttg aatatatgtt ttgacatacg cgataatggt
19921 tcattggaga agttcatgtc tactcccaat gccatcttta tttctgatag aaaaattaag
19981 aaataccctt gtatggtagg tcctgattat gcttacttca atggtgctat catccgtgat
20041 agtgatgttg ttaaacaacc agtgaagttc tacttgtata agaaagtcaa taatgagttt
20101 attgatccta ctgagtgtat ttacactcag agtcgctctt gtagtgactt cctacccctg
20161 tctgacatgg agaaagactt tctatctttt gatagtgatg ttttcattaa gaagtatggc
20221 ttggaaaact atgcttttga gcacgtagtc tatggagact tctctcatac tacgttaggc
20281 ggtcttcact tgcttattgg tttatacaag aagcaacagg aaggtcatat tattatggaa
20341 gaaatgctaa aaggtagctc aactattcat aactatttta ttactgagac taacacagcg
20401 gcttttaagg cggtgtgttc tgttatagat ttaaagcttg acgactttgt tatgatttta
20461 aagagtcaag accttggcgt agtatccaag gttgtcaagg ttcctattga cttaacaatg
20521 attgagttta tgttatggtg taaggatgga caggttcaaa ccttctaccc tcgactccag
20581 gcttctgcag attggaaacc tggtcatgca atgccatccc tctttaaagt tcaaaatgta
20641 aaccttgaac gttgtgagct tgctaattac aagcaatcta ttcctatgcc tcgcggtgtg
20701 cacatgaaca tcgctaaata tatgcaattg tgccagtatt taaatacttg cacattagcc
20761 gtgcctgcca atatgcgtgt tatacatttt ggcgctggtt ctgataaagg tatcgctcct
20821 ggtacatcag ttttacgaca gtggcttcct acagatgcca ttattataga taatgattta
20881 aatgagttcg tgtcagatgc tgacataact ttatttggag attgtgtaac tgtacgtgtc
20941 ggccaacaag tggatcttgt tatttccgac atgtatgatc ctactactaa gaatgtaaca
21001 ggtagtaatg agtcaaaggc tttattcttt acttacctgt gtaacctcat taataataat
21061 cttgctcttg gtgggtctgt tgctattaaa ataacagaac actcttggag cgttgaactt
21121 tatgaactta tgggaaaatt tgcttggtgg actgttttct gcaccaatgc aaatgcatcc
21181 tcatctgaag gattcctctt aggtattaat tacttgggta ctattaaaga aaatatagat
21241 ggtggtgcta tgcacgccaa ctatatattt tggagaaatt ccactcctat gaatctgagt
21301 acttactcac tttttgattt atccaagttt caattaaaat taaaaggaac accagttctt
21361 caattaaagg agagtcaaat taacgaactc gtaatatctc tcctgtcgca gggtaagtta
21421 cttatccgtg acaatgatac actcagtgtt tctactgatg ttcttgttaa cacctacaga
21481 aagttacgtt gatgtagggc cagattctgt taagtctgct tgtattgagg ttgatataca
21541 acagactttc tttgataaaa cttggcctag gccaattgat gtttctaagg ctgacggtat
21601 tatataccct caaggccgta catattctaa cataactatc acttatcaag gtctttttcc
21661 ctatcaggga gaccatggtg atatgtatgt ttactctgca ggacatgcta caggcacaac
21721 tccacaaaag ttgtttgtag ctaactattc tcaggacgtc aaacagtttg ctaatgggtt
21781 tgtcgtccgt ataggagcag ctgccaattc cactggcact gttattatta gcccatctac
21841 cagcgctact atacgaaaaa tttaccctgc ttttatgctg ggttcttcag ttggtaattt
21901 ctcagatggt aaaatgggcc gcttcttcaa tcatactcta gttcttttgc ccgatggatg
21961 tggcacttta cttagagctt tttattgtat tctagagcct cgctctggaa atcattgtcc
22021 tgctggcaat tcctatactt cttttgccac ttatcacact cctgcaacag attgttctga
22081 tggcaattac aatcgtaatg ccagtctgaa ctcttttaag gagtatttta atttacgtaa
22141 ctgcaccttt atgtacactt ataacattac cgaagatgag attttagagt ggtttggcat
22201 tacacaaact gctcaaggtg ttcacctctt ctcatctcgg tatgttgatt tgtacggcgg
22261 caatatgttt caatttgcca ccttgcctgt ttatgatact attaagtatt attctatcat
22321 tcctcacagt attcgttcta tccaaagtga tagaaaagct tgggctgcct tctacgtata
22381 taaacttcaa ccgttaactt tcctgttgga tttttctgtt gatggttata tacgcagagc
22441 tatagactgt ggttttaatg atttgtcaca actccactgc tcatatgaat ccttcgatgt
22501 tgaatctgga gtttattcag tttcgtcttt cgaagcaaaa ccttctggct cagttgtgga
22561 acaggctgaa ggtgttgaat gtgatttttc acctcttctg tctggcacac ctcctcaggt
22621 ttataatttc aagcgtttgg tttttaccaa ttgcaattat aatcttacca aattgctttc
22681 acttttttct gtgaatgatt ttacttgtag tcaaatatct ccagcagcaa ttgctagcaa
22741 ctgttattct tcactgattt tggattattt ttcataccca cttagtatga aatccgatct
22801 cagtgttagt tctgctggtc caatatccca gtttaattat aaacagtcct tttctaatcc
22861 cacatgtttg attttagcga ctgttcctca taaccttact actattacta agcctcttaa
22921 gtacagctat attaacaagt gctctcgtct tctttctgat gatcgtactg aagtacctca
22981 gttagtgaac gctaatcaat actcaccctg tgtatccatt gtcccatcca ctgtgtggga
23041 agacggtgat tattatagga aacaactatc tccacttgaa ggtggtggct ggcttgttgc
23101 tagtggctca actgttgcca tgactgagca attacagatg ggctttggta ttacagttca
23161 atatggtaca gacaccaata gtgtttgccc caagcttgaa tttgctaatg acacaaaaat
23221 tgcctctcaa ttaggcaatt gcgtggaata ttccctctat ggtgtttcgg gccgtggtgt
23281 ttttcagaat tgcacagctg taggtgttcg acagcagcgc tttgtttatg atgcgtacca
23341 gaatttagtt ggctattatt ctgatgatgg caactactac tgtttgcgtg cttgtgttag
23401 tgttcctgtt tctgtcatct atgataaaga aactaaaacc cacgctactc tatttggtag
23461 tgttgcatgt gaacacattt cctctaccat gtctcaatac tcccgttcta cgcgatcaat
23521 gcttaaacgg cgagattcta catatggtcc ccttcagaca cctgttggtt gtgtcctagg
23581 acttgttaat tcctctttgt tcgtagagga ctgcaagttg cctcttggtc aatctctctg
23641 tgctcttcct gacacaccta gtactctcac acctcgcagt gtgcgctctg ttccaggtga
23701 aatgcgcttg gcatccattg cttttaatca tcctattcag gttgatcaac ttaatagtag
23761 ttattttaaa ttaagtatac ctactaattt ttcctttggt gtgactcagg agtacattca
23821 gacaaccatt cagaaagtta ctgttgattg taaacagtac gtttgcaatg gtttccagaa
23881 gtgtgagcaa ttactgcgcg agtatggcca rttttgttcc aaaataaacc aggctctcca
23941 tggtgccaat ttacgccagg atgattctgt acgtaatttg tttgcgagcg tgaaaagctc
24001 tcaatcatct cctatcatac caggttttgg aggtgacttt aatttgacac ttctagaacc
24061 tgtttctata tctactggca gtcgtagtgc acgtagtgct attgaggatt tgctatttga
24121 caaagtcact atagctgatc ctggttatat gcaaggttac gatgattgca tgcagcaagg
24181 tccagcatca gctcgtgatc ttatttgtgc tcaatatgtg gctggttaca aagtattacc
24241 tcctcttatg gatgttaata tggaagccgc gtatacctca tctttgcttg gcagcatagc
24301 aggtgttggc tggactgctg gcttatcctc ctttgctgct attccatttg cacagagtat
24361 cttttatagg ttaaacggtg ttggcattac tcaacaggtt ctttcagaga accaaaagct
24421 tattgccaat aagtttaatc aggctctggg agctatgcaa acaggcttca ctacaactaa
24481 tgaagctttt cggaaggttc aggatgctgt gaacaacaat gcacaggctc tatccaaatt
24541 agctagcgag ctatctaata cttttggtgc tatttccgcc tctattggag acatcataca
24601 acgtcttgat gttctcgaac aggacgccca aatagacaga cttattaatg gccgtttgac
24661 aacactaaat gcttttgttg cacagcagct tgttcgttcc gaatcagctg ctctttccgc
24721 tcaattggct aaagataaag tcaatgagtg tgtcaaggca caatccaagc gttctggatt
24781 ttgcggtcaa ggcacacata tagtgtcctt tgttgtaaat gcccctaatg gcctttactt
24841 catgcatgtt ggttattacc ctagcaacca cattgaggtt gtttctgctt atggtctttg
24901 cgatgcagct aaccctacta attgtatagc ccctgttaat ggctacttta ttaaaactaa
24961 taacactagg attgttgatg agtggtcata tactggctcg tccttctatg cacctgagcc
25021 catcacctct cttaatacta agtatgttgc accacaggtg acataccaaa acatttctac
25081 taacctccct cctcctcttc tcggcaattc caccgggatt gacttccaag atgagttgga
25141 tgagtttttc aaaaatgtta gcaccagtat acctaatttt ggttctctaa cacagattaa
25201 tactacatta ctcgatctta cctacgagat gttgtctctt caacaagttg ttaaagccct
25261 taatgagtct tacatagacc ttaaagagct tggcaattat acttattaca acaaatggcc
25321 gtggtacatt tggcttggtt tcattgctgg gcttgttgcc ttagctctat gcgccttctt
25381 catactgtgc tgcactggtt gtggcacaaa ctgtatggga aaacttaagt gtaatcgttg
25441 ttgtgataga tacgaggaat acgacctcga gccgcataag gttcatgttc actaattaac
25501 gaactatcaa tgagagttca aagaccaccc actctcttgt tagtgttctc actctctctt
25561 ttggtcactg cattttcaaa acctctctat gtacctgagc attgtcagaa ttattctggt
25621 tgcatgctta gggcttgtat taaaactgcc caagctgata cagctggtct ttatacaaat
25681 tttcgaattg acgtcccatc tgcagaatca actggtactc aatcagtttc tgtcgatcgt
25741 gagtcaactt caactcatga tggtcctacc gaacatgtta ctagtgtgaa tctttttgac
25801 gttggttact cagttaatta acgaactcta tggattacgt gtctctgctt aatcaaattt
25861 ggcagaagta ccttaattca ccgtatacta cttgtttgta tatccctaaa cccacagcta
25921 agtatacacc tttagttggc acttcattgc accctgtgct gtggaactgt cagctatcct
25981 ttgctggtta tactgaatct gctgttaatt ctacaaaagc tttggccaaa caggacgcag
26041 ctcagcgaat cgcttggttg ctacataagg atggaggaat ccctgatgga tgttccctct
26101 acctccggca ctcaagttta ttcgcgcaaa gcgaggaaga ggagtcattc tccaactaag
26161 aaactgcgct acgttaagcg tagattttct cttctgcgcc ctgaagacct tagtgttatt
26221 gtccaaccaa cacactatgt cagggttaca ttttcagacc ccaacatgtg gtatctacgt
26281 tcgggtcatc atttacactc agttcacaat tggcttaaac cttatggcgg ccaacctgtt
26341 tctgagtacc atattactct agctttgcta aatctcactg atgaagattt agctagagat
26401 ttttcaccca ttgcgctctt tttgcgcaat gtcagatttg agctacatga gttcgccttg
26461 ctgcgcaaaa ctcttgttct taatgcatca gagatctact gtgctaacat acatagattt
26521 aagcctgtgt atagagttaa cacggcaatc cctactatta aggattggct tctcgttcag
26581 ggattttccc tttaccatag tggcctccct ttacatatgt caatctctaa attgcatgca
26641 ctggatgatg ttactcgcaa ttacatcatt acaatgccat gctttagaac ttatcctcaa
26701 caaatgtttg ttactccttt ggccgtagat gttgtctcca tacggtcttc caatcagggt
26761 aataaacaaa ttgttcattc ttaccccatt ttacatcatc caggatttta acgaactatg
26821 gctttctcgg cgtctttatt taaacccgtc cagctagtcc cagtttctcc tgcatttcat
26881 cgcattgagt ctactgactc tattgttttc acatacattc ctgctagcgg ctatgtagct
26941 gctttagctg tcaatgtgtg tctcattccc ctattattac tgctacgtca agatacttgt
27001 cgtcgcagca ttatcagaac tatggttctc tatttccttg ttctgtataa ctttttatta
27061 gccattgtac tagtcaatgg tgtacattat ccaactggaa gttgcctgat agccttctta
27121 gttatcctca taatactttg gtttgtagat agaattcgtt tctgtctcat gctgaattcc
27181 tacattccac tgtttgacat gcgttctcac tttattcgtg ttagtacagt ttcttctcat
27241 ggtatggtcc ctgtcataca caccaaacca ttatttatta gaaacttcga tcagcgttgc
27301 agctgttctc gttgttttta tttgcactct tccacttata tagagtgcac ttatattagc
27361 cgttttagta agattagcct agtttctgta actgacttct ccttaaacgg caatgtttcc
27421 actgttttcg tgcctgcaac gcgcgattca gttcctcttc acataatcgc cccgagctcg
27481 cttatcgttt aagcagctct gcgctactat gggtcccgtg tagaggctaa tccattagtc
27541 tctctttgga catatggaaa acgaactatg ttaccctttg tccaagaacg aatagggttg
27601 ttcatagtaa actttttcat ttttaccgta gtatgtgcta taacactctt ggtgtgtatg
27661 gctttcctta cggctactag attatgtgtg caatgtatga caggcttcaa taccctgtta
27721 gttcagcccg cattatactt gtataatact ggacgttcag tctatgtaaa attccaggat
27781 agtaaacccc ctctaccacc tgacgagtgg gtttaacgaa ctccttcata atgtctaata
27841 tgacgcaact cactgaggcg cagattattg ccattattaa agactggaac tttgcatggt
27901 ccctgatctt tctcttaatt actatcgtac tacagtatgg atacccatcc cgtagtatga
27961 ctgtctatgt ctttaaaatg tttgttttat ggctcctatg gccatcttcc atggcgctat
28021 caatatttag cgccatttat ccaattgatc tagcttccca gataatctct ggcattgtag
28081 cagctgtttc agctatgatg tggatttcct actttgtgca gagtatccgg ctgtttatga
28141 gaactggatc atggtggtca ttcaatcctg agactaattg ccttttgaac gttccatttg
28201 gtggtacaac tgtcgtacgt ccactcgtag aggactctac cagtgtaact gctgttgtaa
28261 ccaatggcca cctcaaaatg gctggcatgc atttcggtgc ttgtgactac gacagacttc
28321 ctaatgaagt caccgtggcc aaacccaatg tgctgattgc tttaaaaatg gtgaagcggc
28381 aaagctacgg aactaattcc ggcgttgcca tttaccatag atataaggca ggtaattaca
28441 ggagtccgcc tattacggcg gatattgaac ttgcattgct tcgagcttag gctctttagt
28501 aagagtatct taattgattt taacgaatct caatttcatt gttatggcat cccctgctgc
28561 acctcgtgct gtttcctttg ccgataacaa tgatataaca aatacaaacc tgtctcgagg
28621 tagaggacgt aatccaaaac cacgagctgc accaaataac actgtctctt ggtacactgg
28681 gcttacccaa cacgggaaag tccctcttac ctttccacct gggcagggtg tacctcttaa
28741 tgccaattcc acccctgcgc aaaatgctgg gtattggcgg agacaggaca gaaaaattaa
28801 taccgggaat ggaattaagc aactggctcc caggtggtac ttctactaca ctggaactgg
28861 acccgaagca gcactcccat tccgggctgt taaggatggc atcgtttggg tccatgaaga
28921 tggcgccact gatgctcctt caacttttgg gacgcggaac cctaacaatg attcagctat
28981 tgttacacaa ttcgcgcccg gtactaagct tcctaaaaac ttccacattg aggggactgg
29041 aggcaatagt caatcatctt caagagcctc tagcgtaagc agaaactctt ccagatctag
29101 ttcacaaggt tcaagatcag gaaactctac ccgcggcact tctccaggtc catctggaat
29161 cggagcagta ggaggtgatc tactttacct tgatcttctg aacagactac aagcccttga
29221 gtctggcaaa gtaaagcaat cgcagccaaa agtaatcact aagaaggatg ctgctgctgc
29281 taaaaataag atgcgccaca agcgcacttc caccaaaagt ttcaacatgg tgcaagcttt
29341 tggtcttcgc ggaccaggag acctccaggg aaactttggt gatcttcaat tgaataaact
29401 cggcactgag gacccacgtt ggccccaaat tgctgagctt gctcctacag ccagtgcttt
29461 tatgggtatg tcgcaattta aacttaccca tcagaacaat gatgatcatg gcaaccctgt
29521 gtacttcctt cggtacagtg gagccattaa acttgaccca aagaatccca actacaataa
29581 gtggttggag cttcttgagc aaaatattga tgcctacaaa accttcccta agaaggaaaa
29641 gaaacaaaag gcaccaaaag aagaatcaac agaccaaatg tctgaacctc caaaggagca
29701 gcgtgtgcaa ggtagcatca ctcagcgcat tcgcacccgt ccaagtgttc agcctggtcc
29761 aatgattgat gttaacactg attagtgtca ctcaaagtaa caagatcgcg gcaatcgttt
29821 gtgtttggta accccatctc accatcgctt gtccactctt gcacagaatg gaatcatgtt
29881 gtaattacag tgcaataagg taattataac ccatttaatt gatagctatg ctttattaaa
29941 gtgtgtagct gtagagagaa tgttaaagac tgtcacctct gcgtgattgc aagtgaacag
30001 tgccccccgg gaagagctct acagtgtgaa atgtaaataa aaatagctat tattcaatta
30061 gattaggcta attagatgat ttgcaaaaaa aaaaaa

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Thu Jun 04, 2015 7:43 pm 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
LOCUS KR011264 30096 bp RNA linear VRL 27-MAY-2015
DEFINITION Middle East respiratory syndrome coronavirus strain
Hu/Riyadh-KSA-2343/2015, complete genome.
ACCESSION KR011264
VERSION KR011264.1 GI:823104964
KEYWORDS .
SOURCE Middle East respiratory syndrome coronavirus (MERS-CoV)
ORGANISM Middle East respiratory syndrome coronavirus
Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA
stage; Nidovirales; Coronaviridae; Coronavirinae; Betacoronavirus;
unclassified Betacoronavirus.
REFERENCE 1 (bases 1 to 30096)
AUTHORS Lu,X., Saeed,A.A.B. and Erdman,D.D.
TITLE Direct Submission
JOURNAL Submitted (24-MAR-2015) Division of Viral Diseases, Centers for
Disease Control and Prevention, 1600 Clifton Rd., Atlanta, GA
30329, USA
COMMENT ##Assembly-Data-START##
Assembly Method :: Sequencher v. 5.2.4
Sequencing Technology :: Sanger dideoxy sequencing
##Assembly-Data-END##
FEATURES Location/Qualifiers
source 1..30096
/organism="Middle East respiratory syndrome coronavirus"
/mol_type="genomic RNA"
/strain="Hu/Riyadh-KSA-2343/2015"
/isolation_source="respiratory secretions"
/host="Homo sapiens"
/db_xref="taxon:1335626"
/country="Saudi Arabia"
/collection_date="21-Jan-2015"
CDS join(257..13411,13411..21492)
/ribosomal_slippage
/codon_start=1
/product="ORF1ab protein"
/protein_id="AKI29263.1"
/db_xref="GI:823104965"
/translation="MSFVAGVTAQGARGTYRAALNSEKHQDHVSLTVPLCGSGNLVEK
LSPWFIDGENAYEVVKAMLLKKEPLLYVPIRLAGHTRHLPGPRVYLVERLIACENPFM
VNQLAYSSSANGSLVGTTLQGKPIGMFFPYDIELVTGKQNILLRKYGRGGYHYTPFHY
ERDNTSCPEWMDDFEADPKGKYAQNLLKKLIGGDVTPVDQYMCGVDGKPISAYAFLMA
KDGITKLADVEADVAARADDEGFITLKNNLYRLVWHVERKDVPYPKQSIFTINSVVQK
DGVENTPPHYFTLGCKILTLTPRNKWSGVSDLSLKQKLLYTFYGKESLENPTYIYHSA
FIECGSCGNDSWLTGNAIQGFACGCGASYTANDVEVQSSGMIKPNALLCATCPFAKGD
SCSSNCKHSVAQLVSYLSERCNVIADPKSFTLIFGGVAYAYFGCEEGTMYFVPRAKSV
VSRIGDSVFTGCTGSWNKVTQIANMFLEQTQHSLNFVGEFVVNDVVLAILSGTTTNVD
KIRQLLKGVTLDKLRDYLADYDIAVTAGPFMDNAINVGGTGLQYAAITAPYVVLTGLG
ESFKKVATIPYKVCNSVKDTLTYYAHSVLYRVFPYDMDSGVSSFSELLFDCVDLSVAS
TYFLVRLLQDKAGDFMSTIITSCQTAVSKLLDTCFEATEATFNFLLDLAGLFRIFLRN
AYVYTSQGFVVVNGKVSTLVKQVLDLLNKGMQLLHTKVSWAGFNISAVIYSGRESLIF
PSGTYYCVTTKAKSVQQDLDVILPGEFSKKQLGLLQPTDNSTTVSVTVSSNMVETVVG
QLEQTNMHSPDVIVGDYVIISEKLFVRSKEEDGFAFYPACTNGHAVPTLFRLKGGAPV
KKVAFGGDQVHEVAAVRSVTVEYNIHAVLDTLLASSSLRTFVVDKSLSIEEFADVVKE
QVSDLLVKLLRGMPIPDFDLDDFIDAPCYCFNAEGDASWSSTMILSLHPVECDEECSE
VEASDLEEGESECISETSTEQVDVSHEISDDEWAAAVDEAFPLDEAEDVTESVQEEAQ
PVEVPVEDIAQVVIADTLQETPVVSDTVEVPPQVVKLPSEPQTIQPEVKEVAPVYEAD
TEQTQSVTVKPKRLRKKRNVDPLSNFEHKVITECVTIVLGDAIQVAKCYGESVLVNAA
NTHLKHGGGIAGAINAASKGAVQKESDEYILAKGPLQVGDSVLLQGHSLAKNILHVVG
PDARAKQDVSLLSKCYKAMNAYPLVVTPLVSAGIFGVKPAVSFDYLIREAKTRVLVVV
NSQDVYKSLTIVDIPQSLTFSYDGLRGAIRKAKDYGFTVFVCTDNSANTKVLRNKGVD
YTKKFFTVDGVQYYCYTSKDTLDDILQQANKSVGIISMPLGYVSHGLDLIQAGSVVRR
VNVPYVCLLANKEQEAILMSEDVKLNPSEDFIKHVRTNGGYNSWHLVEGELLVQDLRL
NKLLHWSDQTICYKDSVFYVVKNSTAFPFETLSACRAYLDSRTTQQLTIEVLVTVDGV
NFRTVVLNNKNTYRSQLGCVFFNGADISDTIPDEKQNGHSLYLADNLTADETKALKEL
YGPVDPTFLHRFYSLKAAVHKWKMVVCDKVRSLKLSDNNCYLNAVIMTLDLLKDIKFV
IPALQHAFMKHKGGDSTDFIALIMAYGNCTFGAPDDASRLLHTVLAKAELCCSARMVW
REWCNVCGIKDVVLQGLKACCYVGVQTVEDLRARMTYVCQCGGERHRQIVEHTTPWLL
LSGTPNEKLVTTSTAPDFVAFNVFQGIETAVGHYVHARLKGGLILKFDSGTVSKTSDW
KCKVTDVLFSGQKYSSDCNVVRYSLDGNFRTEVDPDLSAFYVKDGKYFTSEPPVTYSP
ATILAGSVYTNSCLVSSDGQPGGDAISLSFNNLLGFDSSKPVAKKYTYSFLPKEDGDV
LLAEFDTYDPIYKNGAMYKGKPILWVNKASYDTNLNKFNRASLRQIFDVAPIELENKF
TPLSVESTPVEPPTVDVVALQQEMTIVKCKGLNKPFVKDNVSFVADDSGTPVVEYLSK
EDLHTLYVDPKYQVIVLKDNVLSSMLRLHTVESGDINVVAASGSLTRKVKLLFRASFY
FKEFATRTFTATTAVGSCIKSVVRHLGVTKGILTGCFSFVKMLFMLPLAYFSDSKLGT
TEVKVSALKTAGVVTGNVVKQCCTAAVDLSMDKLRRVDWKSTLRLLLMLCTTMVLLSS
VYHLYVFNQVLSSDVMFEDAQGLKKFYKEVRAYLGISSACDGLASAYRANSFDVPTFC
ANRSAMCNWCLISQDSITHYPALKMVQTHLSHYVLNIDWLWFAFETGLAYMLYTSAFN
WLLLAGTLHYFFAQTSIFVDWRSYNYAVSSAFWLFTHIPMAGLVRMYNLLACLWLLRK
FYQHVINGCKDTACLLCYKRNRLTRVEASTVVCGGKRTFYITANGGISFCRRHNWNCV
DCDTAGVGNTFICEEVANDFTTALRRPINATDRSHYYVDSVTVKETVVQFNYRRDGQP
FYERFPLCAFTNLDKLKFKEVCKTTTGIPEYNFIIYDSSDRGQESLARSACVYYSQVL
CKSILLVDSSLVTSVGDSSEIATKMFDSFVNSFVSLYNVTRDKLEKLISTARDGVRRG
DNFHSVLTTFIDAARGPAGVESDVETNEIVDSVQYAHKHDIQITNESYNNYVPSYVKP
DSVSTSDLGSLIDCNAASVNQIVLRNSNGACIWNAAAYMKLSDALKRQIRIACRKCNL
AFRLTTSKLRANDNILSVRFTANKIVGGAPTWFNALRDFTLKGYVLATIIVFLCAVLM
YLCLPTFSMVPVEFYEDRILDFKVLDNGIIRDVNPDDKCFANKHRSFTQWYHEHVGGV
YDNSITCPLTVAVIAGVAGARIPDVPTTLAWLNNQIIFFVSRVFANTGSVCYTPIDEI
PYKSFSDSGCILPSECTMFRDAEGRMTPYCHDPTVLPGAFAYSQMRPHVRYDLYDGNM
FIKFPEVVFESTLRITRTLSTQYCRFGSCEYAQEGVCITTNGSWAIFNDHHLNRPGVY
CGSDFIDIVRRLAVSLFQPITYFQLTTSLVLGIGLCAFLTLLFYYINKVKRAFADYTQ
CAVIAVVAAVLNSLCICFVASIPLCIVPYTALYYYATFYFTNEPAFIMHVSWYIMFGP
IVPIWMTCVYTVAMCFRHFFWVLAYFSKKHVEVFTDGKLNCSFQDAASNIFVINKDTY
AALRNSLTNDAYSRFLGLFNKYKYFSGAMETAAYREAAACHLAKALQTYSETGSDLLY
QPPNCSITSGVLQSGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCP
ADQLSDPNYDALLISMTNHSFSVQKHIGAPANLRVVGHAMQGTLLKLTVDVANPSTPA
YTFTTVKPGAAFSVLACYNGRPTGTFTVVMRPNYTIKGSFLCGSCGSVGYTKEGSVIN
FCYMHQMELANGTHTGSAFDGTMYGAFMDKQVHQVQLTDKYCSVNVVAWLYAAILNGC
AWFVKPNRTSVVSFNEWALANQFTEFVGTQSVDMLAVKTGVAIEQLLYAIQQLYTGFQ
GKQILGSTMLEDEFTPEDVNMQIMGVVMQSGVRKVTYGTAHWLFATLVSTYVIILQAT
KFTLWNYLFETIPTQLFPLLFVTMAFVMLLVKHKHTFLTLFLLPVAICLTYANIVYEP
TTPISSALIAVANWLAPTNAYMRTTHTDIGVYISMSLVLVIVVKRLYNPSLSNFALAL
CSGVMWLYTYSIGEASSPIAYLVFVTTLTSDYTITVFVTVNLAKVCTYAIFAYSPQLT
LVFPEVKMILLLYTCLGFMCTCYFGVFSLLNLKLRAPMGVYDFKVSTQEFRFMTANNL
TAPRNSWEAMALNFKLIGIGGTPCIKVAAMQSKLTDLKCTSVVLLSVLQQLHLEANSR
AWAFCVKCHNDILAATDPSEAFEKFVSLFATLMTFSGNVDLDALASDIFDTPSVLQAT
LSEFSHLATFAELEAAQKAYQEAMDSGDTSPQVLKALQKAVNIAKNAYEKDKAVARKL
ERMADQAMTSMYKQARAEDKKAKIVSAMQTMLFGMIKKLDNDVLNGIISNARNGCIPL
SVIPLCASNKLRVVIPDFTVWNQVVTYPSLNYAGALWDITVINNVDNEIVKSSDVVDS
NENLTWPLVLECTRASTSAVKLQNNEIKPSGLKTMVVSAGQEQTNCNTSSLAYYEPVQ
GRKMLMALLSDNAYLKWARVEGKDGFVSVELQPPCKFLIAGPKGPEIRYLYFVKNLNN
LHRGQVLGHIAATVRLQAGSNTEFASNSSVLSLVNFTVDPQKAYLDFVNAGGAPLTNC
VKMLTPKTGTGIAISVKPESTADQETYGGASVCLYCRAHIEHPDVSGVCKYKGKFVQI
PAQCVRDPVGFCLSNTPCNVCQYWIGYGCNCDSLRQATLPQSKDSNFLNRVRGSIVNA
RIEPCSSGLSTDVVFRAFDICNYKAKVAGIGKYYKTNTCRFVELDDQGHHLDSYFVVK
RHTMENYELEKHCYDLLRDCDAVAPHDFFIFDVDKVKTPHIVRQRLTEYTMMDLVYAL
RHFDQNSEVLKAILVKYGCCDVTYFENKLWFDFVENPSVIGVYHKLGERVRQAILNTV
KFCDHMVKAGLVGVLTLDNQDLNGKWYDFGDFVITQPGSGVAIVDSYYSYLMPVLSMT
DCLAAETHRDCDFNKPLIEWPLTEYDFTDYKVQLFEKYFKYWDQTYHANCVNCTDDRC
VLHCANFNVLFAMTMPKTCFGPIVRKIFVDGVPFVVSCGYHYKELGLVMNMDVSLHRH
RLSLKELMMYAADPAMHIASSNAFLDLRTSCFSVAALTTGLTFQTVRPGNFNQDFYDF
VVSKGFFKEGSSVTLKHFFFAQDGNAAITDYNYYSYNLPTMCDIKQMLFCMEVVNKYF
EIYDGGCLNASEVVVNNLDKSAGHPFNKFGKARVYYESMSYQEQDELFAMTKRNVIPT
MTQMNLKYAISAKNRARTVAGVSILSTMTNRQYHQKMLKSMAATRGATCVIGTTKFYG
GWDFMLKTLYKDVDNPHLMGWDYPKCDRAMPNMCRIFASLILARKHATCCTTRDRFYR
LANECAQVLSEYVLCGGGYYVKPGGTSSGDATTAYANSVFNILQATTANVSALMGANG
NKIVDKEVKDMQFDLYVNVYRSTSPDPKFVDKYYAFLNKHFSMMILSDDGVVCYNSDY
AAKGYIAGIQNFKETLYYQNNVFMSEAKCWVETDLKKGPHEFCSQHTLYIKDGDDGYF
LPYPDPSRILSAGCFVDDIVKTDGTLMVERFVSLAIDAYPLTKHEDIEYQNVFWVYLQ
YIEKLYKDLTGHMLDSYSVMLCGDNSAKFWEEAFYRDLYSSPTTLQAVGSCVVCHSQT
SLRCGTCIRRPFLCCKCCYDHVIATPHKMVLSVSPYVCNAPGCGVSDVTKLYLGGMSY
FCVDHRPVCSFPLCANGLVFGLYKNMCTGSPSIVEFNRLATCDWTESGDYTLANTTTE
PLKLFAAETLRATEEASKQSYAIATIKEIVGERQLLLVWEAGKSKPPLNRNYVFTGYH
ITKNSKVQLGEYIFERIDYSDAVSYKSSTTYKLTVGDIFVLTSHSVATLTAPTIVNQE
RYVKITGLYPTITVPEEFASHVANFQKSGYSKYVTVQGPPGTGKSHFAIGLAIYYPTA
RVVYTACSHAAVDALCEKAFKYLNIAKCSRIIPAKARVECYDRFKVNETNSQYLFSTI
NALPETSADILVVDEVSMCTNYDLSIINARIKAKHIVYVGDPAQLPAPRTLLTRGTLE
PENFNSVTRLMCNLGPDIFLSMCYRCPKEIVSTVSALVYNNKLLAKKELSGQCFKILY
KGNVTHDASSAINRPQLTFVKNFITANPAWSKAVFISPYNSQNAVARSMLGLTTQTVD
SSQGSEYQYVIFCQTADTAHANNINRFNVAITRAQKGILCVMTSQALFESLEFTELSF
TNYKLQSQIVTGLFKDCSRETSGLSPAYAPTYVSVDDKYKTSDELCVNLNLPANVPYS
RVISRMGFKLDATVPGYPKLFITREEAVRQVRSWIGFDVEGAHASRNACGTNVPLQLG
FSTGVNFVVQPVGVVDTEWGNMLTGIAARPPPGEQFKHLVPLMHKGAAWPIVRRRIVQ
MLSDTLDKLSDYCTFVCWAHGFELTSASYFCKIGKEQKCCMCNRRAAAYSSPLQSYAC
WTHSCGYDYVYNPFFVDVQQWGYVGNLATNHDRYCSVHQGAHVASNDAIMTRCLAIHS
CFIERVDWDIEYPYISHEKKLNSCCRIVERNVVRAALLAGSFDKVYDIGNPKGIPIVD
DPVVDWHYFDAQPLTRKVQQLFYTEDMASRFADGLCLFWNCNVPKYPNNAIVCRFDTR
VHSEFNLPGCDGGSLYVNKHAFHTPAYDVSAFRDLKPLPFFYYSTTPCEVHGNGSMIE
DIDYVPLKSAVCITACNLGGAVCRKHATEYREYMEAYNLVSASGFRLWCYKTFDIYNL
WSTFTKVQGLENIAFNFVKQGHFIGVEGELPVAVVNDKIFTKSGVNDICMFENKTTLP
TNIAFELYAKRAVRSHPDFKLLHNLQADICYKFVLWDYERSNIYGTATIGVCKYTDID
VNSALNICFDIRDNGSLEKFMSTPNAIFISDRKIKKYPCMVGPDYAYFNGAIIRDSDV
VKQPVKFYLYKKVNNEFIDPTECIYTQSRSCSDFLPLSDMEKDFLSFDSDVFIKKYGL
ENYAFEHVVYGDFSHTTLGGLHLLIGLYKKQQEGHIIMEEMLKGSSTIHNYFITETNT
AAFKAVCSVIDLKLDDFVMILKSQDLGVVSKVVKVPIDLTMIEFMLWCKDGQVQTFYP
RLQASADWKPGHAMPSLFKVQNVNLERCELANYKQSIPMPRGVHMNIAKYMQLCQYLN
TCTLAVPANMRVIHFGAGSDKGIAPGTSVLRQWLPTDAIIIDNDLNEFVSDADITLFG
DCVTVRVGQQVDLVISDMYDPTTKNVTGSNESKALFFTYLCNLINNNLALGGSVAIKI
TEHSWSVELYELMGKFAWWTVFCTNANASSSEGFLLGINYLGTIKENIDGGAMHANYI
FWRNSTPMNLSTYSLFDLSKFQLKLKGTPVLQLKESQINELVISLLSQGKLLIRDNDT
LSVSTDVLVNTYRKLR"
CDS 257..13432
/codon_start=1
/product="ORF1a protein"
/protein_id="AKI29264.1"
/db_xref="GI:823104966"
/translation="MSFVAGVTAQGARGTYRAALNSEKHQDHVSLTVPLCGSGNLVEK
LSPWFIDGENAYEVVKAMLLKKEPLLYVPIRLAGHTRHLPGPRVYLVERLIACENPFM
VNQLAYSSSANGSLVGTTLQGKPIGMFFPYDIELVTGKQNILLRKYGRGGYHYTPFHY
ERDNTSCPEWMDDFEADPKGKYAQNLLKKLIGGDVTPVDQYMCGVDGKPISAYAFLMA
KDGITKLADVEADVAARADDEGFITLKNNLYRLVWHVERKDVPYPKQSIFTINSVVQK
DGVENTPPHYFTLGCKILTLTPRNKWSGVSDLSLKQKLLYTFYGKESLENPTYIYHSA
FIECGSCGNDSWLTGNAIQGFACGCGASYTANDVEVQSSGMIKPNALLCATCPFAKGD
SCSSNCKHSVAQLVSYLSERCNVIADPKSFTLIFGGVAYAYFGCEEGTMYFVPRAKSV
VSRIGDSVFTGCTGSWNKVTQIANMFLEQTQHSLNFVGEFVVNDVVLAILSGTTTNVD
KIRQLLKGVTLDKLRDYLADYDIAVTAGPFMDNAINVGGTGLQYAAITAPYVVLTGLG
ESFKKVATIPYKVCNSVKDTLTYYAHSVLYRVFPYDMDSGVSSFSELLFDCVDLSVAS
TYFLVRLLQDKAGDFMSTIITSCQTAVSKLLDTCFEATEATFNFLLDLAGLFRIFLRN
AYVYTSQGFVVVNGKVSTLVKQVLDLLNKGMQLLHTKVSWAGFNISAVIYSGRESLIF
PSGTYYCVTTKAKSVQQDLDVILPGEFSKKQLGLLQPTDNSTTVSVTVSSNMVETVVG
QLEQTNMHSPDVIVGDYVIISEKLFVRSKEEDGFAFYPACTNGHAVPTLFRLKGGAPV
KKVAFGGDQVHEVAAVRSVTVEYNIHAVLDTLLASSSLRTFVVDKSLSIEEFADVVKE
QVSDLLVKLLRGMPIPDFDLDDFIDAPCYCFNAEGDASWSSTMILSLHPVECDEECSE
VEASDLEEGESECISETSTEQVDVSHEISDDEWAAAVDEAFPLDEAEDVTESVQEEAQ
PVEVPVEDIAQVVIADTLQETPVVSDTVEVPPQVVKLPSEPQTIQPEVKEVAPVYEAD
TEQTQSVTVKPKRLRKKRNVDPLSNFEHKVITECVTIVLGDAIQVAKCYGESVLVNAA
NTHLKHGGGIAGAINAASKGAVQKESDEYILAKGPLQVGDSVLLQGHSLAKNILHVVG
PDARAKQDVSLLSKCYKAMNAYPLVVTPLVSAGIFGVKPAVSFDYLIREAKTRVLVVV
NSQDVYKSLTIVDIPQSLTFSYDGLRGAIRKAKDYGFTVFVCTDNSANTKVLRNKGVD
YTKKFFTVDGVQYYCYTSKDTLDDILQQANKSVGIISMPLGYVSHGLDLIQAGSVVRR
VNVPYVCLLANKEQEAILMSEDVKLNPSEDFIKHVRTNGGYNSWHLVEGELLVQDLRL
NKLLHWSDQTICYKDSVFYVVKNSTAFPFETLSACRAYLDSRTTQQLTIEVLVTVDGV
NFRTVVLNNKNTYRSQLGCVFFNGADISDTIPDEKQNGHSLYLADNLTADETKALKEL
YGPVDPTFLHRFYSLKAAVHKWKMVVCDKVRSLKLSDNNCYLNAVIMTLDLLKDIKFV
IPALQHAFMKHKGGDSTDFIALIMAYGNCTFGAPDDASRLLHTVLAKAELCCSARMVW
REWCNVCGIKDVVLQGLKACCYVGVQTVEDLRARMTYVCQCGGERHRQIVEHTTPWLL
LSGTPNEKLVTTSTAPDFVAFNVFQGIETAVGHYVHARLKGGLILKFDSGTVSKTSDW
KCKVTDVLFSGQKYSSDCNVVRYSLDGNFRTEVDPDLSAFYVKDGKYFTSEPPVTYSP
ATILAGSVYTNSCLVSSDGQPGGDAISLSFNNLLGFDSSKPVAKKYTYSFLPKEDGDV
LLAEFDTYDPIYKNGAMYKGKPILWVNKASYDTNLNKFNRASLRQIFDVAPIELENKF
TPLSVESTPVEPPTVDVVALQQEMTIVKCKGLNKPFVKDNVSFVADDSGTPVVEYLSK
EDLHTLYVDPKYQVIVLKDNVLSSMLRLHTVESGDINVVAASGSLTRKVKLLFRASFY
FKEFATRTFTATTAVGSCIKSVVRHLGVTKGILTGCFSFVKMLFMLPLAYFSDSKLGT
TEVKVSALKTAGVVTGNVVKQCCTAAVDLSMDKLRRVDWKSTLRLLLMLCTTMVLLSS
VYHLYVFNQVLSSDVMFEDAQGLKKFYKEVRAYLGISSACDGLASAYRANSFDVPTFC
ANRSAMCNWCLISQDSITHYPALKMVQTHLSHYVLNIDWLWFAFETGLAYMLYTSAFN
WLLLAGTLHYFFAQTSIFVDWRSYNYAVSSAFWLFTHIPMAGLVRMYNLLACLWLLRK
FYQHVINGCKDTACLLCYKRNRLTRVEASTVVCGGKRTFYITANGGISFCRRHNWNCV
DCDTAGVGNTFICEEVANDFTTALRRPINATDRSHYYVDSVTVKETVVQFNYRRDGQP
FYERFPLCAFTNLDKLKFKEVCKTTTGIPEYNFIIYDSSDRGQESLARSACVYYSQVL
CKSILLVDSSLVTSVGDSSEIATKMFDSFVNSFVSLYNVTRDKLEKLISTARDGVRRG
DNFHSVLTTFIDAARGPAGVESDVETNEIVDSVQYAHKHDIQITNESYNNYVPSYVKP
DSVSTSDLGSLIDCNAASVNQIVLRNSNGACIWNAAAYMKLSDALKRQIRIACRKCNL
AFRLTTSKLRANDNILSVRFTANKIVGGAPTWFNALRDFTLKGYVLATIIVFLCAVLM
YLCLPTFSMVPVEFYEDRILDFKVLDNGIIRDVNPDDKCFANKHRSFTQWYHEHVGGV
YDNSITCPLTVAVIAGVAGARIPDVPTTLAWLNNQIIFFVSRVFANTGSVCYTPIDEI
PYKSFSDSGCILPSECTMFRDAEGRMTPYCHDPTVLPGAFAYSQMRPHVRYDLYDGNM
FIKFPEVVFESTLRITRTLSTQYCRFGSCEYAQEGVCITTNGSWAIFNDHHLNRPGVY
CGSDFIDIVRRLAVSLFQPITYFQLTTSLVLGIGLCAFLTLLFYYINKVKRAFADYTQ
CAVIAVVAAVLNSLCICFVASIPLCIVPYTALYYYATFYFTNEPAFIMHVSWYIMFGP
IVPIWMTCVYTVAMCFRHFFWVLAYFSKKHVEVFTDGKLNCSFQDAASNIFVINKDTY
AALRNSLTNDAYSRFLGLFNKYKYFSGAMETAAYREAAACHLAKALQTYSETGSDLLY
QPPNCSITSGVLQSGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCP
ADQLSDPNYDALLISMTNHSFSVQKHIGAPANLRVVGHAMQGTLLKLTVDVANPSTPA
YTFTTVKPGAAFSVLACYNGRPTGTFTVVMRPNYTIKGSFLCGSCGSVGYTKEGSVIN
FCYMHQMELANGTHTGSAFDGTMYGAFMDKQVHQVQLTDKYCSVNVVAWLYAAILNGC
AWFVKPNRTSVVSFNEWALANQFTEFVGTQSVDMLAVKTGVAIEQLLYAIQQLYTGFQ
GKQILGSTMLEDEFTPEDVNMQIMGVVMQSGVRKVTYGTAHWLFATLVSTYVIILQAT
KFTLWNYLFETIPTQLFPLLFVTMAFVMLLVKHKHTFLTLFLLPVAICLTYANIVYEP
TTPISSALIAVANWLAPTNAYMRTTHTDIGVYISMSLVLVIVVKRLYNPSLSNFALAL
CSGVMWLYTYSIGEASSPIAYLVFVTTLTSDYTITVFVTVNLAKVCTYAIFAYSPQLT
LVFPEVKMILLLYTCLGFMCTCYFGVFSLLNLKLRAPMGVYDFKVSTQEFRFMTANNL
TAPRNSWEAMALNFKLIGIGGTPCIKVAAMQSKLTDLKCTSVVLLSVLQQLHLEANSR
AWAFCVKCHNDILAATDPSEAFEKFVSLFATLMTFSGNVDLDALASDIFDTPSVLQAT
LSEFSHLATFAELEAAQKAYQEAMDSGDTSPQVLKALQKAVNIAKNAYEKDKAVARKL
ERMADQAMTSMYKQARAEDKKAKIVSAMQTMLFGMIKKLDNDVLNGIISNARNGCIPL
SVIPLCASNKLRVVIPDFTVWNQVVTYPSLNYAGALWDITVINNVDNEIVKSSDVVDS
NENLTWPLVLECTRASTSAVKLQNNEIKPSGLKTMVVSAGQEQTNCNTSSLAYYEPVQ
GRKMLMALLSDNAYLKWARVEGKDGFVSVELQPPCKFLIAGPKGPEIRYLYFVKNLNN
LHRGQVLGHIAATVRLQAGSNTEFASNSSVLSLVNFTVDPQKAYLDFVNAGGAPLTNC
VKMLTPKTGTGIAISVKPESTADQETYGGASVCLYCRAHIEHPDVSGVCKYKGKFVQI
PAQCVRDPVGFCLSNTPCNVCQYWIGYGCNCDSLRQATLPQSKDSNFLNESGVLL"
CDS 21434..25495
/codon_start=1
/product="S protein"
/protein_id="AKI29265.1"
/db_xref="GI:823104967"
/translation="MIHSVFLLMFLLTPTESYVDVGPDSVKSACIEVDIQQTFFDKTW
PRPIDVSKADGIIYPQGRTYSNITITYQGLFPYQGDHGDMYVYSAGHATGTTPQKLFV
ANYSQDVKQFANGFVVRIGAAANSTGTVIISPSTSATIRKIYPAFMLGSSVGNFSDGK
MGRFFNHTLVLLPDGCGTLLRAFYCILEPRSGNHCPAGNSYTSFATYHTPATDCSDGN
YNRNASLNSFKEYFNLRNCTFMYTYNITEDEILEWFGITQTAQGVHLFSSRYVDLYGG
NMFQFATLPVYDTIKYYSIIPHSIRSIQSDRKAWAAFYVYKLQPLTFLLDFSVDGYIR
RAIDCGFNDLSQLHCSYESFDVESGVYSVSSFEAKPSGSVVEQAEGVECDFSPLLSGT
PPQVYNFKRLVFTNCNYNLTKLLSLFSVNDFTCSQISPAAIASNCYSSLILDYFSYPL
SMKSDLSVSSAGPISQFNYKQSFSNPTCLILATVPHNLTTITKPLKYSYINKCSRLLS
DDRTEVPQLVNANQYSPCVSIVPSTVWEDGDYYRKQLSPLEGGGWLVASGSTVAMTEQ
LQMGFGITVQYGTDTNSVCPKLEFANDTKIASQLGNCVEYSLYGVSGRGVFQNCTAVG
VRQQRFVYDAYQNLVGYYSDDGNYYCLRACVSVPVSVIYDKETKTHATLFGSVACEHI
SSTMSQYSRSTRSMLKRRDSTYGPLQTPVGCVLGLVNSSLFVEDCKLPLGQSLCALPD
TPSTLTPRSVRSVPGEMRLASIAFNHPIQVDQLNSSYFKLSIPTNFSFGVTQEYIQTT
IQKVTVDCKQYVCNGFQKCEQLLREYGQFCSKINQALHGANLRQDDSVRNLFASVKSS
QSSPIIPGFGGDFNLTLLEPVSISTGSRSARSAIEDLLFDKVTIADPGYMQGYDDCMQ
QGPASARDLICAQYVAGYKVLPPLMDVNMEAAYTSSLLGSIAGVGWTAGLSSFAAIPF
AQSIFYRLNGVGITQQVLSENQKLIANKFNQALGAMQTGFTTTNEAFRKVQDAVNNNA
QALSKLASELSNTFGAISASIGDIIQRLDVLEQDAQIDRLINGRLTTLNAFVAQQLVR
SESAALSAQLAKDKVNECVKAQSKRSGFCGQGTHIVSFVVNAPNGLYFMHVGYYPSNH
IEVVSAYGLCDAANPTNCIAPVNGYFIKTNNTRIVDEWSYTGSSFYAPEPITSLNTKY
VAPQVTYQNISTNLPPPLLGNSTGIDFQDELDEFFKNVSTSIPNFGSLTQINTTLLDL
TYEMLSLQQVVKALNESYIDLKELGNYTYYNKWPWYIWLGFIAGLVALALCAFFILCC
TGCGTNCMGKLKCNRCCDRYEEYDLEPHKVHVH"
CDS 25510..25821
/codon_start=1
/product="NS3A protein"
/protein_id="AKI29266.1"
/db_xref="GI:823104968"
/translation="MRVQRPPTLLLVFSLSLLVTAFSKPLYVPEHCQNYSGCMLRACI
KTAQADTAGLYTNFRIDVPSAESTGTQSVSVDRESTSTHDGPTEHVTSVNLFDVGYSV
N"
CDS 25830..26159
/codon_start=1
/product="NS3B protein"
/protein_id="AKI29267.1"
/db_xref="GI:823104969"
/translation="MDYVSLLNQIWQKYLNSPYTTCLYIPKPTAKYTPLVGTSLHPVL
WNCQLSFAGYTESAVNSTKALAKQDAAQRIAWLLHKDGGIPDGCSLYLRHSSLFAQSE
EEESFSN"
CDS 26071..26811
/codon_start=1
/product="NS3C protein"
/protein_id="AKI29268.1"
/db_xref="GI:823104970"
/translation="MEESLMDVPSTSGTQVYSRKARKRSHSPTKKLRYVKRRFSLLRP
EDLSVIVQPTHYVRVTFSDPNMWYLRSGHHLHSVHNWLKPYGGQPVSEYHITLALLNL
TDEDLARDFSPIALFLRNVRFELHEFALLRKTLVLNASEIYCANIHRFKPVYRVNTAI
PTIKDWLLVQGFSLYHSGLPLHMSISKLHALDDVTRNYIITMPCFRTYPQQMFVTPLA
VDVVSIRSSNQGNKQIVHSYPILHHPGF"
CDS 26818..27492
/codon_start=1
/product="NS3D protein"
/protein_id="AKI29269.1"
/db_xref="GI:823104971"
/translation="MAFSASLFKPVQLVPVSPAFHRIESTDSIVFTYIPASGYVAALA
VNVCLIPLLLLLRQDTCRRSIIRTMVLYFLVLYNFLLAIVLVNGVHYPTGSCLIAFLV
ILIILWFVDRIRFCLMLNSYIPLFDMRSHFIRVSTVSSHGMVPVIHTKPLFIRNFDQR
CSCSRCFYLHSSTYIECTYISRFSKISLVSVTDFSLNGNVSTVFVPATRDSVPLHIIA
PSSLIV"
CDS 27568..27816
/codon_start=1
/product="E protein"
/protein_id="AKI29270.1"
/db_xref="GI:823104972"
/translation="MLPFVQERIGLFIVNFFIFTVVCAITLLVCMAFLTATRLCVQCM
TGFNTLLVQPALYLYNTGRSVYVKFQDSKPPLPPDEWV"
CDS 27831..28490
/codon_start=1
/product="M protein"
/protein_id="AKI29271.1"
/db_xref="GI:823104973"
/translation="MSNMTQLTEAQIIAIIKDWNFAWSLIFLLITIVLQYGYPSRSMT
VYVFKMFVLWLLWPSSMALSIFSAIYPIDLASQIISGIVAAVSAMMWISYFVQSIRLF
MRTGSWWSFNPETNCLLNVPFGGTTVVRPLVEDSTSVTAVVTNGHLKMAGMHFGACDY
DRLPNEVTVAKPNVLIALKMVKRQSYGTNSGVAIYHRYKAGNYRSPPITADIELALLR
A"
CDS 28544..29785
/codon_start=1
/product="N protein"
/protein_id="AKI29272.1"
/db_xref="GI:823104974"
/translation="MASPAAPRAVSFADNNDITNTNLSRGRGRNPKPRAAPNNTVSWY
TGLTQHGKVPLTFPPGQGVPLNANSTPAQNAGYWRRQDRKINTGNGIKQLAPRWYFYY
TGTGPEAALPFRAVKDGIVWVHEDGATDAPSTFGTRNPNNDSAIVTQFAPGTKLPKNF
HIEGTGGNSQSSSRASSVSRNSSRSSSQGSRSGNSTRGTSPGPSGIGAVGGDLLYLDL
LNRLQALESGKVKQSQPKVITKKDAAAAKNKMRHKRTSTKSFNMVQAFGLRGPGDLQG
NFGDLQLNKLGTEDPRWPQIAELAPTASAFMGMSQFKLTHQNNDDHGNPVYFLRYSGA
IKLDPKNPNYNKWLELLEQNIDAYKTFPKKEKKQKAPKEESTDQMSEPPKEQRVQGSI
TQRIRTRPSVQPGPMIDVNTD"

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Thu Jun 04, 2015 7:45 pm 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
1 atctcacttc ccctcgttct cttgcagaac tttgatttta acgaacttaa ataaaagccc
61 tgttgtttag cgtattgttg cacttgtctg gtgggattgt ggcattaatt tgcctgctca
121 tctaggcagt ggacatatgc tcaacactgg gtataattct aattgaatac tatttttcag
181 ttagagcgtc gtgtctcttg tacgtctcgg tcacaataca cggtttcgtc cggtgcgtgg
241 caattcgggg cacatcatgt ctttcgtggc tggtgtgacc gcgcaaggtg cgcgcggtac
301 gtatcgagca gcgctcaact ctgaaaaaca tcaagaccat gtgtctctaa ctgtgccact
361 ctgtggttca ggaaacctgg ttgaaaaact ttcaccatgg ttcattgatg gcgaaaatgc
421 ctatgaagtg gtgaaggcca tgttacttaa aaaggagcca cttctctatg tgcccatccg
481 gctggctgga cacactagac acctcccagg tcctcgtgta tacctggttg agaggctcat
541 tgcttgtgaa aatccattca tggttaacca attggcttat agctctagtg caaatggcag
601 cttggttggc acaactttgc agggcaagcc tattggtatg ttcttccctt atgacatcga
661 acttgtcaca ggaaagcaaa atattctcct gcgcaagtat ggccgtggtg gttatcacta
721 caccccattc cactatgagc gagacaacac ctcttgccct gagtggatgg acgattttga
781 ggcggatcct aaaggcaaat atgcccagaa tctgcttaag aagttgattg gcggtgatgt
841 cactccagtt gaccaataca tgtgtggcgt tgatggaaaa cccattagtg cctacgcatt
901 tttaatggcc aaggatggaa taaccaaact ggctgatgtt gaagcggacg tcgcagcacg
961 tgctgatgac gaaggcttca tcacattaaa gaacaatcta tatagattgg tttggcatgt
1021 tgagcgtaaa gacgttccat atcctaagca atctattttt actattaata gtgtggtcca
1081 aaaggatggt gttgaaaaca ctcctcctca ctattttact cttggatgca aaattttaac
1141 gctcacccca cgcaacaagt ggagtggcgt ttctgacttg tccctcaaac aaaaactcct
1201 ttacaccttc tatggtaagg agtcacttga gaacccaacc tacatttacc actccgcatt
1261 cattgagtgt ggaagttgtg gtaatgattc ctggcttaca gggaatgcta tccaagggtt
1321 tgcctgtgga tgtggggcat catatacagc taatgatgtc gaagtccaat catctggcat
1381 gattaagcca aatgctcttc tttgtgctac ttgccccttt gctaagggtg atagctgttc
1441 ttctaattgc aaacattcag ttgctcagtt ggttagttac ctttctgaac gttgtaatgt
1501 tattgctgat cctaagtcct tcacacttat ctttggtggc gtagcttacg cctactttgg
1561 atgtgaggaa ggtactatgt actttgtgcc tagagctaag tctgttgtct caaggattgg
1621 agactccgtc tttacaggct gtactggctc ttggaacaag gttactcaaa ttgctaacat
1681 gttcttggaa cagactcagc attcccttaa ctttgtggga gagttcgttg tcaacgatgt
1741 tgtcctcgca attctctctg gaaccacaac taatgttgac aaaatacgcc agcttctcaa
1801 gggtgtcacc cttgacaagt tgcgtgatta tttagctgac tatgacatag cagtcactgc
1861 cggcccattc atggataatg ctattaatgt tggtggtaca ggattacagt atgccgccat
1921 tactgcacct tatgtagttc tcactggctt aggtgagtcc tttaagaaag ttgcaaccat
1981 accgtacaag gtttgcaact ctgttaagga tactctgact tattatgctc acagcgtgtt
2041 gtacagagtt tttccttatg acatggattc tggtgtgtca tcttttagtg aactactttt
2101 tgattgcgtt gatctttcag tagcttctac ctatttttta gtccgcctct tgcaagataa
2161 ggctggcgac tttatgtcta caattattac ttcctgccaa actgctgtta gtaagcttct
2221 agatacatgt tttgaagcta cagaagcaac atttaacttc ttgttagatt tggcaggatt
2281 gttcagaatc tttcttcgca atgcctatgt gtacacttca caagggtttg tggtggtcaa
2341 tggcaaagtt tctacacttg tcaaacaagt gttagacttg cttaataagg gtatgcaact
2401 tttgcataca aaggtctcct gggctggttt taatatcagt gctgttatct acagcggcag
2461 ggagtctcta atattcccat cgggaaccta ttactgtgtc accactaagg ctaagtccgt
2521 tcaacaagat cttgacgtta ttttgcctgg tgagttttcc aagaagcagt taggactgct
2581 ccaacctact gacaattcta caactgttag tgttactgta tccagtaaca tggttgaaac
2641 tgttgtgggt caacttgagc aaactaatat gcatagtcct gatgttatag taggtgacta
2701 tgtcattatt agtgaaaaat tgtttgtgcg tagtaaggaa gaagacggat ttgccttcta
2761 ccctgcttgc actaatggtc atgctgtacc gactctcttt agacttaagg gaggtgcacc
2821 tgtaaaaaaa gtagcctttg gcggtgatca agtacatgag gttgctgctg taagaagtgt
2881 tactgtcgag tacaacattc atgctgtatt agacacacta cttgcttctt ctagtcttag
2941 aacctttgtt gtagataagt ctttgtcaat tgaggagttt gctgacgtag taaaggaaca
3001 agtctcagac ttgcttgtta aattactgcg tggaatgccg attccagatt ttgatttaga
3061 cgattttatt gacgcaccat gctattgctt taacgctgag ggtgatgcat cttggtcttc
3121 tactatgatc ctctctcttc accccgtcga gtgtgacgag gagtgttctg aagtagaggc
3181 ttcagattta gaagaaggtg aatcagagtg catttctgag acttcaactg aacaagttga
3241 cgtttctcat gagatttctg acgacgagtg ggctgctgca gttgatgaag cgttccctct
3301 cgatgaagca gaagatgtta ctgaatctgt gcaagaagaa gcacaaccag tagaagtacc
3361 tgttgaagat attgcgcagg ttgtcatagc tgacacctta caggaaactc ctgttgtgtc
3421 tgatactgtt gaagtcccac cgcaagtggt gaaacttccg tctgaacctc agactatcca
3481 gcccgaggta aaagaagttg cacctgtcta tgaggctgat accgaacaga cacagagtgt
3541 tactgttaaa cctaagaggt tacgcaaaaa gcgtaatgtt gaccctttgt ccaattttga
3601 acataaggtt attacagagt gcgttaccat agttttaggt gacgcaattc aagtagccaa
3661 gtgctatggt gagtctgtgt tagttaatgc tgctaacaca catcttaagc atggcggtgg
3721 tatcgctggt gctattaatg cggcttcaaa aggggctgtc caaaaagagt cagatgagta
3781 tattctggct aaagggccgt tacaagtagg agattcagtt ctcttgcaag gccattctct
3841 agctaagaat atcctgcatg tcgtaggccc agatgcccgc gctaaacagg atgtttctct
3901 ccttagtaag tgctataagg ctatgaatgc atatcctctt gtagtcactc ctcttgtttc
3961 agcaggcata tttggtgtaa aaccagctgt gtcttttgat tatcttatta gagaggctaa
4021 gactagagtt ttagtcgtcg ttaattccca agatgtctat aagagtctta ccatagttga
4081 cattccacag agtttgactt tttcatatga tgggttacgt ggcgcaatac gtaaagctaa
4141 agattatggt tttactgttt ttgtgtgcac agacaactct gctaacacta aagttcttag
4201 gaacaagggt gttgattata ctaagaagtt ttttacagtt gacggtgtgc aatattattg
4261 ctacacgtct aaggacactt tagatgatat cttacaacag gctaataagt ctgttggtat
4321 tatatctatg cctttgggat atgtgtctca tggtttagac ttaattcaag cagggagtgt
4381 cgtgcgtaga gttaacgtgc cctacgtgtg tctcctagct aataaagagc aagaagctat
4441 tttgatgtct gaagacgtta agttaaaccc ttcagaagat tttataaagc acgtccgcac
4501 taatggtggt tacaattctt ggcatttagt cgagggtgaa ctattggtgc aagacttacg
4561 cttaaataag ctcctgcatt ggtctgatca aaccatatgc tacaaggata gtgtgtttta
4621 tgttgtaaag aatagtacag cttttccatt tgaaacactt tcagcatgtc gtgcgtattt
4681 ggattcacgc acgacacagc agttaacaat cgaagtctta gtgactgtcg atggtgtaaa
4741 ttttagaaca gtcgttctaa ataataagaa cacttataga tcacagcttg gatgcgtttt
4801 ctttaatggt gctgatattt ctgataccat tcctgatgag aaacagaatg gtcacagttt
4861 atatctagca gacaatttga ctgctgatga aacaaaggcg cttaaagagt tatatggccc
4921 cgttgatcct actttcttac acagattcta ttcacttaag gctgcagtcc ataagtggaa
4981 gatggttgtg tgtgataagg tacgttctct caaattgagt gataataatt gttatcttaa
5041 tgcagttatt atgacacttg atttattgaa ggacattaaa tttgttatac ctgctctaca
5101 gcatgcattt atgaaacata agggcggtga ttcaactgac ttcatagccc tcattatggc
5161 ttatggcaat tgcacatttg gtgctccaga tgatgcctct cggttacttc ataccgtgct
5221 tgcaaaggct gagttatgct gttctgcacg catggtttgg agagagtggt gcaatgtctg
5281 tggcataaaa gatgttgttc tacaaggctt aaaagcttgt tgttacgtgg gtgtgcaaac
5341 tgttgaagat ctgcgtgctc gtatgacata tgtatgccag tgtggtggtg aacgtcatcg
5401 gcaaatagtc gaacacacca ccccctggtt gctgctctca ggcacaccaa atgaaaaatt
5461 ggtgacaacc tccacggcgc ctgattttgt agcgtttaat gtctttcagg gcattgaaac
5521 ggctgttggc cattatgttc atgctcgcct gaagggtggt cttattttaa agtttgactc
5581 tggcaccgtt agcaagactt cagactggaa gtgcaaggtg acagatgtac ttttctccgg
5641 ccaaaaatac agtagcgatt gtaatgtcgt acggtattct ttggacggta atttcagaac
5701 agaggttgat cccgacctat ctgctttcta tgttaaggat ggtaaatact ttacaagtga
5761 accacccgta acatattcac cagctacaat tttagctggt agtgtctaca ctaatagctg
5821 ccttgtatcg tctgatggac aacctggcgg tgatgctatt agtttgagtt ttaataacct
5881 tttagggttt gattctagta aaccagtcgc taagaaatac acttactcct tcttgcctaa
5941 agaagacggc gatgtgttgt tggctgagtt tgacacttat gaccctattt ataagaatgg
6001 tgccatgtat aaaggcaaac caattctttg ggtcaacaaa gcatcttatg atactaatct
6061 taataagttc aatagagcta gtttgcgtca aatttttgac gtagccccca ttgaactcga
6121 aaataaattc acacctttga gtgtggagtc tacaccagtt gaacctccaa ctgtagatgt
6181 ggtagcactt caacaggaaa tgacaattgt caaatgtaag ggtttaaata aacctttcgt
6241 gaaggacaat gtcagtttcg ttgctgatga ctcaggtact cccgttgttg agtatctgtc
6301 taaagaagat ctacatacat tgtatgtaga ccctaagtat caagtcattg tcttaaaaga
6361 caatgtactt tcttctatgc ttagattgca caccgttgag tcaggtgata ttaacgttgt
6421 tgcagcttcc ggatctttga cacgtaaagt gaaattacta tttagggctt cattttattt
6481 caaagaattt gctacccgca ctttcactgc taccactgct gtaggtagtt gtataaagag
6541 tgtagtgcgg catctaggtg ttactaaagg catattgaca ggctgtttta gttttgtcaa
6601 gatgttattt atgcttccac tagcttactt tagtgattca aaactcggca ccacagaggt
6661 taaagtgagt gctttgaaaa cagctggcgt tgtgacaggt aatgttgtaa aacagtgttg
6721 cactgctgct gttgatttaa gtatggataa gttgcgccgt gtggattgga aatcaaccct
6781 acggttgtta cttatgttat gcacaactat ggtattgttg tcttctgtgt atcacttgta
6841 tgtcttcaat caggtcttat caagtgatgt tatgtttgaa gatgcccaag gtttgaaaaa
6901 gttctacaaa gaagttagag cttacctagg aatctcttct gcttgtgacg gtcttgcttc
6961 agcttatagg gcgaattcct ttgatgtacc tacattctgc gcaaaccgtt ctgcaatgtg
7021 taattggtgc ttgattagcc aagattccat aactcactac ccagctctta agatggttca
7081 aacacatctt agccactatg ttcttaacat agattggttg tggtttgcat ttgagactgg
7141 tttggcatac atgctctata cctcggcctt caactggttg ttgttggcag gtacattgca
7201 ttatttcttt gcacagactt ccatatttgt agactggcgg tcatacaatt atgctgtgtc
7261 tagtgccttc tggttattca cccacattcc aatggcgggt ttggtacgaa tgtataattt
7321 gttagcatgc ctttggcttt tacgcaagtt ttatcagcat gtaatcaatg gttgcaaaga
7381 tacggcatgc ttgctctgct ataagaggaa ccgacttact agagttgaag cttctaccgt
7441 tgtctgtggt ggaaaacgta cgttttatat cacagcaaat ggcggtattt cattctgtcg
7501 taggcataat tggaattgtg tggattgtga cactgcaggt gtggggaata ccttcatctg
7561 tgaagaagtc gcaaatgact tcactaccgc cctacgcagg cctattaacg ctacggatag
7621 atcacattat tatgtggatt ccgttacagt taaagagact gttgttcagt ttaattatcg
7681 tagagacggt caaccattct acgagcggtt tcccctctgc gcttttacaa atctagataa
7741 gttgaagttc aaagaggtct gtaaaactac tactggtata cctgaataca actttatcat
7801 ctacgactca tcagatcgtg gccaggaaag tttagctagg tctgcatgtg tttattattc
7861 tcaagtcttg tgtaaatcaa ttcttttggt tgactcaagt ttggttactt ctgttggtga
7921 ttctagtgaa atcgccacta aaatgtttga ttcctttgtt aatagtttcg tctcgctgta
7981 taatgtcaca cgcgataagt tggaaaaact tatctctact gctcgtgatg gcgtaaggcg
8041 aggcgataac ttccatagtg tcttaacaac attcattgac gcagcacgag gccccgcagg
8101 tgtggagtct gatgttgaga ccaatgaaat tgttgactct gtgcagtatg ctcataaaca
8161 tgacatacaa attactaatg agagttacaa taattatgta ccctcatatg ttaaacctga
8221 tagtgtgtct accagtgatt taggtagtct cattgattgt aatgcggctt cagttaacca
8281 aattgtcttg cgtaattcta atggtgcttg tatttggaac gctgctgcat atatgaaact
8341 ctcggatgca cttaaacgac agattcgcat tgcatgccgt aagtgtaatt tagctttccg
8401 gttaaccacc tcaaagctac gcgctaatga taatatctta tcagttagat tcactgctaa
8461 caaaattgtt ggtggtgctc ctacatggtt taatgcgttg cgtgacttta cgttaaaggg
8521 ttacgttctt gctaccatta ttgtgtttct gtgtgctgta ctgatgtatt tgtgtttacc
8581 tacattttct atggtacctg ttgaatttta tgaagaccgc atcttggact ttaaagttct
8641 tgataatggt atcattaggg atgtaaatcc tgatgataag tgctttgcta ataagcaccg
8701 gtccttcaca caatggtatc atgagcatgt tggtggtgtc tatgacaact ctatcacatg
8761 cccattgaca gttgcagtaa ttgctggagt tgctggtgct cgcattccag acgtacctac
8821 tacattggct tggttgaaca atcagataat tttctttgtt tctcgagtct ttgctaatac
8881 aggcagtgtt tgctacactc ctatagatga gataccctat aagagtttct ctgatagtgg
8941 ttgcattctt ccatctgagt gcactatgtt tagggatgca gagggccgta tgacaccata
9001 ctgccatgat cctactgttt tgcctggggc ttttgcgtac agtcagatga ggcctcatgt
9061 tcgttacgac ttgtatgatg gtaacatgtt tattaaattt cctgaagtag tatttgaaag
9121 tacacttagg attactagaa ctctgtcaac tcagtactgc cggttcggta gttgtgagta
9181 tgcacaagag ggtgtttgta ttaccacaaa tggctcgtgg gccattttta atgaccacca
9241 tcttaataga cctggtgtct attgtggctc tgattttatt gacattgtca ggcggttagc
9301 agtatcactg ttccagccta ttacttattt ccaattgact acctcattgg tcttgggtat
9361 aggtttgtgt gcgttcctga ctttgctctt ctattatatt aataaagtaa aacgtgcttt
9421 tgcagattac acccagtgtg ctgtaattgc tgttgttgct gctgttctta atagcttgtg
9481 catctgcttt gttgcctcta taccattgtg tatagtacct tacactgcat tgtactatta
9541 tgctacattc tattttacta atgagcctgc atttattatg catgtttctt ggtacattat
9601 gttcgggcct atcgttccca tatggatgac ctgcgtttat acagttgcaa tgtgctttag
9661 acacttcttc tgggttttag cttattttag taagaaacat gtagaagttt ttactgatgg
9721 taagcttaat tgtagtttcc aggacgctgc ctctaatatc tttgttatta acaaggacac
9781 ttatgcagct cttagaaact ctttaactaa tgatgcctat tcacgatttt tggggttgtt
9841 taacaagtat aagtacttct ctggtgctat ggaaacagcc gcttatcgtg aagctgcagc
9901 atgtcatctt gctaaagcct tacaaacata cagcgagact ggtagtgatc ttctttacca
9961 accacccaac tgtagcataa cctctggcgt gttgcaaagc ggtttggtga aaatgtcaca
10021 tcccagtgga gatgttgagg cttgtatggt tcaggttacc tgcggtagca tgactcttaa
10081 tggtctttgg cttgacaaca cagtctggtg cccacgacac gtaatgtgcc cggctgacca
10141 gttgtctgat cctaattatg atgccttgtt gatttctatg actaatcata gtttcagtgt
10201 gcaaaaacac attggcgctc cagcaaactt gcgtgttgtt ggtcatgcca tgcaaggcac
10261 tcttttgaag ttgactgtcg atgttgctaa ccctagcact ccagcctaca cttttacaac
10321 agtgaaacct ggcgcagcat ttagtgtgtt agcatgctat aatggtcgtc cgactggtac
10381 attcactgtt gtaatgcgcc ctaactacac aattaagggt tcctttctgt gtggttcttg
10441 tggtagtgtt ggttacacca aggagggtag tgtgatcaat ttttgttaca tgcatcaaat
10501 ggaacttgct aatggtacac ataccggttc agcatttgat ggtactatgt atggtgcctt
10561 tatggataaa caagtgcacc aagttcagtt aacagacaaa tactgcagtg ttaatgtagt
10621 agcttggctt tacgcagcaa tacttaatgg ttgcgcttgg tttgtaaaac ccaatcgcac
10681 tagtgttgtt tcttttaatg aatgggctct tgccaaccaa ttcactgaat ttgttggcac
10741 tcaatccgtt gacatgttag ctgtcaaaac aggcgttgct attgaacagc tgctttatgc
10801 gatccaacaa ctttatactg ggttccaggg aaagcaaatc cttggcagta ctatgttgga
10861 agatgaattc acacctgagg atgttaatat gcagattatg ggtgtggtta tgcagagtgg
10921 tgtgagaaaa gttacatatg gtactgcgca ttggttgttc gcgacccttg tctcaaccta
10981 tgtgataatc ttacaagcca ctaaatttac tttgtggaac tacttgtttg agactattcc
11041 cacacagttg ttcccactct tatttgtgac tatggccttc gttatgttgt tggttaaaca
11101 caaacacacc tttttgacac ttttcttgtt gcctgtggct atttgtttga cttatgcaaa
11161 catagtctac gagcccacta ctcccatttc gtcagcgctg attgcagttg caaattggct
11221 tgcccccact aatgcttata tgcgcactac acatactgat attggtgtct acattagtat
11281 gtcacttgta ttagtcattg tagtgaagag attgtacaac ccatcacttt ctaactttgc
11341 gttagcattg tgcagtggtg taatgtggtt gtacacttat agcattggag aagcctcaag
11401 ccccattgcc tatctggttt ttgtcactac actcactagt gattatacga ttacagtctt
11461 tgttactgtc aaccttgcaa aagtttgcac ttatgccatc tttgcttact caccacagct
11521 tacacttgtg tttccggaag tgaagatgat acttttatta tacacatgtt taggtttcat
11581 gtgtacttgc tattttggtg tcttctctct tttgaacctt aagcttagag cacctatggg
11641 tgtctatgac tttaaggtct caacacaaga gttcagattc atgactgcta acaatctaac
11701 tgcacctaga aattcttggg aggctatggc tctgaacttt aagttaatag gtattggcgg
11761 tacaccttgt ataaaggttg ctgctatgca gtctaaactt acagatctta aatgcacatc
11821 tgtggttctc ctctctgtgc tccaacagtt acacttagag gctaatagta gggcctgggc
11881 tttctgtgtt aaatgccata atgatatatt ggcagcaaca gaccccagtg aggctttcga
11941 gaaattcgta agtctctttg ccactttaat gactttttct ggtaatgtag atcttgatgc
12001 gttagctagt gatatttttg acactcctag cgtacttcaa gctactcttt ctgagttttc
12061 acacttagct acctttgctg agttggaagc tgcgcagaaa gcctatcagg aagctatgga
12121 ctctggtgac acctcaccac aagttcttaa ggctttgcag aaggctgtta atatagctaa
12181 aaacgcctat gagaaggata aggcagtggc ccgtaagtta gaacgtatgg ctgaccaggc
12241 tatgacttct atgtataagc aagcacgtgc tgaagacaag aaagcaaaaa ttgtcagtgc
12301 tatgcaaact atgttgtttg gtatgattaa gaagctcgac aacgatgttc ttaatggtat
12361 catttctaac gctaggaatg gttgtatacc tcttagtgtc attccactgt gtgcttcaaa
12421 taaacttcgc gttgtaattc ctgacttcac cgtctggaat caggtagtca catatccctc
12481 gcttaactac gctggggctt tgtgggacat tacagttata aacaatgtgg acaatgaaat
12541 tgttaagtct tcagatgttg tagacagcaa tgaaaattta acatggccac ttgttttaga
12601 atgcactagg gcatccactt ctgccgttaa gttgcaaaat aatgagatca aaccttcagg
12661 tttaaaaacc atggttgtgt ctgcaggtca agagcaaact aactgtaata ctagttcctt
12721 agcttattac gaacctgtgc agggtcgtaa aatgctgatg gctcttcttt ctgataatgc
12781 ctatctcaaa tgggcgcgtg ttgaaggtaa ggacggattt gttagtgtag agctacaacc
12841 tccttgcaaa ttcttgattg cgggaccaaa aggacctgaa atccgatatc tctattttgt
12901 taaaaatctt aacaaccttc atcgcgggca agtgttaggg cacattgctg cgactgttag
12961 attgcaagct ggttctaaca ccgagtttgc ctctaattct tcggtgttgt cacttgttaa
13021 cttcaccgtt gatcctcaaa aagcttatct cgatttcgtc aatgcgggag gtgccccatt
13081 gacaaattgt gttaagatgc ttactcctaa aactggtaca ggtatagcta tatctgttaa
13141 accagagagt acagctgatc aagagactta tggtggagct tcagtgtgtc tctattgccg
13201 tgcgcatata gaacatcctg atgtctctgg tgtttgtaaa tataagggta agtttgtcca
13261 aatccctgct cagtgtgtcc gtgaccctgt gggattttgt ttgtcaaata ccccctgtaa
13321 tgtctgtcaa tattggattg gatatgggtg caattgtgac tcgcttaggc aagcaacact
13381 gccccaatct aaagattcca attttttaaa cgagtccggg gttctattgt aaatgcccga
13441 atagaaccct gttcaagtgg tttgtccact gatgtcgttt ttagggcatt tgacatctgc
13501 aactataagg ctaaggttgc tggtattgga aaatactaca agactaatac ttgtaggttt
13561 gtagaattag atgaccaagg gcatcattta gactcctatt ttgtcgttaa gaggcatact
13621 atggagaatt atgaactaga gaagcactgt tacgatttgt tacgtgactg tgatgctgta
13681 gctccccatg atttcttcat ctttgatgta gacaaagtta aaacacctca tattgtacgt
13741 cagcgtttaa ctgagtacac tatgatggat cttgtatatg ccctgaggca ctttgatcaa
13801 aatagcgaag tgcttaaggc tatcttagtg aagtatggtt gctgtgatgt tacctacttt
13861 gaaaataaac tctggtttga tttcgttgaa aatcccagtg ttattggtgt ttatcataaa
13921 cttggagaac gtgtacgcca agctatctta aacactgtta aattttgtga ccacatggtc
13981 aaggctggtt tagtcggtgt gctcacacta gacaaccagg accttaatgg caagtggtat
14041 gattttggtg acttcgtaat cactcaacct ggttcaggag tagctatagt tgatagctac
14101 tattcttatt tgatgcctgt gctctcaatg accgattgtc tggccgctga gacacatagg
14161 gattgtgatt ttaataaacc actcattgag tggccactta ctgagtatga ttttactgat
14221 tataaggtac aactctttga gaagtacttt aaatattggg atcagacgta tcacgcaaat
14281 tgcgttaatt gtactgatga ccgttgtgtg ttacattgtg ctaatttcaa tgtattgttt
14341 gctatgacca tgcctaagac ttgtttcgga cccatagtcc gaaagatctt tgttgatggc
14401 gtgccatttg tagtatcttg tggttatcac tacaaagaat taggtttagt catgaatatg
14461 gatgttagtc tccatagaca taggctctct cttaaagagt tgatgatgta tgccgctgat
14521 ccagccatgc acattgcctc ctctaacgct tttcttgatt tgaggacatc atgttttagt
14581 gtcgctgcac ttacaactgg tttgactttt caaactgtgc ggcctggcaa ttttaaccaa
14641 gacttctatg atttcgtggt atctaaaggt ttctttaagg agggctcttc agtgacgctc
14701 aaacattttt tctttgctca agatggtaat gctgctatta cagattataa ttactattct
14761 tataatctgc ctactatgtg tgacatcaaa caaatgttgt tctgcatgga agttgtaaac
14821 aagtacttcg aaatctatga cggtggttgt cttaatgctt ctgaagtggt tgttaataat
14881 ttagacaaga gtgctggcca tccttttaat aagtttggca aagctcgtgt ctattatgag
14941 agcatgtctt accaggagca agatgaactc tttgccatga caaagcgtaa cgtcattcct
15001 accatgactc aaatgaatct aaaatatgct attagtgcta agaatagagc tcgcactgtt
15061 gcaggcgtgt ccatacttag cacaatgact aatcgccagt accatcagaa aatgcttaag
15121 tccatggctg caactcgtgg agcgacttgc gtcattggta ctacaaagtt ctatggtggc
15181 tgggatttca tgcttaaaac attgtacaaa gatgttgata atccgcatct tatgggttgg
15241 gattacccta agtgtgatag agctatgcct aatatgtgta gaatcttcgc ttcactcata
15301 ttagctcgta aacatgccac ttgttgtact acaagggaca gattttatcg cttggcaaat
15361 gagtgtgctc aggtgctaag cgaatatgtt ctatgtggtg gtggttacta cgtcaaacct
15421 ggaggtacca gtagcggaga tgccaccact gcatatgcca atagtgtctt taacattttg
15481 caggcgacaa ctgctaatgt cagtgcactt atgggtgcta atggcaacaa gattgttgac
15541 aaagaagtta aagacatgca gtttgatttg tatgtcaatg tttacaggag cactagccca
15601 gaccccaaat ttgttgataa atactatgct tttcttaata agcacttttc tatgatgata
15661 ctgtctgatg acggtgtcgt ttgctataat agtgattatg cagctaaggg ttacattgct
15721 ggaatacaga attttaagga aacgctgtat tatcagaaca atgtctttat gtctgaagct
15781 aaatgctggg tggaaaccga tctgaagaaa gggccacatg aattctgttc acagcatacg
15841 ctttatatta aggatggcga cgatggttac ttccttcctt atccagaccc ttcaagaatt
15901 ttgtctgccg gttgctttgt agatgatatc gttaagactg acggtacact catggtagag
15961 cggtttgtgt ctttggctat agatgcttac cctctcacaa agcatgaaga tatagaatac
16021 cagaatgtat tctgggtcta cttacagtat atagaaaaac tgtataaaga ccttacagga
16081 cacatgcttg acagttattc tgtcatgcta tgtggtgata attctgctaa gttttgggaa
16141 gaggcattct acagagatct ctatagttcg cctaccactt tgcaggctgt cggttcatgc
16201 gttgtatgcc attcacagac ttccctacgc tgtgggacat gcatccgtag accatttctc
16261 tgctgtaaat gctgctatga tcatgttata gcaactccac ataagatggt tttgtctgtt
16321 tctccttacg tttgtaatgc ccctggttgt ggcgtttcag acgttactaa gctatattta
16381 ggtggtatga gctacttttg tgtagatcat agacctgtgt gtagttttcc actttgcgct
16441 aatggtcttg tattcggctt atacaagaat atgtgcacag gtagtccttc tatagttgaa
16501 tttaataggt tggctacctg tgactggact gaaagtggtg attacaccct tgccaatact
16561 acaacagaac cactcaaact ttttgctgct gagactttac gtgccactga agaggcgtct
16621 aagcagtctt atgctattgc caccatcaaa gaaattgttg gtgagcgcca actattactt
16681 gtgtgggagg ctggcaagtc caaaccacca ctcaatcgta attatgtttt tactggttat
16741 catataacca aaaatagtaa agtgcagctc ggtgagtaca tcttcgagcg cattgattat
16801 agtgatgctg tatcctacaa gtctagtaca acgtataaac tgactgtagg tgacatcttc
16861 gtacttacct ctcactctgt ggctaccttg acggcgccca caattgtgaa tcaagagagg
16921 tatgttaaaa ttactgggtt gtacccaacc attacggtac ctgaagagtt cgcaagtcat
16981 gttgccaact tccaaaaatc aggttatagt aaatatgtca ctgttcaggg accacctggc
17041 actggcaaaa gtcactttgc tatagggtta gcgatttact accctacagc acgtgttgtt
17101 tatacagcat gttcacacgc agctgttgat gctttgtgtg aaaaagcttt taaatatttg
17161 aacattgcta aatgttcccg tattattcct gcaaaggcac gtgttgagtg ctatgacagg
17221 tttaaagtta atgagacaaa ttctcaatat ttgtttagta ctattaatgc tctaccagaa
17281 acttctgccg atattctggt ggttgatgag gttagtatgt gcactaatta tgatctttca
17341 attattaatg cacgtattaa agctaagcac attgtctatg taggagatcc agcacagttg
17401 ccagctccta ggactttgtt gactagaggc acattggaac cagaaaattt caatagtgtc
17461 actagattga tgtgtaactt aggtcctgac atatttttaa gtatgtgcta caggtgtcct
17521 aaggaaatag taagcactgt gagcgctctt gtctacaata ataaattgtt agccaagaag
17581 gagctttcag gccagtgctt taaaatactc tataagggca atgtgacgca tgatgctagc
17641 tctgccatta atagaccaca actcacattt gtgaagaatt ttattactgc caatccggca
17701 tggagtaagg cagtctttat ttcgccttat aattcacaga atgctgtggc tcgttcaatg
17761 ctgggtctta ctactcagac tgttgattcc tcacagggtt cagaatacca gtacgttatc
17821 ttctgtcaaa cagcagatac ggcacatgct aacaacatta acagatttaa tgttgcaatc
17881 actcgtgccc aaaaaggtat tctttgtgtt atgacatctc aggcactctt tgagtcctta
17941 gagtttactg aattgtcttt tactaattac aagctccagt ctcagattgt aactggcctt
18001 tttaaagatt gctctagaga aacttctggc ctctcacctg cttatgcacc aacatacgtt
18061 agtgttgatg acaagtataa gacgagtgat gagctttgcg tgaatcttaa tttacccgca
18121 aatgtcccat actctcgtgt tatttccagg atgggcttta aactcgatgc aacagttcct
18181 ggatatccta agcttttcat tactcgtgaa gaggctgtaa ggcaagttcg aagctggata
18241 ggcttcgatg ttgagggtgc tcatgcttcc cgtaatgcat gtggcaccaa tgtgcctcta
18301 caattaggat tttcaactgg tgtgaacttt gttgttcagc cagttggtgt tgtagacact
18361 gagtggggta acatgttaac gggcattgct gcccgtcctc caccaggtga acagtttaag
18421 cacctcgtgc ctcttatgca taagggggct gcgtggccta ttgttagacg acgtatagtg
18481 caaatgttgt cagacacttt agacaaattg tctgattact gtacgtttgt ttgttgggct
18541 catggctttg aattaacgtc tgcatcatac ttttgcaaga taggtaagga acagaagtgt
18601 tgcatgtgca atagacgcgc tgcagcgtac tcttcacctc tgcaatctta tgcctgctgg
18661 actcattcct gcggttatga ttatgtctac aaccctttct ttgtcgatgt tcaacagtgg
18721 ggttatgtag gcaatcttgc tactaatcac gatcgttatt gctctgtcca tcaaggagct
18781 catgtggctt ctaatgatgc aataatgact cgttgtttag ctattcattc ttgttttata
18841 gaacgtgtgg attgggatat agagtatcct tatatctcac atgaaaagaa attgaattcc
18901 tgttgtagaa tcgttgagcg caacgtcgta cgtgctgctc ttcttgccgg ttcatttgac
18961 aaagtctatg atattggcaa tcctaaagga attcctattg ttgatgaccc tgtggttgat
19021 tggcattatt ttgatgcaca gcccttgacc agaaaggtac aacagctttt ctatacagag
19081 gacatggcct caagatttgc tgatgggctc tgcttatttt ggaactgtaa tgtaccaaaa
19141 tatcctaata atgcaattgt atgcaggttt gacacacgtg tgcattctga gttcaatttg
19201 ccaggttgtg atggcggtag tttgtatgtt aacaagcacg cttttcatac accagcatat
19261 gatgtgagtg cattccgtga tctgaaacct ttaccattct tttattattc tactacacca
19321 tgtgaagtgc atggtaatgg tagtatgata gaggatattg attatgtacc cctaaaatct
19381 gcagtctgta ttacagcttg taatttaggg ggcgctgttt gtaggaagca tgctacagag
19441 tacagagagt atatggaagc atataatctt gtctctgcat caggtttccg cctttggtgt
19501 tataagacct ttgatattta taatctctgg tctactttta caaaagttca aggtttggaa
19561 aacattgctt ttaattttgt taaacaaggc cattttattg gtgttgaggg tgaactacct
19621 gtagctgtag tcaatgataa gatcttcacc aagagtggcg ttaatgacat ttgtatgttt
19681 gagaataaaa ccactttgcc tactaatata gcttttgaac tctatgctaa gcgtgctgta
19741 cgctcgcatc ccgatttcaa attgctacac aatttacaag cagacatttg ctacaagttc
19801 gtcctttggg attatgaacg tagcaatatt tatggtactg ctactattgg tgtatgtaag
19861 tacactgata ttgatgttaa ttcagctttg aatatatgtt ttgacatacg cgataatggt
19921 tcattggaga agttcatgtc tactcccaat gccatcttta tttctgatag aaaaattaag
19981 aaataccctt gtatggtagg tcctgattat gcttacttca atggtgctat catccgtgat
20041 agtgatgttg ttaaacaacc agtgaagttc tacttgtata agaaagtcaa taatgagttt
20101 attgatccta ctgagtgtat ttacactcag agtcgctctt gtagtgactt cctacccctg
20161 tctgacatgg agaaagactt tctatctttt gatagtgatg ttttcattaa gaagtatggc
20221 ttggaaaact atgcttttga gcacgtagtc tatggagact tctctcatac tacgttaggc
20281 ggtcttcact tgcttattgg tttatacaag aagcaacagg aaggtcatat tattatggaa
20341 gaaatgctaa aaggtagctc aactattcat aactatttta ttactgagac taacacagcg
20401 gcttttaagg cggtgtgttc tgttatagat ttaaagcttg acgactttgt tatgatttta
20461 aagagtcaag accttggcgt agtatccaag gttgtcaagg ttcctattga cttaacaatg
20521 attgagttta tgttatggtg taaggatgga caggttcaaa ccttctaccc tcgactccag
20581 gcttctgcag attggaaacc tggtcatgca atgccatccc tctttaaagt tcaaaatgta
20641 aaccttgaac gttgtgagct tgctaattac aagcaatcta ttcctatgcc tcgcggtgtg
20701 cacatgaaca tcgctaaata tatgcaattg tgccagtatt taaatacttg cacattagcc
20761 gtgcctgcca atatgcgtgt tatacatttt ggcgctggtt ctgataaagg tatcgctcct
20821 ggtacatcag ttttacgaca gtggcttcct acagatgcca ttattataga taatgattta
20881 aatgagttcg tgtcagatgc tgacataact ttatttggag attgtgtaac tgtacgtgtc
20941 ggccaacaag tggatcttgt tatttccgac atgtatgatc ctactactaa gaatgtaaca
21001 ggtagtaatg agtcaaaggc tttattcttt acttacctgt gtaacctcat taataataat
21061 cttgctcttg gtgggtctgt tgctattaaa ataacagaac actcttggag cgttgaactt
21121 tatgaactta tgggaaaatt tgcttggtgg actgttttct gcaccaatgc aaatgcatcc
21181 tcatctgaag gattcctctt aggtattaat tacttgggta ctattaaaga aaatatagat
21241 ggtggtgcta tgcacgccaa ctatatattt tggagaaatt ccactcctat gaatctgagt
21301 acttactcac tttttgattt atccaagttt caattaaaat taaaaggaac accagttctt
21361 caattaaagg agagtcaaat taacgaactc gtaatatctc tcctgtcgca gggtaagtta
21421 cttatccgtg acaatgatac actcagtgtt tctactgatg ttcttgttaa cacctacaga
21481 aagttacgtt gatgtagggc cagattctgt taagtctgct tgtattgagg ttgatataca
21541 acagactttc tttgataaaa cttggcctag gccaattgat gtttctaagg ctgacggtat
21601 tatataccct caaggccgta catattctaa cataactatc acttatcaag gtctttttcc
21661 ctatcaggga gaccatggtg atatgtatgt ttactctgca ggacatgcta caggcacaac
21721 tccacaaaag ttgtttgtag ctaactattc tcaggacgtc aaacagtttg ctaatgggtt
21781 tgtcgtccgt ataggagcag ctgccaattc cactggcact gttattatta gcccatctac
21841 cagcgctact atacgaaaaa tttaccctgc ttttatgctg ggttcttcag ttggtaattt
21901 ctcagatggt aaaatgggcc gcttcttcaa tcatactcta gttcttttgc ccgatggatg
21961 tggcacttta cttagagctt tttattgtat tctagagcct cgctctggaa atcattgtcc
22021 tgctggcaat tcctatactt cttttgccac ttatcacact cctgcaacag attgttctga
22081 tggcaattac aatcgtaatg ccagtctgaa ctcttttaag gagtatttta atttacgtaa
22141 ctgcaccttt atgtacactt ataacattac cgaagatgag attttagagt ggtttggcat
22201 tacacaaact gctcaaggtg ttcacctctt ctcatctcgg tatgttgatt tgtacggcgg
22261 caatatgttt caatttgcca ccttgcctgt ttatgatact attaagtatt attctatcat
22321 tcctcacagt attcgttcta tccaaagtga tagaaaagct tgggctgcct tctacgtata
22381 taaacttcaa ccgttaactt tcctgttgga tttttctgtt gatggttata tacgcagagc
22441 tatagactgt ggttttaatg atttgtcaca actccactgc tcatatgaat ccttcgatgt
22501 tgaatctgga gtttattcag tttcgtcttt cgaagcaaaa ccttctggct cagttgtgga
22561 acaggctgaa ggtgttgaat gtgatttttc acctcttctg tctggcacac ctcctcaggt
22621 ttataatttc aagcgtttgg tttttaccaa ttgcaattat aatcttacca aattgctttc
22681 acttttttct gtgaatgatt ttacttgtag tcaaatatct ccagcagcaa ttgctagcaa
22741 ctgttattct tcactgattt tggattattt ttcataccca cttagtatga aatccgatct
22801 cagtgttagt tctgctggtc caatatccca gtttaattat aaacagtcct tttctaatcc
22861 cacatgtttg attttagcga ctgttcctca taaccttact actattacta agcctcttaa
22921 gtacagctat attaacaagt gctctcgtct tctttctgat gatcgtactg aagtacctca
22981 gttagtgaac gctaatcaat actcaccctg tgtatccatt gtcccatcca ctgtgtggga
23041 agacggtgat tattatagga aacaactatc tccacttgaa ggtggtggct ggcttgttgc
23101 tagtggctca actgttgcca tgactgagca attacagatg ggctttggta ttacagttca
23161 atatggtaca gacaccaata gtgtttgccc caagcttgaa tttgctaatg acacaaaaat
23221 tgcctctcaa ttaggcaatt gcgtggaata ttccctctat ggtgtttcgg gccgtggtgt
23281 ttttcagaat tgcacagctg taggtgttcg acagcagcgc tttgtttatg atgcgtacca
23341 gaatttagtt ggctattatt ctgatgatgg caactactac tgtttgcgtg cttgtgttag
23401 tgttcctgtt tctgtcatct atgataaaga aactaaaacc cacgctactc tatttggtag
23461 tgttgcatgt gaacacattt cctctaccat gtctcaatac tcccgttcta cgcgatcaat
23521 gcttaaacgg cgagattcta catatggtcc ccttcagaca cctgttggtt gtgtcctagg
23581 acttgttaat tcctctttgt tcgtagagga ctgcaagttg cctcttggtc aatctctctg
23641 tgctcttcct gacacaccta gtactctcac acctcgcagt gtgcgctctg ttccaggtga
23701 aatgcgcttg gcatccattg cttttaatca tcctattcag gttgatcaac ttaatagtag
23761 ttattttaaa ttaagtatac ctactaattt ttcctttggt gtgactcagg agtacattca
23821 gacaaccatt cagaaagtta ctgttgattg taaacagtac gtttgcaatg gtttccagaa
23881 gtgtgagcaa ttactgcgcg agtatggcca gttttgttcc aaaataaacc aggctctcca
23941 tggtgccaat ttacgccagg atgattctgt acgtaatttg tttgcgagcg tgaaaagctc
24001 tcaatcatct cctatcatac caggttttgg aggtgacttt aatttgacac ttctagaacc
24061 tgtttctata tctactggca gtcgtagtgc acgtagtgct attgaggatt tgctatttga
24121 caaagtcact atagctgatc ctggttatat gcaaggttac gatgattgca tgcagcaagg
24181 tccagcatca gctcgtgatc ttatttgtgc tcaatatgtg gctggttaca aagtattacc
24241 tcctcttatg gatgttaata tggaagccgc gtatacctca tctttgcttg gcagcatagc
24301 aggtgttggc tggactgctg gcttatcctc ctttgctgct attccatttg cacagagtat
24361 cttttatagg ttaaacggtg ttggcattac tcaacaggtt ctttcagaga accaaaagct
24421 tattgccaat aagtttaatc aggctctggg agctatgcaa acaggcttca ctacaactaa
24481 tgaagctttt cggaaggttc aggatgctgt gaacaacaat gcacaggctc tatccaaatt
24541 agctagcgag ctatctaata cttttggtgc tatttccgcc tctattggag acatcataca
24601 acgtcttgat gttctcgaac aggacgccca aatagacaga cttattaatg gccgtttgac
24661 aacactaaat gcttttgttg cacagcagct tgttcgttcc gaatcagctg ctctttccgc
24721 tcaattggct aaagataaag tcaatgagtg tgtcaaggca caatccaagc gttctggatt
24781 ttgcggtcaa ggcacacata tagtgtcctt tgttgtaaat gcccctaatg gcctttactt
24841 catgcatgtt ggttattacc ctagcaacca cattgaggtt gtttctgctt atggtctttg
24901 cgatgcagct aaccctacta attgtatagc ccctgttaat ggctacttta ttaaaactaa
24961 taacactagg attgttgatg agtggtcata tactggctcg tccttctatg cacctgagcc
25021 catcacctct cttaatacta agtatgttgc accacaggtg acataccaaa acatttctac
25081 taacctccct cctcctcttc tcggcaattc caccgggatt gacttccaag atgagttgga
25141 tgagtttttc aaaaatgtta gcaccagtat acctaatttt ggttctctaa cacagattaa
25201 tactacatta ctcgatctta cctacgagat gttgtctctt caacaagttg ttaaagccct
25261 taatgagtct tacatagacc ttaaagagct tggcaattat acttattaca acaaatggcc
25321 gtggtacatt tggcttggtt tcattgctgg gcttgttgcc ttagctctat gcgccttctt
25381 catactgtgc tgcactggtt gtggcacaaa ctgtatggga aaacttaagt gtaatcgttg
25441 ttgtgataga tacgaggaat acgacctcga gccgcataag gttcatgttc actaattaac
25501 gaactatcaa tgagagttca aagaccaccc actctcttgt tagtgttctc actctctctt
25561 ttggtcactg cattttcaaa acctctctat gtacctgagc attgtcagaa ttattctggt
25621 tgcatgctta gggcttgtat taaaactgcc caagctgata cagctggtct ttatacaaat
25681 tttcgaattg acgtcccatc tgcagaatca actggtactc aatcagtttc tgtcgatcgt
25741 gagtcaactt caactcatga tggtcctacc gaacatgtta ctagtgtgaa tctttttgac
25801 gttggttact cagttaatta acgaactcta tggattacgt gtctctgctt aatcaaattt
25861 ggcagaagta ccttaattca ccgtatacta cttgtttgta tatccctaaa cccacagcta
25921 agtatacacc tttagttggc acttcattgc accctgtgct gtggaactgt cagctatcct
25981 ttgctggtta tactgaatct gctgttaatt ctacaaaagc tttggccaaa caggacgcag
26041 ctcagcgaat cgcttggttg ctacataagg atggaggaat ccctgatgga tgttccctct
26101 acctccggca ctcaagttta ttcgcgcaaa gcgaggaaga ggagtcattc tccaactaag
26161 aaactgcgct acgttaagcg tagattttct cttctgcgcc ctgaagacct tagtgttatt
26221 gtccaaccaa cacactatgt cagggttaca ttttcagacc ccaacatgtg gtatctacgt
26281 tcgggtcatc atttacactc agttcacaat tggcttaaac cttatggcgg ccaacctgtt
26341 tctgagtacc atattactct agctttgcta aatctcactg atgaagattt agctagagat
26401 ttttcaccca ttgcgctctt tttgcgcaat gtcagatttg agctacatga gttcgccttg
26461 ctgcgcaaaa ctcttgttct taatgcatca gagatctact gtgctaacat acatagattt
26521 aagcctgtgt atagagttaa cacggcaatc cctactatta aggattggct tctcgttcag
26581 ggattttccc tttaccatag tggcctccct ttacatatgt caatctctaa attgcatgca
26641 ctggatgatg ttactcgcaa ttacatcatt acaatgccat gctttagaac ttatcctcaa
26701 caaatgtttg ttactccttt ggccgtagat gttgtctcca tacggtcttc caatcagggt
26761 aataaacaaa ttgttcattc ttaccccatt ttacatcatc caggatttta acgaactatg
26821 gctttctcgg cgtctttatt taaacccgtc cagctagtcc cagtttctcc tgcatttcat
26881 cgcattgagt ctactgactc tattgttttc acatacattc ctgctagcgg ctatgtagct
26941 gctttagctg tcaatgtgtg tctcattccc ctattattac tgctacgtca agatacttgt
27001 cgtcgcagca ttatcagaac tatggttctc tatttccttg ttctgtataa ctttttatta
27061 gccattgtac tagtcaatgg tgtacattat ccaactggaa gttgcctgat agccttctta
27121 gttatcctca taatactttg gtttgtagat agaattcgtt tctgtctcat gctgaattcc
27181 tacattccac tgtttgacat gcgttctcac tttattcgtg ttagtacagt ttcttctcat
27241 ggtatggtcc ctgtcataca caccaaacca ttatttatta gaaacttcga tcagcgttgc
27301 agctgttctc gttgttttta tttgcactct tccacttata tagagtgcac ttatattagc
27361 cgttttagta agattagcct agtttctgta actgacttct ccttaaacgg caatgtttcc
27421 actgttttcg tgcctgcaac gcgcgattca gttcctcttc acataatcgc cccgagctcg
27481 cttatcgttt aagcagctct gcgctactat gggtcccgtg tagaggctaa tccattagtc
27541 tctctttgga catatggaaa acgaactatg ttaccctttg tccaagaacg aatagggttg
27601 ttcatagtaa actttttcat ttttaccgta gtatgtgcta taacactctt ggtgtgtatg
27661 gctttcctta cggctactag attatgtgtg caatgtatga caggcttcaa taccctgtta
27721 gttcagcccg cattatactt gtataatact ggacgttcag tctatgtaaa attccaggat
27781 agtaaacccc ctctaccacc tgacgagtgg gtttaacgaa ctccttcata atgtctaata
27841 tgacgcaact cactgaggcg cagattattg ccattattaa agactggaac tttgcatggt
27901 ccctgatctt tctcttaatt actatcgtac tacagtatgg atacccatcc cgtagtatga
27961 ctgtctatgt ctttaaaatg tttgttttat ggctcctatg gccatcttcc atggcgctat
28021 caatatttag cgccatttat ccaattgatc tagcttccca gataatctct ggcattgtag
28081 cagctgtttc agctatgatg tggatttcct actttgtgca gagtatccgg ctgtttatga
28141 gaactggatc atggtggtca ttcaatcctg agactaattg ccttttgaac gttccatttg
28201 gtggtacaac tgtcgtacgt ccactcgtag aggactctac cagtgtaact gctgttgtaa
28261 ccaatggcca cctcaaaatg gctggcatgc atttcggtgc ttgtgactac gacagacttc
28321 ctaatgaagt caccgtggcc aaacccaatg tgctgattgc tttaaaaatg gtgaagcggc
28381 aaagctacgg aactaattcc ggcgttgcca tttaccatag atataaggca ggtaattaca
28441 ggagtccgcc tattacggcg gatattgaac ttgcattgct tcgagcttag gctctttagt
28501 aagagtatct taattgattt taacgaatct caatttcatt gttatggcat cccctgctgc
28561 acctcgtgct gtttcctttg ccgataacaa tgatataaca aatacaaacc tgtctcgagg
28621 tagaggacgt aatccaaaac cacgagctgc accaaataac actgtctctt ggtacactgg
28681 gcttacccaa cacgggaaag tccctcttac ctttccacct gggcagggtg tacctcttaa
28741 tgccaattcc acccctgcgc aaaatgctgg gtattggcgg agacaggaca gaaaaattaa
28801 taccgggaat ggaattaagc aactggctcc caggtggtac ttctactaca ctggaactgg
28861 acccgaagca gcactcccat tccgggctgt taaggatggc atcgtttggg tccatgaaga
28921 tggcgccact gatgctcctt caacttttgg gacgcggaac cctaacaatg attcagctat
28981 tgttacacaa ttcgcgcccg gtactaagct tcctaaaaac ttccacattg aggggactgg
29041 aggcaatagt caatcatctt caagagcctc tagcgtaagc agaaactctt ccagatctag
29101 ttcacaaggt tcaagatcag gaaactctac ccgcggcact tctccaggtc catctggaat
29161 cggagcagta ggaggtgatc tactttacct tgatcttctg aacagactac aagcccttga
29221 gtctggcaaa gtaaagcaat cgcagccaaa agtaatcact aagaaggatg ctgctgctgc
29281 taaaaataag atgcgccaca agcgcacttc caccaaaagt ttcaacatgg tgcaagcttt
29341 tggtcttcgc ggaccaggag acctccaggg aaactttggt gatcttcaat tgaataaact
29401 cggcactgag gacccacgtt ggccccaaat tgctgagctt gctcctacag ccagtgcttt
29461 tatgggtatg tcgcaattta aacttaccca tcagaacaat gatgatcatg gcaaccctgt
29521 gtacttcctt cggtacagtg gagccattaa acttgaccca aagaatccca actacaataa
29581 gtggttggag cttcttgagc aaaatattga tgcctacaaa accttcccta agaaggaaaa
29641 gaaacaaaag gcaccaaaag aagaatcaac agaccaaatg tctgaacctc caaaggagca
29701 gcgtgtgcaa ggtagcatca ctcagcgcat tcgcacccgt ccaagtgttc agcctggtcc
29761 aatgattgat gttaacactg attagtgtca ctcaaagtaa caagatcgcg gcaatcgttt
29821 gtgtttggta accccatctc accatcgctt gtccactctt gcacagaatg gaatcatgtt
29881 gtaattacag tgcaataagg taattataac ccatttaatt gatagctatg ctttattaaa
29941 gtgtgtagct gtagagagaa tgttaaagac tgtcacctct gcgtgattgc aagtgaacag
30001 tgccccccgg gaagagctct acagtgtgaa atgtaaataa aaatagctat tattcaatta
30061 gattaggcta attagatgat ttgcaaaaaa aaaaaa

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Thu Jun 04, 2015 7:47 pm 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
LOCUS KR011263 30096 bp RNA linear VRL 27-MAY-2015
DEFINITION Middle East respiratory syndrome coronavirus strain
Hu/Riyadh-KSA-2345/2015, complete genome.
ACCESSION KR011263
VERSION KR011263.1 GI:823104953
KEYWORDS .
SOURCE Middle East respiratory syndrome coronavirus (MERS-CoV)
ORGANISM Middle East respiratory syndrome coronavirus
Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA
stage; Nidovirales; Coronaviridae; Coronavirinae; Betacoronavirus;
unclassified Betacoronavirus.
REFERENCE 1 (bases 1 to 30096)
AUTHORS Lu,X., Saeed,A.A.B. and Erdman,D.D.
TITLE Direct Submission
JOURNAL Submitted (24-MAR-2015) Division of Viral Diseases, Centers for
Disease Control and Prevention, 1600 Clifton Rd., Atlanta, GA
30329, USA
COMMENT ##Assembly-Data-START##
Assembly Method :: Sequencher v. 5.2.4
Sequencing Technology :: Sanger dideoxy sequencing
##Assembly-Data-END##
FEATURES Location/Qualifiers
source 1..30096
/organism="Middle East respiratory syndrome coronavirus"
/mol_type="genomic RNA"
/strain="Hu/Riyadh-KSA-2345/2015"
/isolation_source="respiratory secretions"
/host="Homo sapiens"
/db_xref="taxon:1335626"
/country="Saudi Arabia"
/collection_date="21-Jan-2015"
CDS join(257..13411,13411..21492)
/ribosomal_slippage
/codon_start=1
/product="ORF1ab protein"
/protein_id="AKI29253.1"
/db_xref="GI:823104954"
/translation="MSFVAGVTAQGARGTYRAALNSEKHQDHVSLTVPLCGSGNLVEK
LSPWFIDGENAYEVVKAMLLKKEPLLYVPIRLAGHTRHLPGPRVYLVERLIACENPFM
VNQLAYSSSANGSLVGTTLQGKPIGMFFPYDIELVTGKQNILLRKYGRGGYHYTPFHY
ERDNTSCPEWMDDFEADPKGKYAQNLLKKLIGGDVTPVDQYMCGVDGKPISAYAFLMA
KDGITKLADVEADVAARADDEGFITLKNNLYRLVWHVERKDVPYPKQSIFTINSVVQK
DGVENTPPHYFTLGCKILTLTPRNKWSGVSDLSLKQKLLYTFYGKESLENPTYIYHSA
FIECGSCGNDSWLTGNAIQGFACGCGASYTANDVEVQSSGMIKPNALLCATCPFAKGD
SCSSNCKHSVAQLVSYLSERCNVIADPKSFTLIFGGVAYAYFGCEEGTMYFVPRAKSV
VSRIGDSVFTGCTGSWNKVTQIANMFLEQTQHSLNFVGEFVVNDVVLAILSGTTTNVD
KIRQLLKGVTLDKLRDYLADYDIAVTAGPFMDNAINVGGTGLQYAAITAPYVVLTGLG
ESFKKVATIPYKVCNSVKDTLTYYAHSVLYRVFPYDMDSGVSSFSELLFDCVDLSVAS
TYFLVRLLQDKAGDFMSTIITSCQTAVSKLLDTCFEATEATFNFLLDLAGLFRIFLRN
AYVYTSQGFVVVNGKVSTLVKQVLDLLNKGMQLLHTKVSWAGFNISAVIYSGRESLIF
PSGTYYCVTTKAKSVQQDLDVILPGEFSKKQLGLLQPTDNSTTVSVTVSSNMVETVVG
QLEQTNMHSPDVIVGDYVIISEKLFVRSKEEDGFAFYPACTNGHAVPTLFRLKGGAPV
KKVAFGGDQVHEVAAVRSVTVEYNIHAVLDTLLASSSLRTFVVDKSLSIEEFADVVKE
QVSDLLVKLLRGMPIPDFDLDDFIDAPCYCFNAEGDASWSSTMILSLHPVECDEECSE
VEASDLEEGESECISETSTEQVDVSHEISDDEWAAAVDEAFPLDEAEDVTESVQEEAQ
PVEVPVEDIAQVVIADTLQETPVVSDTVEVPPQVVKLPSEPQTIQPEVKEVAPVYEAD
TEQTQSVTVKPKRLRKKRNVDPLSNFEHKVITECVTIVLGDAIQVAKCYGESVLVNAA
NTHLKHGGGIAGAINAASKGAVQKESDEYILAKGPLQVGDSVLLQGHSLAKNILHVVG
PDARAKQDVSLLSKCYKAMNAYPLVVTPLVSAGIFGVKPAVSFDYLIREAKTRVLVVV
NSQDVYKSLTIVDIPQSLTFSYDGLRGAIRKAKDYGFTVFVCTDNSANTKVLRNKGVD
YTKKFFTVDGVQYYCYTSKDTLDDILQQANKSVGIISMPLGYVSHGLDLIQAGSVVRR
VNVPYVCLLANKEQEAILMSEDVKLNPSEDFIKHVRTNGGYNSWHLVEGELLVQDLRL
NKLLHWSDQTICYKDSVFYVVKNSTAFPFETLSACRAYLDSRTTQQLTIEVLVTVDGV
NFRTVVLNNKNTYRSQLGCVFFNGADISDTIPDEKQNGHSLYLADNLTADETKALKEL
YGPVDPTFLHRFYSLKAAVHKWKMVVCDKVRSLKLSDNNCYLNAVIMTLDLLKDIKFV
IPALQHAFMKHKGGDSTDFIALIMAYGNCTFGAPDDASRLLHTVLAKAELCCSARMVW
REWCNVCGIKDVVLQGLKACCYVGVQTVEDLRARMTYVCQCGGERHRQIVEHTTPWLL
LSGTPNEKLVTTSTAPDFVAFNVFQGIETAVGHYVHARLKGGLILKFDSGTVSKTSDW
KCKVTDVLFSGQKYSSDCNVVRYSLDGNFRTEVDPDLSAFYVKDGKYFTSEPPVTYSP
ATILAGSVYTNSCLVSSDGQPGGDAISLSFNNLLGFDSSKPVAKKYTYSFLPKEDGDV
LLAEFDTYDPIYKNGAMYKGKPILWVNKASYDTNLNKFNRASLRQIFDVAPIELENKF
TPLSVESTPVEPPTVDVVALQQEMTIVKCKGLNKPFVKDNVSFVADDSGTPVVEYLSK
EDLHTLYVDPKYQVIVLKDNVLSSMLRLHTVESGDINVVAASGSLTRKVKLLFRASFY
FKEFATRTFTATTAVGSCIKSVVRHLGVTKGILTGCFSFVKMLFMLPLAYFSDSKLGT
TEVKVSALKTAGVVTGNVVKQCCTAAVDLSMDKLRRVDWKSTLRLLLMLCTTMVLLSS
VYHLYVFNQVLSSDVMFEDAQGLKKFYKEVRAYLGISSACDGLASAYRANSFDVPTFC
ANRSAMCNWCLISQDSITHYPALKMVQTHLSHYVLNIDWLWFAFETGLAYMLYTSAFN
WLLLAGTLHYFFAQTSIFVDWRSYNYAVSSAFWLFTHIPMAGLVRMYNLLACLWLLRK
FYQHVINGCKDTACLLCYKRNRLTRVEASTVVCGGKRTFYITANGGISFCRRHNWNCV
DCDTAGVGNTFICEEVANDFTTALRRPINATDRSHYYVDSVTVKETVVQFNYRRDGQP
FYERFPLCAFTNLDKLKFKEVCKTTTGIPEYNFIIYDSSDRGQESLARSACVYYSQVL
CKSILLVDSSLVTSVGDSSEIATKMFDSFVNSFVSLYNVTRDKLEKLISTARDGVRRG
DNFHSVLTTFIDAARGPAGVESDVETNEIVDSVQYAHKHDIQITNESYNNYVPSYVKP
DSVSTSDLGSLIDCNAASVNQIVLRNSNGACIWNAAAYMKLSDALKRQIRIACRKCNL
AFRLTTSKLRANDNILSVRFTANKIVGGAPTWFNALRDFTLKGYVLATIIVFLCAVLM
YLCLPTFSMVPVEFYEDRILDFKVLDNGIIRDVNPDDKCFANKHRSFTQWYHEHVGGV
YDNSITCPLTVAVIAGVAGARIPDVPTTLAWLNNQIIFFVSRVFANTGSVCYTPIDEI
PYKSFSDSGCILPSECTMFRDAEGRMTPYCHDPTVLPGAFAYSQMRPHVRYDLYDGNM
FIKFPEVVFESTLRITRTLSTQYCRFGSCEYAQEGVCITTNGSWAIFNDHHLNRPGVY
CGSDFIDIVRRLAVSLFQPITYFQLTTSLVLGIGLCAFLTLLFYYINKVKRAFADYTQ
CAVIAVVAAVLNSLCICFVASIPLCIVPYTALYYYATFYFTNEPAFIMHVSWYIMFGP
IVPIWMTCVYTVAMCFRHFFWVLAYFSKKHVEVFTDGKLNCSFQDAASNIFVINKDTY
AALRNSLTNDAYSRFLGLFNKYKYFSGAMETAAYREAAACHLAKALQTYSETGSDLLY
QPPNCSITSGVLQSGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCP
ADQLSDPNYDALLISMTNHSFSVQKHIGAPANLRVVGHAMQGTLLKLTVDVANPSTPA
YTFTTVKPGAAFSVLACYNGRPTGTFTVVMRPNYTIKGSFLCGSCGSVGYTKEGSVIN
FCYMHQMELANGTHTGSAFDGTMYGAFMDKQVHQVQLTDKYCSVNVVAWLYAAILNGC
AWFVKPNRTSVVSFNEWALANQFTEFVGTQSVDMLAVKTGVAIEQLLYAIQQLYTGFQ
GKQILGSTMLEDEFTPEDVNMQIMGVVMQSGVRKVTYGTAHWLFATLVSTYVIILQAT
KFTLWNYLFETIPTQLFPLLFVTMAFVMLLVKHKHTFLTLFLLPVAICLTYANIVYEP
TTPISSALIAVANWLAPTNAYMRTTHTDIGVYISMSLVLVIVVKRLYNPSLSNFALAL
CSGVMWLYTYSIGEASSPIAYLVFVTTLTSDYTITVFVTVNLAKVCTYAIFAYSPQLT
LVFPEVKMILLLYTCLGFMCTCYFGVFSLLNLKLRAPMGVYDFKVSTQEFRFMTANNL
TAPRNSWEAMALNFKLIGIGGTPCIKVAAMQSKLTDLKCTSVVLLSVLQQLHLEANSR
AWAFCVKCHNDILAATDPSEAFEKFVSLFATLMTFSGNVDLDALASDIFDTPSVLQAT
LSEFSHLATFAELEAAQKAYQEAMDSGDTSPQVLKALQKAVNIAKNAYEKDKAVARKL
ERMADQAMTSMYKQARAEDKKAKIVSAMQTMLFGMIKKLDNDVLNGIISNARNGCIPL
SVIPLCASNKLRVVIPDFTVWNQVVTYPSLNYAGALWDITVINNVDNEIVKSSDVVDS
NENLTWPLVLECTRASTSAVKLQNNEIKPSGLKTMVVSAGQEQTNCNTSSLAYYEPVQ
GRKMLMALLSDNAYLKWARVEGKDGFVSVELQPPCKFLIAGPKGPEIRYLYFVKNLNN
LHRGQVLGHIAATVRLQAGSNTEFASNSSVLSLVNFTVDPQKAYLDFVNAGGAPLTNC
VKMLTPKTGTGIAISVKPESTADQETYGGASVCLYCRAHIEHPDVSGVCKYKGKFVQI
PAQCVRDPVGFCLSNTPCNVCQYWIGYGCNCDSLRQATLPQSKDSNFLNRVRGSIVNA
RIEPCSSGLSTDVVFRAFDICNYKAKVAGIGKYYKTNTCRFVELDDQGHHLDSYFVVK
RHTMENYELEKHCYDLLRDCDAVAPHDFFIFDVDKVKTPHIVRQRLTEYTMMDLVYAL
RHFDQNSEVLKAILVKYGCCDVTYFENKLWFDFVENPSVIGVYHKLGERVRQAILNTV
KFCDHMVKAGLVGVLTLDNQDLNGKWYDFGDFVITQPGSGVAIVDSYYSYLMPVLSMT
DCLAAETHRDCDFNKPLIEWPLTEYDFTDYKVQLFEKYFKYWDQTYHANCVNCTDDRC
VLHCANFNVLFAMTMPKTCFGPIVRKIFVDGVPFVVSCGYHYKELGLVMNMDVSLHRH
RLSLKELMMYAADPAMHIASSNAFLDLRTSCFSVAALTTGLTFQTVRPGNFNQDFYDF
VVSKGFFKEGSSVTLKHFFFAQDGNAAITDYNYYSYNLPTMCDIKQMLFCMEVVNKYF
EIYDGGCLNASEVVVNNLDKSAGHPFNKFGKARVYYESMSYQEQDELFAMTKRNVIPT
MTQMNLKYAISAKNRARTVAGVSILSTMTNRQYHQKMLKSMAATRGATCVIGTTKFYG
GWDFMLKTLYKDVDNPHLMGWDYPKCDRAMPNMCRIFASLILARKHATCCTTRDRFYR
LANECAQVLSEYVLCGGGYYVKPGGTSSGDATTAYANSVFNILQATTANVSALMGANG
NKIVDKEVKDMQFDLYVNVYRSTSPDPKFVDKYYAFLNKHFSMMILSDDGVVCYNSDY
AAKGYIAGIQNFKETLYYQNNVFMSEAKCWVETDLKKGPHEFCSQHTLYIKDGDDGYF
LPYPDPSRILSAGCFVDDIVKTDGTLMVERFVSLAIDAYPLTKHEDIEYQNVFWVYLQ
YIEKLYKDLTGHMLDSYSVMLCGDNSAKFWEEAFYRDLYSSPTTLQAVGSCVVCHSQT
SLRCGTCIRRPFLCCKCCYDHVIATPHKMVLSVSPYVCNAPGCGVSDVTKLYLGGMSY
FCVDHRPVCSFPLCANGLVFGLYKNMCTGSPSIVEFNRLATCDWTESGDYTLANTTTE
PLKLFAAETLRATEEASKQSYAIATIKEIVGERQLLLVWEAGKSKPPLNRNYVFTGYH
ITKNSKVQLGEYIFERIDYSDAVSYKSSTTYKLTVGDIFVLTSHSVATLTAPTIVNQE
RYVKITGLYPTITVPEEFASHVANFQKSGYSKYVTVQGPPGTGKSHFAIGLAIYYPTA
RVVYTACSHAAVDALCEKAFKYLNIAKCSRIIPAKARVECYDRFKVNETNSQYLFSTI
NALPETSADILVVDEVSMCTNYDLSIINARIKAKHIVYVGDPAQLPAPRTLLTRGTLE
PENFNSVTRLMCNLGPDIFLSMCYRCPKEIVSTVSALVYNNKLLAKKELSGQCFKILY
KGNVTHDASSAINRPQLTFVKNFITANPAWSKAVFISPYNSQNAVARSMLGLTTQTVD
SSQGSEYQYVIFCQTADTAHANNINRFNVAITRAQKGILCVMTSQALFESLEFTELSF
TNYKLQSQIVTGLFKDCSRETSGLSPAYAPTYVSVDDKYKTSDELCVNLNLPANVPYS
RVISRMGFKLDATVPGYPKLFITREEAVRQVRSWIGFDVEGAHASRNACGTNVPLQLG
FSTGVNFVVQPVGVVDTEWGNMLTGIAARPPPGEQFKHLVPLMHKGAAWPIVRRRIVQ
MLSDTLDKLSDYCTFVCWAHGFELTSASYFCKIGKEQKCCMCNRRAAAYSSPLQSYAC
WTHSCGYDYVYNPFFVDVQQWGYVGNLATNHDRYCSVHQGAHVASNDAIMTRCLAIHS
CFIERVDWDIEYPYISHEKKLNSCCRIVERNVVRAALLAGSFDKVYDIGNPKGIPIVD
DPVVDWHYFDAQPLTRKVQQLFYTEDMASRFADGLCLFWNCNVPKYPNNAIVCRFDTR
VHSEFNLPGCDGGSLYVNKHAFHTPAYDVSAFRDLKPLPFFYYSTTPCEVHGNGSMIE
DIDYVPLKSAVCITACNLGGAVCRKHATEYREYMEAYNLVSASGFRLWCYKTFDIYNL
WSTFTKVQGLENIAFNFVKQGHFIGVEGELPVAVVNDKIFTKSGVNDICMFENKTTLP
TNIAFELYAKRAVRSHPDFKLLHNLQADICYKFVLWDYERSNIYGTATIGVCKYTDID
VNSALNICFDIRDNGSLEKFMSTPNAIFISDRKIKKYPCMVGPDYAYFNGAIIRDSDV
VKQPVKFYLYKKVNNEFIDPTECIYTQSRSCSDFLPLSDMEKDFLSFDSDVFIKKYGL
ENYAFEHVVYGDFSHTTLGGLHLLIGLYKKQQEGHIIMEEMLKGSSTIHNYFITETNT
AAFKAVCSVIDLKLDDFVMILKSQDLGVVSKVVKVPIDLTMIEFMLWCKDGQVQTFYP
RLQASADWKPGHAMPSLFKVQNVNLERCELANYKQSIPMPRGVHMNIAKYMQLCQYLN
TCTLAVPANMRVIHFGAGSDKGIAPGTSVLRQWLPTDAIIIDNDLNEFVSDADITLFG
DCVTVRVGQQVDLVISDMYDPTTKNVTGSNESKALFFTYLCNLINNNLALGGSVAIKI
TEHSWSVELYELMGKFAWWTVFCTNANASSSEGFLLGINYLGTIKENIDGGAMHANYI
FWRNSTPMNLSTYSLFDLSKFQLKLKGTPVLQLKESQINELVISLLSQGKLLIRDNDT
LSVSTDVLVNTYRKLR"
CDS 257..13432
/codon_start=1
/product="ORF1a protein"
/protein_id="AKI29254.1"
/db_xref="GI:823104955"
/translation="MSFVAGVTAQGARGTYRAALNSEKHQDHVSLTVPLCGSGNLVEK
LSPWFIDGENAYEVVKAMLLKKEPLLYVPIRLAGHTRHLPGPRVYLVERLIACENPFM
VNQLAYSSSANGSLVGTTLQGKPIGMFFPYDIELVTGKQNILLRKYGRGGYHYTPFHY
ERDNTSCPEWMDDFEADPKGKYAQNLLKKLIGGDVTPVDQYMCGVDGKPISAYAFLMA
KDGITKLADVEADVAARADDEGFITLKNNLYRLVWHVERKDVPYPKQSIFTINSVVQK
DGVENTPPHYFTLGCKILTLTPRNKWSGVSDLSLKQKLLYTFYGKESLENPTYIYHSA
FIECGSCGNDSWLTGNAIQGFACGCGASYTANDVEVQSSGMIKPNALLCATCPFAKGD
SCSSNCKHSVAQLVSYLSERCNVIADPKSFTLIFGGVAYAYFGCEEGTMYFVPRAKSV
VSRIGDSVFTGCTGSWNKVTQIANMFLEQTQHSLNFVGEFVVNDVVLAILSGTTTNVD
KIRQLLKGVTLDKLRDYLADYDIAVTAGPFMDNAINVGGTGLQYAAITAPYVVLTGLG
ESFKKVATIPYKVCNSVKDTLTYYAHSVLYRVFPYDMDSGVSSFSELLFDCVDLSVAS
TYFLVRLLQDKAGDFMSTIITSCQTAVSKLLDTCFEATEATFNFLLDLAGLFRIFLRN
AYVYTSQGFVVVNGKVSTLVKQVLDLLNKGMQLLHTKVSWAGFNISAVIYSGRESLIF
PSGTYYCVTTKAKSVQQDLDVILPGEFSKKQLGLLQPTDNSTTVSVTVSSNMVETVVG
QLEQTNMHSPDVIVGDYVIISEKLFVRSKEEDGFAFYPACTNGHAVPTLFRLKGGAPV
KKVAFGGDQVHEVAAVRSVTVEYNIHAVLDTLLASSSLRTFVVDKSLSIEEFADVVKE
QVSDLLVKLLRGMPIPDFDLDDFIDAPCYCFNAEGDASWSSTMILSLHPVECDEECSE
VEASDLEEGESECISETSTEQVDVSHEISDDEWAAAVDEAFPLDEAEDVTESVQEEAQ
PVEVPVEDIAQVVIADTLQETPVVSDTVEVPPQVVKLPSEPQTIQPEVKEVAPVYEAD
TEQTQSVTVKPKRLRKKRNVDPLSNFEHKVITECVTIVLGDAIQVAKCYGESVLVNAA
NTHLKHGGGIAGAINAASKGAVQKESDEYILAKGPLQVGDSVLLQGHSLAKNILHVVG
PDARAKQDVSLLSKCYKAMNAYPLVVTPLVSAGIFGVKPAVSFDYLIREAKTRVLVVV
NSQDVYKSLTIVDIPQSLTFSYDGLRGAIRKAKDYGFTVFVCTDNSANTKVLRNKGVD
YTKKFFTVDGVQYYCYTSKDTLDDILQQANKSVGIISMPLGYVSHGLDLIQAGSVVRR
VNVPYVCLLANKEQEAILMSEDVKLNPSEDFIKHVRTNGGYNSWHLVEGELLVQDLRL
NKLLHWSDQTICYKDSVFYVVKNSTAFPFETLSACRAYLDSRTTQQLTIEVLVTVDGV
NFRTVVLNNKNTYRSQLGCVFFNGADISDTIPDEKQNGHSLYLADNLTADETKALKEL
YGPVDPTFLHRFYSLKAAVHKWKMVVCDKVRSLKLSDNNCYLNAVIMTLDLLKDIKFV
IPALQHAFMKHKGGDSTDFIALIMAYGNCTFGAPDDASRLLHTVLAKAELCCSARMVW
REWCNVCGIKDVVLQGLKACCYVGVQTVEDLRARMTYVCQCGGERHRQIVEHTTPWLL
LSGTPNEKLVTTSTAPDFVAFNVFQGIETAVGHYVHARLKGGLILKFDSGTVSKTSDW
KCKVTDVLFSGQKYSSDCNVVRYSLDGNFRTEVDPDLSAFYVKDGKYFTSEPPVTYSP
ATILAGSVYTNSCLVSSDGQPGGDAISLSFNNLLGFDSSKPVAKKYTYSFLPKEDGDV
LLAEFDTYDPIYKNGAMYKGKPILWVNKASYDTNLNKFNRASLRQIFDVAPIELENKF
TPLSVESTPVEPPTVDVVALQQEMTIVKCKGLNKPFVKDNVSFVADDSGTPVVEYLSK
EDLHTLYVDPKYQVIVLKDNVLSSMLRLHTVESGDINVVAASGSLTRKVKLLFRASFY
FKEFATRTFTATTAVGSCIKSVVRHLGVTKGILTGCFSFVKMLFMLPLAYFSDSKLGT
TEVKVSALKTAGVVTGNVVKQCCTAAVDLSMDKLRRVDWKSTLRLLLMLCTTMVLLSS
VYHLYVFNQVLSSDVMFEDAQGLKKFYKEVRAYLGISSACDGLASAYRANSFDVPTFC
ANRSAMCNWCLISQDSITHYPALKMVQTHLSHYVLNIDWLWFAFETGLAYMLYTSAFN
WLLLAGTLHYFFAQTSIFVDWRSYNYAVSSAFWLFTHIPMAGLVRMYNLLACLWLLRK
FYQHVINGCKDTACLLCYKRNRLTRVEASTVVCGGKRTFYITANGGISFCRRHNWNCV
DCDTAGVGNTFICEEVANDFTTALRRPINATDRSHYYVDSVTVKETVVQFNYRRDGQP
FYERFPLCAFTNLDKLKFKEVCKTTTGIPEYNFIIYDSSDRGQESLARSACVYYSQVL
CKSILLVDSSLVTSVGDSSEIATKMFDSFVNSFVSLYNVTRDKLEKLISTARDGVRRG
DNFHSVLTTFIDAARGPAGVESDVETNEIVDSVQYAHKHDIQITNESYNNYVPSYVKP
DSVSTSDLGSLIDCNAASVNQIVLRNSNGACIWNAAAYMKLSDALKRQIRIACRKCNL
AFRLTTSKLRANDNILSVRFTANKIVGGAPTWFNALRDFTLKGYVLATIIVFLCAVLM
YLCLPTFSMVPVEFYEDRILDFKVLDNGIIRDVNPDDKCFANKHRSFTQWYHEHVGGV
YDNSITCPLTVAVIAGVAGARIPDVPTTLAWLNNQIIFFVSRVFANTGSVCYTPIDEI
PYKSFSDSGCILPSECTMFRDAEGRMTPYCHDPTVLPGAFAYSQMRPHVRYDLYDGNM
FIKFPEVVFESTLRITRTLSTQYCRFGSCEYAQEGVCITTNGSWAIFNDHHLNRPGVY
CGSDFIDIVRRLAVSLFQPITYFQLTTSLVLGIGLCAFLTLLFYYINKVKRAFADYTQ
CAVIAVVAAVLNSLCICFVASIPLCIVPYTALYYYATFYFTNEPAFIMHVSWYIMFGP
IVPIWMTCVYTVAMCFRHFFWVLAYFSKKHVEVFTDGKLNCSFQDAASNIFVINKDTY
AALRNSLTNDAYSRFLGLFNKYKYFSGAMETAAYREAAACHLAKALQTYSETGSDLLY
QPPNCSITSGVLQSGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCP
ADQLSDPNYDALLISMTNHSFSVQKHIGAPANLRVVGHAMQGTLLKLTVDVANPSTPA
YTFTTVKPGAAFSVLACYNGRPTGTFTVVMRPNYTIKGSFLCGSCGSVGYTKEGSVIN
FCYMHQMELANGTHTGSAFDGTMYGAFMDKQVHQVQLTDKYCSVNVVAWLYAAILNGC
AWFVKPNRTSVVSFNEWALANQFTEFVGTQSVDMLAVKTGVAIEQLLYAIQQLYTGFQ
GKQILGSTMLEDEFTPEDVNMQIMGVVMQSGVRKVTYGTAHWLFATLVSTYVIILQAT
KFTLWNYLFETIPTQLFPLLFVTMAFVMLLVKHKHTFLTLFLLPVAICLTYANIVYEP
TTPISSALIAVANWLAPTNAYMRTTHTDIGVYISMSLVLVIVVKRLYNPSLSNFALAL
CSGVMWLYTYSIGEASSPIAYLVFVTTLTSDYTITVFVTVNLAKVCTYAIFAYSPQLT
LVFPEVKMILLLYTCLGFMCTCYFGVFSLLNLKLRAPMGVYDFKVSTQEFRFMTANNL
TAPRNSWEAMALNFKLIGIGGTPCIKVAAMQSKLTDLKCTSVVLLSVLQQLHLEANSR
AWAFCVKCHNDILAATDPSEAFEKFVSLFATLMTFSGNVDLDALASDIFDTPSVLQAT
LSEFSHLATFAELEAAQKAYQEAMDSGDTSPQVLKALQKAVNIAKNAYEKDKAVARKL
ERMADQAMTSMYKQARAEDKKAKIVSAMQTMLFGMIKKLDNDVLNGIISNARNGCIPL
SVIPLCASNKLRVVIPDFTVWNQVVTYPSLNYAGALWDITVINNVDNEIVKSSDVVDS
NENLTWPLVLECTRASTSAVKLQNNEIKPSGLKTMVVSAGQEQTNCNTSSLAYYEPVQ
GRKMLMALLSDNAYLKWARVEGKDGFVSVELQPPCKFLIAGPKGPEIRYLYFVKNLNN
LHRGQVLGHIAATVRLQAGSNTEFASNSSVLSLVNFTVDPQKAYLDFVNAGGAPLTNC
VKMLTPKTGTGIAISVKPESTADQETYGGASVCLYCRAHIEHPDVSGVCKYKGKFVQI
PAQCVRDPVGFCLSNTPCNVCQYWIGYGCNCDSLRQATLPQSKDSNFLNESGVLL"
CDS 21434..25495
/codon_start=1
/product="S protein"
/protein_id="AKI29255.1"
/db_xref="GI:823104956"
/translation="MIHSVFLLMFLLTPTESYVDVGPDSVKSACIEVDIQQTFFDKTW
PRPIDVSKADGIIYPQGRTYSNITITYQGLFPYQGDHGDMYVYSAGHATGTTPQKLFV
ANYSQDVKQFANGFVVRIGAAANSTGTVIISPSTSATIRKIYPAFMLGSSVGNFSDGK
MGRFFNHTLVLLPDGCGTLLRAFYCILEPRSGNHCPAGNSYTSFATYHTPATDCSDGN
YNRNASLNSFKEYFNLRNCTFMYTYNITEDEILEWFGITQTAQGVHLFSSRYVDLYGG
NMFQFATLPVYDTIKYYSIIPHSIRSIQSDRKAWAAFYVYKLQPLTFLLDFSVDGYIR
RAIDCGFNDLSQLHCSYESFDVESGVYSVSSFEAKPSGSVVEQAEGVECDFSPLLSGT
PPQVYNFKRLVFTNCNYNLTKLLSLFSVNDFTCSQISPAAIASNCYSSLILDYFSYPL
SMKSDLSVSSAGPISQFNYKQSFSNPTCLILATVPHNLTTITKPLKYSYINKCSRLLS
DDRTEVPQLVNANQYSPCVSIVPSTVWEDGDYYRKQLSPLEGGGWLVASGSTVAMTEQ
LQMGFGITVQYGTDTNSVCPKLEFANDTKIASQLGNCVEYSLYGVSGRGVFQNCTAVG
VRQQRFVYDAYQNLVGYYSDDGNYYCLRACVSVPVSVIYDKETKTHATLFGSVACEHI
SSTMSQYSRSTRSMLKRRDSTYGPLQTPVGCVLGLVNSSLFVEDCKLPLGQSLCALPD
TPSTLTPRSVRSVPGEMRLASIAFNHPIQVDQLNSSYFKLSIPTNFSFGVTQEYIQTT
IQKVTVDCKQYVCNGFQKCEQLLREYGQFCSKINQALHGANLRQDDSVRNLFASVKSS
QSSPIIPGFGGDFNLTLLEPVSISTGSRSARSAIEDLLFDKVTIADPGYMQGYDDCMQ
QGPASARDLICAQYVAGYKVLPPLMDVNMEAAYTSSLLGSIAGVGWTAGLSSFAAIPF
AQSIFYRLNGVGITQQVLSENQKLIANKFNQALGAMQTGFTTTNEAFRKVQDAVNNNA
QALSKLASELSNTFGAISASIGDIIQRLDVLEQDAQIDRLINGRLTTLNAFVAQQLVR
SESAALSAQLAKDKVNECVKAQSKRSGFCGQGTHIVSFVVNAPNGLYFMHVGYYPSNH
IEVVSAYGLCDAANPTNCIAPVNGYFIKTNNTRIVDEWSYTGSSFYAPEPITSLNTKY
VAPQVTYQNISTNLPPPLLGNSTGIDFQDELDEFFKNVSTSIPNFGSLTQINTTLLDL
TYEMLSLQQVVKALNESYIDLKELGNYTYYNKWPWYIWLGFIAGLVALALCAFFILCC
TGCGTNCMGKLKCNRCCDRYEEYDLEPHKVHVH"
CDS 25510..25821
/codon_start=1
/product="NS3A protein"
/protein_id="AKI29256.1"
/db_xref="GI:823104957"
/translation="MRVQRPPTLLLVFSLSLLVTAFSKPLYVPEHCQNYSGCMLRACI
KTAQADTAGLYTNFRIDVPSAESTGTQSVSVDRESTSTHDGPTEHVTSVNLFDVGYSV
N"
CDS 25830..26159
/codon_start=1
/product="NS3B protein"
/protein_id="AKI29257.1"
/db_xref="GI:823104958"
/translation="MDYVSLLNQIWQKYLNSPYTTCLYIPKPTAKYTPLVGTSLHPVL
WNCQLSFAGYTESAVNSTKALAKQDAAQRIAWLLHKDGGIPDGCSLYLRHSSLFAQSE
EEESFSN"
CDS 26071..26811
/codon_start=1
/product="NS3C protein"
/protein_id="AKI29258.1"
/db_xref="GI:823104959"
/translation="MEESLMDVPSTSGTQVYSRKARKRSHSPTKKLRYVKRRFSLLRP
EDLSVIVQPTHYVRVTFSDPNMWYLRSGHHLHSVHNWLKPYGGQPVSEYHITLALLNL
TDEDLARDFSPIALFLRNVRFELHEFALLRKTLVLNASEIYCANIHRFKPVYRVNTAI
PTIKDWLLVQGFSLYHSGLPLHMSISKLHALDDVTRNYIITMPCFRTYPQQMFVTPLA
VDVVSIRSSNQGNKQIVHSYPILHHPGF"
CDS 26818..27492
/codon_start=1
/product="NS3D protein"
/protein_id="AKI29259.1"
/db_xref="GI:823104960"
/translation="MAFSASLFKPVQLVPVSPAFHRIESTDSIVFTYIPASGYVAALA
VNVCLIPLLLLLRQDTCRRSIIRTMVLYFLVLYNFLLAIVLVNGVHYPTGSCLIAFLV
ILIILWFVDRIRFCLMLNSYIPLFDMRSHFIRVSTVSSHGMVPVIHTKPLFIRNFDQR
CSCSRCFYLHSSTYIECTYISRFSKISLVSVTDFSLNGNVSTVFVPATRDSVPLHIIA
PSSLIV"
CDS 27568..27816
/codon_start=1
/product="E protein"
/protein_id="AKI29260.1"
/db_xref="GI:823104961"
/translation="MLPFVQERIGLFIVNFFIFTVVCAITLLVCMAFLTATRLCVQCM
TGFNTLLVQPALYLYNTGRSVYVKFQDSKPPLPPDEWV"
CDS 27831..28490
/codon_start=1
/product="M protein"
/protein_id="AKI29261.1"
/db_xref="GI:823104962"
/translation="MSNMTQLTEAQIIAIIKDWNFAWSLIFLLITIVLQYGYPSRSMT
VYVFKMFVLWLLWPSSMALSIFSAIYPIDLASQIISGIVAAVSAMMWISYFVQSIRLF
MRTGSWWSFNPETNCLLNVPFGGTTVVRPLVEDSTSVTAVVTNGHLKMAGMHFGACDY
DRLPNEVTVAKPNVLIALKMVKRQSYGTNSGVAIYHRYKAGNYRSPPITADIELALLR
A"
CDS 28544..29785
/codon_start=1
/product="N protein"
/protein_id="AKI29262.1"
/db_xref="GI:823104963"
/translation="MASPAAPRAVSFADNNDITNTNLSRGRGRNPKPRAAPNNTVSWY
TGLTQHGKVPLTFPPGQGVPLNANSTPAQNAGYWRRQDRKINTGNGIKQLAPRWYFYY
TGTGPEAALPFRAVKDGIVWVHEDGATDAPSTFGTRNPNNDSAIVTQFAPGTKLPKNF
HIEGTGGNSQSSSRASSVSRNSSRSSSQGSRSGNSTRGTSPGPSGIGAVGGDLLYLDL
LNRLQALESGKVKQSQPKVITKKDAAAAKNKMRHKRTSTKSFNMVQAFGLRGPGDLQG
NFGDLQLNKLGTEDPRWPQIAELAPTASAFMGMSQFKLTHQNNDDHGNPVYFLRYSGA
IKLDPKNPNYNKWLELLEQNIDAYKTFPKKEKKQKAPKEESTDQMSEPPKEQRVQGSI
TQRIRTRPSVQPGPMIDVNTD"

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Thu Jun 04, 2015 7:48 pm 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
1 atctcacttc ccctcgttct cttgcagaac tttgatttta acgaacttaa ataaaagccc
61 tgttgtttag cgtattgttg cacttgtctg gtgggattgt ggcattaatt tgcctgctca
121 tctaggcagt ggacatatgc tcaacactgg gtataattct aattgaatac tatttttcag
181 ttagagcgtc gtgtctcttg tacgtctcgg tcacaataca cggtttcgtc cggtgcgtgg
241 caattcgggg cacatcatgt ctttcgtggc tggtgtgacc gcgcaaggtg cgcgcggtac
301 gtatcgagca gcgctcaact ctgaaaaaca tcaagaccat gtgtctctaa ctgtgccact
361 ctgtggttca ggaaacctgg ttgaaaaact ttcaccatgg ttcattgatg gcgaaaatgc
421 ctatgaagtg gtgaaggcca tgttacttaa aaaggagcca cttctctatg tgcccatccg
481 gctggctgga cacactagac acctcccagg tcctcgtgta tacctggttg agaggctcat
541 tgcttgtgaa aatccattca tggttaacca attggcttat agctctagtg caaatggcag
601 cttggttggc acaactttgc agggcaagcc tattggtatg ttcttccctt atgacatcga
661 acttgtcaca ggaaagcaaa atattctcct gcgcaagtat ggccgtggtg gttatcacta
721 caccccattc cactatgagc gagacaacac ctcttgccct gagtggatgg acgattttga
781 ggcggatcct aaaggcaaat atgcccagaa tctgcttaag aagttgattg gcggtgatgt
841 cactccagtt gaccaataca tgtgtggcgt tgatggaaaa cccattagtg cctacgcatt
901 tttaatggcc aaggatggaa taaccaaact ggctgatgtt gaagcggacg tcgcagcacg
961 tgctgatgac gaaggcttca tcacattaaa gaacaatcta tatagattgg tttggcatgt
1021 tgagcgtaaa gacgttccat atcctaagca atctattttt actattaata gtgtggtcca
1081 aaaggatggt gttgaaaaca ctcctcctca ctattttact cttggatgca aaattttaac
1141 gctcacccca cgcaacaagt ggagtggcgt ttctgacttg tccctcaaac aaaaactcct
1201 ttacaccttc tatggtaagg agtcacttga gaacccaacc tacatttacc actccgcatt
1261 cattgagtgt ggaagttgtg gtaatgattc ctggcttaca gggaatgcta tccaagggtt
1321 tgcctgtgga tgtggggcat catatacagc taatgatgtc gaagtccaat catctggcat
1381 gattaagcca aatgctcttc tttgtgctac ttgccccttt gctaagggtg atagctgttc
1441 ttctaattgc aaacattcag ttgctcagtt ggttagttac ctttctgaac gttgtaatgt
1501 tattgctgat cctaagtcct tcacacttat ctttggtggc gtagcttacg cctactttgg
1561 atgtgaggaa ggtactatgt actttgtgcc tagagctaag tctgttgtct caaggattgg
1621 agactccgtc tttacaggct gtactggctc ttggaacaag gttactcaaa ttgctaacat
1681 gttcttggaa cagactcagc attcccttaa ctttgtggga gagttcgttg tcaacgatgt
1741 tgtcctcgca attctctctg gaaccacaac taatgttgac aaaatacgcc agcttctcaa
1801 gggtgtcacc cttgacaagt tgcgtgatta tttagctgac tatgacatag cagtcactgc
1861 cggcccattc atggataatg ctattaatgt tggtggtaca ggattacagt atgccgccat
1921 tactgcacct tatgtagttc tcactggctt aggtgagtcc tttaagaaag ttgcaaccat
1981 accgtacaag gtttgcaact ctgttaagga tactctgact tattatgctc acagcgtgtt
2041 gtacagagtt tttccttatg acatggattc tggtgtgtca tcttttagtg aactactttt
2101 tgattgcgtt gatctttcag tagcttctac ctatttttta gtccgcctct tgcaagataa
2161 ggctggcgac tttatgtcta caattattac ttcctgccaa actgctgtta gtaagcttct
2221 agatacatgt tttgaagcta cagaagcaac atttaacttc ttgttagatt tggcaggatt
2281 gttcagaatc tttcttcgca atgcctatgt gtacacttca caagggtttg tggtggtcaa
2341 tggcaaagtt tctacacttg tcaaacaagt gttagacttg cttaataagg gtatgcaact
2401 tttgcataca aaggtctcct gggctggttt taatatcagt gctgttatct acagcggcag
2461 ggagtctcta atattcccat cgggaaccta ttactgtgtc accactaagg ctaagtccgt
2521 tcaacaagat cttgacgtta ttttgcctgg tgagttttcc aagaagcagt taggactgct
2581 ccaacctact gacaattcta caactgttag tgttactgta tccagtaaca tggttgaaac
2641 tgttgtgggt caacttgagc aaactaatat gcatagtcct gatgttatag taggtgacta
2701 tgtcattatt agtgaaaaat tgtttgtgcg tagtaaggaa gaagacggat ttgccttcta
2761 ccctgcttgc actaatggtc atgctgtacc gactctcttt agacttaagg gaggtgcacc
2821 tgtaaaaaaa gtagcctttg gcggtgatca agtacatgag gttgctgctg taagaagtgt
2881 tactgtcgag tacaacattc atgctgtatt agacacacta cttgcttctt ctagtcttag
2941 aacctttgtt gtagataagt ctttgtcaat tgaggagttt gctgacgtag taaaggaaca
3001 agtctcagac ttgcttgtta aattactgcg tggaatgccg attccagatt ttgatttaga
3061 cgattttatt gacgcaccat gctattgctt taacgctgag ggtgatgcat cttggtcttc
3121 tactatgatc ctctctcttc accccgtcga gtgtgacgag gagtgttctg aagtagaggc
3181 ttcagattta gaagaaggtg aatcagagtg catttctgag acttcaactg aacaagttga
3241 cgtttctcat gagatttctg acgacgagtg ggctgctgca gttgatgaag cgttccctct
3301 cgatgaagca gaagatgtta ctgaatctgt gcaagaagaa gcacaaccag tagaagtacc
3361 tgttgaagat attgcgcagg ttgtcatagc tgacacctta caggaaactc ctgttgtgtc
3421 tgatactgtt gaagtcccac cgcaagtggt gaaacttccg tctgaacctc agactatcca
3481 gcccgaggta aaagaagttg cacctgtcta tgaggctgat accgaacaga cacagagtgt
3541 tactgttaaa cctaagaggt tacgcaaaaa gcgtaatgtt gaccctttgt ccaattttga
3601 acataaggtt attacagagt gcgttaccat agttttaggt gacgcaattc aagtagccaa
3661 gtgctatggt gagtctgtgt tagttaatgc tgctaacaca catcttaagc atggcggtgg
3721 tatcgctggt gctattaatg cggcttcaaa aggggctgtc caaaaagagt cagatgagta
3781 tattctggct aaagggccgt tacaagtagg agattcagtt ctcttgcaag gccattctct
3841 agctaagaat atcctgcatg tcgtaggccc agatgcccgc gctaaacagg atgtttctct
3901 ccttagtaag tgctataagg ctatgaatgc atatcctctt gtagtcactc ctcttgtttc
3961 agcaggcata tttggtgtaa aaccagctgt gtcttttgat tatcttatta gagaggctaa
4021 gactagagtt ttagtcgtcg ttaattccca agatgtctat aagagtctta ccatagttga
4081 cattccacag agtttgactt tttcatatga tgggttacgt ggcgcaatac gtaaagctaa
4141 agattatggt tttactgttt ttgtgtgcac agacaactct gctaacacta aagttcttag
4201 gaacaagggt gttgattata ctaagaagtt ttttacagtt gacggtgtgc aatattattg
4261 ctacacgtct aaggacactt tagatgatat cttacaacag gctaataagt ctgttggtat
4321 tatatctatg cctttgggat atgtgtctca tggtttagac ttaattcaag cagggagtgt
4381 cgtgcgtaga gttaacgtgc cctacgtgtg tctcctagct aataaagagc aagaagctat
4441 tttgatgtct gaagacgtta agttaaaccc ttcagaagat tttataaagc acgtccgcac
4501 taatggtggt tacaattctt ggcatttagt cgagggtgaa ctattggtgc aagacttacg
4561 cttaaataag ctcctgcatt ggtctgatca aaccatatgc tacaaggata gtgtgtttta
4621 tgttgtaaag aatagtacag cttttccatt tgaaacactt tcagcatgtc gtgcgtattt
4681 ggattcacgc acgacacagc agttaacaat cgaagtctta gtgactgtcg atggtgtaaa
4741 ttttagaaca gtcgttctaa ataataagaa cacttataga tcacagcttg gatgcgtttt
4801 ctttaatggt gctgatattt ctgataccat tcctgatgag aaacagaatg gtcacagttt
4861 atatctagca gacaatttga ctgctgatga aacaaaggcg cttaaagagt tatatggccc
4921 cgttgatcct actttcttac acagattcta ttcacttaag gctgcagtcc ataagtggaa
4981 gatggttgtg tgtgataagg tacgttctct caaattgagt gataataatt gttatcttaa
5041 tgcagttatt atgacacttg atttattgaa ggacattaaa tttgttatac ctgctctaca
5101 gcatgcattt atgaaacata agggcggtga ttcaactgac ttcatagccc tcattatggc
5161 ttatggcaat tgcacatttg gtgctccaga tgatgcctct cggttacttc ataccgtgct
5221 tgcaaaggct gagttatgct gttctgcacg catggtttgg agagagtggt gcaatgtctg
5281 tggcataaaa gatgttgttc tacaaggctt aaaagcttgt tgttacgtgg gtgtgcaaac
5341 tgttgaagat ctgcgtgctc gtatgacata tgtatgccag tgtggtggtg aacgtcatcg
5401 gcaaatagtc gaacacacca ccccctggtt gctgctctca ggcacaccaa atgaaaaatt
5461 ggtgacaacc tccacggcgc ctgattttgt agcgtttaat gtctttcagg gcattgaaac
5521 ggctgttggc cattatgttc atgctcgcct gaagggtggt cttattttaa agtttgactc
5581 tggcaccgtt agcaagactt cagactggaa gtgcaaggtg acagatgtac ttttctccgg
5641 ccaaaaatac agtagcgatt gtaatgtcgt acggtattct ttggacggta atttcagaac
5701 agaggttgat cccgacctat ctgctttcta tgttaaggat ggtaaatact ttacaagtga
5761 accacccgta acatattcac cagctacaat tttagctggt agtgtctaca ctaatagctg
5821 ccttgtatcg tctgatggac aacctggcgg tgatgctatt agtttgagtt ttaataacct
5881 tttagggttt gattctagta aaccagtcgc taagaaatac acttactcct tcttgcctaa
5941 agaagacggc gatgtgttgt tggctgagtt tgacacttat gaccctattt ataagaatgg
6001 tgccatgtat aaaggcaaac caattctttg ggtcaacaaa gcatcttatg atactaatct
6061 taataagttc aatagagcta gtttgcgtca aatttttgac gtagccccca ttgaactcga
6121 aaataaattc acacctttga gtgtggagtc tacaccagtt gaacctccaa ctgtagatgt
6181 ggtagcactt caacaggaaa tgacaattgt caaatgtaag ggtttaaata aacctttcgt
6241 gaaggacaat gtcagtttcg ttgctgatga ctcaggtact cccgttgttg agtatctgtc
6301 taaagaagat ctacatacat tgtatgtaga ccctaagtat caagtcattg tcttaaaaga
6361 caatgtactt tcttctatgc ttagattgca caccgttgag tcaggtgata ttaacgttgt
6421 tgcagcttcc ggatctttga cacgtaaagt gaaattacta tttagggctt cattttattt
6481 caaagaattt gctacccgca ctttcactgc taccactgct gtaggtagtt gtataaagag
6541 tgtagtgcgg catctaggtg ttactaaagg catattgaca ggctgtttta gttttgtcaa
6601 gatgttattt atgcttccac tagcttactt tagtgattca aaactcggca ccacagaggt
6661 taaagtgagt gctttgaaaa cagctggcgt tgtgacaggt aatgttgtaa aacagtgttg
6721 cactgctgct gttgatttaa gtatggataa gttgcgccgt gtggattgga aatcaaccct
6781 acggttgtta cttatgttat gcacaactat ggtattgttg tcttctgtgt atcacttgta
6841 tgtcttcaat caggtcttat caagtgatgt tatgtttgaa gatgcccaag gtttgaaaaa
6901 gttctacaaa gaagttagag cttacctagg aatctcttct gcttgtgacg gtcttgcttc
6961 agcttatagg gcgaattcct ttgatgtacc tacattctgc gcaaaccgtt ctgcaatgtg
7021 taattggtgc ttgattagcc aagattccat aactcactac ccagctctta agatggttca
7081 aacacatctt agccactatg ttcttaacat agattggttg tggtttgcat ttgagactgg
7141 tttggcatac atgctctata cctcggcctt caactggttg ttgttggcag gtacattgca
7201 ttatttcttt gcacagactt ccatatttgt agactggcgg tcatacaatt atgctgtgtc
7261 tagtgccttc tggttattca cccacattcc aatggcgggt ttggtacgaa tgtataattt
7321 gttagcatgc ctttggcttt tacgcaagtt ttatcagcat gtaatcaatg gttgcaaaga
7381 tacggcatgc ttgctctgct ataagaggaa ccgacttact agagttgaag cttctaccgt
7441 tgtctgtggt ggaaaacgta cgttttatat cacagcaaat ggcggtattt cattctgtcg
7501 taggcataat tggaattgtg tggattgtga cactgcaggt gtggggaata ccttcatctg
7561 tgaagaagtc gcaaatgact tcactaccgc cctacgcagg cctattaacg ctacggatag
7621 atcacattat tatgtggatt ccgttacagt taaagagact gttgttcagt ttaattatcg
7681 tagagacggt caaccattct acgagcggtt tcccctctgc gcttttacaa atctagataa
7741 gttgaagttc aaagaggtct gtaaaactac tactggtata cctgaataca actttatcat
7801 ctacgactca tcagatcgtg gccaggaaag tttagctagg tctgcatgtg tttattattc
7861 tcaagtcttg tgtaaatcaa ttcttttggt tgactcaagt ttggttactt ctgttggtga
7921 ttctagtgaa atcgccacta aaatgtttga ttcctttgtt aatagtttcg tctcgctgta
7981 taatgtcaca cgcgataagt tggaaaaact tatctctact gctcgtgatg gcgtaaggcg
8041 aggcgataac ttccatagtg tcttaacaac attcattgac gcagcacgag gccccgcagg
8101 tgtggagtct gatgttgaga ccaatgaaat tgttgactct gtgcagtatg ctcataaaca
8161 tgacatacaa attactaatg agagttacaa taattatgta ccctcatatg ttaaacctga
8221 tagtgtgtct accagtgatt taggtagtct cattgattgt aatgcggctt cagttaacca
8281 aattgtcttg cgtaattcta atggtgcttg tatttggaac gctgctgcat atatgaaact
8341 ctcggatgca cttaaacgac agattcgcat tgcatgccgt aagtgtaatt tagctttccg
8401 gttaaccacc tcaaagctac gcgctaatga taatatctta tcagttagat tcactgctaa
8461 caaaattgtt ggtggtgctc ctacatggtt taatgcgttg cgtgacttta cgttaaaggg
8521 ttacgttctt gctaccatta ttgtgtttct gtgtgctgta ctgatgtatt tgtgtttacc
8581 tacattttct atggtacctg ttgaatttta tgaagaccgc atcttggact ttaaagttct
8641 tgataatggt atcattaggg atgtaaatcc tgatgataag tgctttgcta ataagcaccg
8701 gtccttcaca caatggtatc atgagcatgt tggtggtgtc tatgacaact ctatcacatg
8761 cccattgaca gttgcagtaa ttgctggagt tgctggtgct cgcattccag acgtacctac
8821 tacattggct tggttgaaca atcagataat tttctttgtt tctcgagtct ttgctaatac
8881 aggcagtgtt tgctacactc ctatagatga gataccctat aagagtttct ctgatagtgg
8941 ttgcattctt ccatctgagt gcactatgtt tagggatgca gagggccgta tgacaccata
9001 ctgccatgat cctactgttt tgcctggggc ttttgcgtac agtcagatga ggcctcatgt
9061 tcgttacgac ttgtatgatg gtaacatgtt tattaaattt cctgaagtag tatttgaaag
9121 tacacttagg attactagaa ctctgtcaac tcagtactgc cggttcggta gttgtgagta
9181 tgcacaagag ggtgtttgta ttaccacaaa tggctcgtgg gccattttta atgaccacca
9241 tcttaataga cctggtgtct attgtggctc tgattttatt gacattgtca ggcggttagc
9301 agtatcactg ttccagccta ttacttattt ccaattgact acctcattgg tcttgggtat
9361 aggtttgtgt gcgttcctga ctttgctctt ctattatatt aataaagtaa aacgtgcttt
9421 tgcagattac acccagtgtg ctgtaattgc tgttgttgct gctgttctta atagcttgtg
9481 catctgcttt gttgcctcta taccattgtg tatagtacct tacactgcat tgtactatta
9541 tgctacattc tattttacta atgagcctgc atttattatg catgtttctt ggtacattat
9601 gttcgggcct atcgttccca tatggatgac ctgcgtttat acagttgcaa tgtgctttag
9661 acacttcttc tgggttttag cttattttag taagaaacat gtagaagttt ttactgatgg
9721 taagcttaat tgtagtttcc aggacgctgc ctctaatatc tttgttatta acaaggacac
9781 ttatgcagct cttagaaact ctttaactaa tgatgcctat tcacgatttt tggggttgtt
9841 taacaagtat aagtacttct ctggtgctat ggaaacagcc gcttatcgtg aagctgcagc
9901 atgtcatctt gctaaagcct tacaaacata cagcgagact ggtagtgatc ttctttacca
9961 accacccaac tgtagcataa cctctggcgt gttgcaaagc ggtttggtga aaatgtcaca
10021 tcccagtgga gatgttgagg cttgtatggt tcaggttacc tgcggtagca tgactcttaa
10081 tggtctttgg cttgacaaca cagtctggtg cccacgacac gtaatgtgcc cggctgacca
10141 gttgtctgat cctaattatg atgccttgtt gatttctatg actaatcata gtttcagtgt
10201 gcaaaaacac attggcgctc cagcaaactt gcgtgttgtt ggtcatgcca tgcaaggcac
10261 tcttttgaag ttgactgtcg atgttgctaa ccctagcact ccagcctaca cttttacaac
10321 agtgaaacct ggcgcagcat ttagtgtgtt agcatgctat aatggtcgtc cgactggtac
10381 attcactgtt gtaatgcgcc ctaactacac aattaagggt tcctttctgt gtggttcttg
10441 tggtagtgtt ggttacacca aggagggtag tgtgatcaat ttttgttaca tgcatcaaat
10501 ggaacttgct aatggtacac ataccggttc agcatttgat ggtactatgt atggtgcctt
10561 tatggataaa caagtgcacc aagttcagtt aacagacaaa tactgcagtg ttaatgtagt
10621 agcttggctt tacgcagcaa tacttaatgg ttgcgcttgg tttgtaaaac ccaatcgcac
10681 tagtgttgtt tcttttaatg aatgggctct tgccaaccaa ttcactgaat ttgttggcac
10741 tcaatccgtt gacatgttag ctgtcaaaac aggcgttgct attgaacagc tgctttatgc
10801 gatccaacaa ctttatactg ggttccaggg aaagcaaatc cttggcagta ctatgttgga
10861 agatgaattc acacctgagg atgttaatat gcagattatg ggtgtggtta tgcagagtgg
10921 tgtgagaaaa gttacatatg gtactgcgca ttggttgttc gcgacccttg tctcaaccta
10981 tgtgataatc ttacaagcca ctaaatttac tttgtggaac tacttgtttg agactattcc
11041 cacacagttg ttcccactct tatttgtgac tatggccttc gttatgttgt tggttaaaca
11101 caaacacacc tttttgacac ttttcttgtt gcctgtggct atttgtttga cttatgcaaa
11161 catagtctac gagcccacta ctcccatttc gtcagcgctg attgcagttg caaattggct
11221 tgcccccact aatgcttata tgcgcactac acatactgat attggtgtct acattagtat
11281 gtcacttgta ttagtcattg tagtgaagag attgtacaac ccatcacttt ctaactttgc
11341 gttagcattg tgcagtggtg taatgtggtt gtacacttat agcattggag aagcctcaag
11401 ccccattgcc tatctggttt ttgtcactac actcactagt gattatacga ttacagtctt
11461 tgttactgtc aaccttgcaa aagtttgcac ttatgccatc tttgcttact caccacagct
11521 tacacttgtg tttccggaag tgaagatgat acttttatta tacacatgtt taggtttcat
11581 gtgtacttgc tattttggtg tcttctctct tttgaacctt aagcttagag cacctatggg
11641 tgtctatgac tttaaggtct caacacaaga gttcagattc atgactgcta acaatctaac
11701 tgcacctaga aattcttggg aggctatggc tctgaacttt aagttaatag gtattggcgg
11761 tacaccttgt ataaaggttg ctgctatgca gtctaaactt acagatctta aatgcacatc
11821 tgtggttctc ctctctgtgc tccaacagtt acacttagag gctaatagta gggcctgggc
11881 tttctgtgtt aaatgccata atgatatatt ggcagcaaca gaccccagtg aggctttcga
11941 gaaattcgta agtctctttg ccactttaat gactttttct ggtaatgtag atcttgatgc
12001 gttagctagt gatatttttg acactcctag cgtacttcaa gctactcttt ctgagttttc
12061 acacttagct acctttgctg agttggaagc tgcgcagaaa gcctatcagg aagctatgga
12121 ctctggtgac acctcaccac aagttcttaa ggctttgcag aaggctgtta atatagctaa
12181 aaacgcctat gagaaggata aggcagtggc ccgtaagtta gaacgtatgg ctgaccaggc
12241 tatgacttct atgtataagc aagcacgtgc tgaagacaag aaagcaaaaa ttgtcagtgc
12301 tatgcaaact atgttgtttg gtatgattaa gaagctcgac aacgatgttc ttaatggtat
12361 catttctaac gctaggaatg gttgtatacc tcttagtgtc attccactgt gtgcttcaaa
12421 taaacttcgc gttgtaattc ctgacttcac cgtctggaat caggtagtca catatccctc
12481 gcttaactac gctggggctt tgtgggacat tacagttata aacaatgtgg acaatgaaat
12541 tgttaagtct tcagatgttg tagacagcaa tgaaaattta acatggccac ttgttttaga
12601 atgcactagg gcatccactt ctgccgttaa gttgcaaaat aatgagatca aaccttcagg
12661 tttaaaaacc atggttgtgt ctgcaggtca agagcaaact aactgtaata ctagttcctt
12721 agcttattac gaacctgtgc agggtcgtaa aatgctgatg gctcttcttt ctgataatgc
12781 ctatctcaaa tgggcgcgtg ttgaaggtaa ggacggattt gttagtgtag agctacaacc
12841 tccttgcaaa ttcttgattg cgggaccaaa aggacctgaa atccgatatc tctattttgt
12901 taaaaatctt aacaaccttc atcgcgggca agtgttaggg cacattgctg cgactgttag
12961 attgcaagct ggttctaaca ccgagtttgc ctctaattct tcggtgttgt cacttgttaa
13021 cttcaccgtt gatcctcaaa aagcttatct cgatttcgtc aatgcgggag gtgccccatt
13081 gacaaattgt gttaagatgc ttactcctaa aactggtaca ggtatagcta tatctgttaa
13141 accagagagt acagctgatc aagagactta tggtggagct tcagtgtgtc tctattgccg
13201 tgcgcatata gaacatcctg atgtctctgg tgtttgtaaa tataagggta agtttgtcca
13261 aatccctgct cagtgtgtcc gtgaccctgt gggattttgt ttgtcaaata ccccctgtaa
13321 tgtctgtcaa tattggattg gatatgggtg caattgtgac tcgcttaggc aagcaacact
13381 gccccaatct aaagattcca attttttaaa cgagtccggg gttctattgt aaatgcccga
13441 atagaaccct gttcaagtgg tttgtccact gatgtcgttt ttagggcatt tgacatctgc
13501 aactataagg ctaaggttgc tggtattgga aaatactaca agactaatac ttgtaggttt
13561 gtagaattag atgaccaagg gcatcattta gactcctatt ttgtcgttaa gaggcatact
13621 atggagaatt atgaactaga gaagcactgt tacgatttgt tacgtgactg tgatgctgta
13681 gctccccatg atttcttcat ctttgatgta gacaaagtta aaacacctca tattgtacgt
13741 cagcgtttaa ctgagtacac tatgatggat cttgtatatg ccctgaggca ctttgatcaa
13801 aatagcgaag tgcttaaggc tatcttagtg aagtatggtt gctgtgatgt tacctacttt
13861 gaaaataaac tctggtttga tttcgttgaa aatcccagtg ttattggtgt ttatcataaa
13921 cttggagaac gtgtacgcca agctatctta aacactgtta aattttgtga ccacatggtc
13981 aaggctggtt tagtcggtgt gctcacacta gacaaccagg accttaatgg caagtggtat
14041 gattttggtg acttcgtaat cactcaacct ggttcaggag tagctatagt tgatagctac
14101 tattcttatt tgatgcctgt gctctcaatg accgattgtc tggccgctga gacacatagg
14161 gattgtgatt ttaataaacc actcattgag tggccactta ctgagtatga ttttactgat
14221 tataaggtac aactctttga gaagtacttt aaatattggg atcagacgta tcacgcaaat
14281 tgcgttaatt gtactgatga ccgttgtgtg ttacattgtg ctaatttcaa tgtattgttt
14341 gctatgacca tgcctaagac ttgtttcgga cccatagtcc gaaagatctt tgttgatggc
14401 gtgccatttg tagtatcttg tggttatcac tacaaagaat taggtttagt catgaatatg
14461 gatgttagtc tccatagaca taggctctct cttaaagagt tgatgatgta tgccgctgat
14521 ccagccatgc acattgcctc ctctaacgct tttcttgatt tgaggacatc atgttttagt
14581 gtcgctgcac ttacaactgg tttgactttt caaactgtgc ggcctggcaa ttttaaccaa
14641 gacttctatg atttcgtggt atctaaaggt ttctttaagg agggctcttc agtgacgctc
14701 aaacattttt tctttgctca agatggtaat gctgctatta cagattataa ttactattct
14761 tataatctgc ctactatgtg tgacatcaaa caaatgttgt tctgcatgga agttgtaaac
14821 aagtacttcg aaatctatga cggtggttgt cttaatgctt ctgaagtggt tgttaataat
14881 ttagacaaga gtgctggcca tccttttaat aagtttggca aagctcgtgt ctattatgag
14941 agcatgtctt accaggagca agatgaactc tttgccatga caaagcgtaa cgtcattcct
15001 accatgactc aaatgaatct aaaatatgct attagtgcta agaatagagc tcgcactgtt
15061 gcaggcgtgt ccatacttag cacaatgact aatcgccagt accatcagaa aatgcttaag
15121 tccatggctg caactcgtgg agcgacttgc gtcattggta ctacaaagtt ctatggtggc
15181 tgggatttca tgcttaaaac attgtacaaa gatgttgata atccgcatct tatgggttgg
15241 gattacccta agtgtgatag agctatgcct aatatgtgta gaatcttcgc ttcactcata
15301 ttagctcgta aacatgccac ttgttgtact acaagggaca gattttatcg cttggcaaat
15361 gagtgtgctc aggtgctaag cgaatatgtt ctatgtggtg gtggttacta cgtcaaacct
15421 ggaggtacca gtagcggaga tgccaccact gcatatgcca atagtgtctt taacattttg
15481 caggcgacaa ctgctaatgt cagtgcactt atgggtgcta atggcaacaa gattgttgac
15541 aaagaagtta aagacatgca gtttgatttg tatgtcaatg tttacaggag cactagccca
15601 gaccccaaat ttgttgataa atactatgct tttcttaata agcacttttc tatgatgata
15661 ctgtctgatg acggtgtcgt ttgctataat agtgattatg cagctaaggg ttacattgct
15721 ggaatacaga attttaagga aacgctgtat tatcagaaca atgtctttat gtctgaagct
15781 aaatgctggg tggaaaccga tctgaagaaa gggccacatg aattctgttc acagcatacg
15841 ctttatatta aggatggcga cgatggttac ttccttcctt atccagaccc ttcaagaatt
15901 ttgtctgccg gttgctttgt agatgatatc gttaagactg acggtacact catggtagag
15961 cggtttgtgt ctttggctat agatgcttac cctctcacaa agcatgaaga tatagaatac
16021 cagaatgtat tctgggtcta cttacagtat atagaaaaac tgtataaaga ccttacagga
16081 cacatgcttg acagttattc tgtcatgcta tgtggtgata attctgctaa gttttgggaa
16141 gaggcattct acagagatct ctatagttcg cctaccactt tgcaggctgt cggttcatgc
16201 gttgtatgcc attcacagac ttccctacgc tgtgggacat gcatccgtag accatttctc
16261 tgctgtaaat gctgctatga tcatgttata gcaactccac ataagatggt tttgtctgtt
16321 tctccttacg tttgtaatgc ccctggttgt ggcgtttcag acgttactaa gctatattta
16381 ggtggtatga gctacttttg tgtagatcat agacctgtgt gtagttttcc actttgcgct
16441 aatggtcttg tattcggctt atacaagaat atgtgcacag gtagtccttc tatagttgaa
16501 tttaataggt tggctacctg tgactggact gaaagtggtg attacaccct tgccaatact
16561 acaacagaac cactcaaact ttttgctgct gagactttac gtgccactga agaggcgtct
16621 aagcagtctt atgctattgc caccatcaaa gaaattgttg gtgagcgcca actattactt
16681 gtgtgggagg ctggcaagtc caaaccacca ctcaatcgta attatgtttt tactggttat
16741 catataacca aaaatagtaa agtgcagctc ggtgagtaca tcttcgagcg cattgattat
16801 agtgatgctg tatcctacaa gtctagtaca acgtataaac tgactgtagg tgacatcttc
16861 gtacttacct ctcactctgt ggctaccttg acggcgccca caattgtgaa tcaagagagg
16921 tatgttaaaa ttactgggtt gtacccaacc attacggtac ctgaagagtt cgcaagtcat
16981 gttgccaact tccaaaaatc aggttatagt aaatatgtca ctgttcaggg accacctggc
17041 actggcaaaa gtcactttgc tatagggtta gcgatttact accctacagc acgtgttgtt
17101 tatacagcat gttcacacgc agctgttgat gctttgtgtg aaaaagcttt taaatatttg
17161 aacattgcta aatgttcccg tattattcct gcaaaggcac gtgttgagtg ctatgacagg
17221 tttaaagtta atgagacaaa ttctcaatat ttgtttagta ctattaatgc tctaccagaa
17281 acttctgccg atattctggt ggttgatgag gttagtatgt gcactaatta tgatctttca
17341 attattaatg cacgtattaa agctaagcac attgtctatg taggagatcc agcacagttg
17401 ccagctccta ggactttgtt gactagaggc acattggaac cagaaaattt caatagtgtc
17461 actagattga tgtgtaactt aggtcctgac atatttttaa gtatgtgcta caggtgtcct
17521 aaggaaatag taagcactgt gagcgctctt gtctacaata ataaattgtt agccaagaag
17581 gagctttcag gccagtgctt taaaatactc tataagggca atgtgacgca tgatgctagc
17641 tctgccatta atagaccaca actcacattt gtgaagaatt ttattactgc caatccggca
17701 tggagtaagg cagtctttat ttcgccttat aattcacaga atgctgtggc tcgttcaatg
17761 ctgggtctta ctactcagac tgttgattcc tcacagggtt cagaatacca gtacgttatc
17821 ttctgtcaaa cagcagatac ggcacatgct aacaacatta acagatttaa tgttgcaatc
17881 actcgtgccc aaaaaggtat tctttgtgtt atgacatctc aggcactctt tgagtcctta
17941 gagtttactg aattgtcttt tactaattac aagctccagt ctcagattgt aactggcctt
18001 tttaaagatt gctctagaga aacttctggc ctctcacctg cttatgcacc aacatacgtt
18061 agtgttgatg acaagtataa gacgagtgat gagctttgcg tgaatcttaa tttacccgca
18121 aatgtcccat actctcgtgt tatttccagg atgggcttta aactcgatgc aacagttcct
18181 ggatatccta agcttttcat tactcgtgaa gaggctgtaa ggcaagttcg aagctggata
18241 ggcttcgatg ttgagggtgc tcatgcttcc cgtaatgcat gtggcaccaa tgtgcctcta
18301 caattaggat tttcaactgg tgtgaacttt gttgttcagc cagttggtgt tgtagacact
18361 gagtggggta acatgttaac gggcattgct gcccgtcctc caccaggtga acagtttaag
18421 cacctcgtgc ctcttatgca taagggggct gcgtggccta ttgttagacg acgtatagtg
18481 caaatgttgt cagacacttt agacaaattg tctgattact gtacgtttgt ttgttgggct
18541 catggctttg aattaacgtc tgcatcatac ttttgcaaga taggtaagga acagaagtgt
18601 tgcatgtgca atagacgcgc tgcagcgtac tcttcacctc tgcaatctta tgcctgctgg
18661 actcattcct gcggttatga ttatgtctac aaccctttct ttgtcgatgt tcaacagtgg
18721 ggttatgtag gcaatcttgc tactaatcac gatcgttatt gctctgtcca tcaaggagct
18781 catgtggctt ctaatgatgc aataatgact cgttgtttag ctattcattc ttgttttata
18841 gaacgtgtgg attgggatat agagtatcct tatatctcac atgaaaagaa attgaattcc
18901 tgttgtagaa tcgttgagcg caacgtcgta cgtgctgctc ttcttgccgg ttcatttgac
18961 aaagtctatg atattggcaa tcctaaagga attcctattg ttgatgaccc tgtggttgat
19021 tggcattatt ttgatgcaca gcccttgacc agaaaggtac aacagctttt ctatacagag
19081 gacatggcct caagatttgc tgatgggctc tgcttatttt ggaactgtaa tgtaccaaaa
19141 tatcctaata atgcaattgt atgcaggttt gacacacgtg tgcattctga gttcaatttg
19201 ccaggttgtg atggcggtag tttgtatgtt aacaagcacg cttttcatac accagcatat
19261 gatgtgagtg cattccgtga tctgaaacct ttaccattct tttattattc tactacacca
19321 tgtgaagtgc atggtaatgg tagtatgata gaggatattg attatgtacc cctaaaatct
19381 gcagtctgta ttacagcttg taatttaggg ggcgctgttt gtaggaagca tgctacagag
19441 tacagagagt atatggaagc atataatctt gtctctgcat caggtttccg cctttggtgt
19501 tataagacct ttgatattta taatctctgg tctactttta caaaagttca aggtttggaa
19561 aacattgctt ttaattttgt taaacaaggc cattttattg gtgttgaggg tgaactacct
19621 gtagctgtag tcaatgataa gatcttcacc aagagtggcg ttaatgacat ttgtatgttt
19681 gagaataaaa ccactttgcc tactaatata gcttttgaac tctatgctaa gcgtgctgta
19741 cgctcgcatc ccgatttcaa attgctacac aatttacaag cagacatttg ctacaagttc
19801 gtcctttggg attatgaacg tagcaatatt tatggtactg ctactattgg tgtatgtaag
19861 tacactgata ttgatgttaa ttcagctttg aatatatgtt ttgacatacg cgataatggt
19921 tcattggaga agttcatgtc tactcccaat gccatcttta tttctgatag aaaaattaag
19981 aaataccctt gtatggtagg tcctgattat gcttacttca atggtgctat catccgtgat
20041 agtgatgttg ttaaacaacc agtgaagttc tacttgtata agaaagtcaa taatgagttt
20101 attgatccta ctgagtgtat ttacactcag agtcgctctt gtagtgactt cctacccctg
20161 tctgacatgg agaaagactt tctatctttt gatagtgatg ttttcattaa gaagtatggc
20221 ttggaaaact atgcttttga gcacgtagtc tatggagact tctctcatac tacgttaggc
20281 ggtcttcact tgcttattgg tttatacaag aagcaacagg aaggtcatat tattatggaa
20341 gaaatgctaa aaggtagctc aactattcat aactatttta ttactgagac taacacagcg
20401 gcttttaagg cggtgtgttc tgttatagat ttaaagcttg acgactttgt tatgatttta
20461 aagagtcaag accttggcgt agtatccaag gttgtcaagg ttcctattga cttaacaatg
20521 attgagttta tgttatggtg taaggatgga caggttcaaa ccttctaccc tcgactccag
20581 gcttctgcag attggaaacc tggtcatgca atgccatccc tctttaaagt tcaaaatgta
20641 aaccttgaac gttgtgagct tgctaattac aagcaatcta ttcctatgcc tcgcggtgtg
20701 cacatgaaca tcgctaaata tatgcaattg tgccagtatt taaatacttg cacattagcc
20761 gtgcctgcca atatgcgtgt tatacatttt ggcgctggtt ctgataaagg tatcgctcct
20821 ggtacatcag ttttacgaca gtggcttcct acagatgcca ttattataga taatgattta
20881 aatgagttcg tgtcagatgc tgacataact ttatttggag attgtgtaac tgtacgtgtc
20941 ggccaacaag tggatcttgt tatttccgac atgtatgatc ctactactaa gaatgtaaca
21001 ggtagtaatg agtcaaaggc tttattcttt acttacctgt gtaacctcat taataataat
21061 cttgctcttg gtgggtctgt tgctattaaa ataacagaac actcttggag cgttgaactt
21121 tatgaactta tgggaaaatt tgcttggtgg actgttttct gcaccaatgc aaatgcatcc
21181 tcatctgaag gattcctctt aggtattaat tacttgggta ctattaaaga aaatatagat
21241 ggtggtgcta tgcacgccaa ctatatattt tggagaaatt ccactcctat gaatctgagt
21301 acttactcac tttttgattt atccaagttt caattaaaat taaaaggaac accagttctt
21361 caattaaagg agagtcaaat taacgaactc gtaatatctc tcctgtcgca gggtaagtta
21421 cttatccgtg acaatgatac actcagtgtt tctactgatg ttcttgttaa cacctacaga
21481 aagttacgtt gatgtagggc cagattctgt taagtctgct tgtattgagg ttgatataca
21541 acagactttc tttgataaaa cttggcctag gccaattgat gtttctaagg ctgacggtat
21601 tatataccct caaggccgta catattctaa cataactatc acttatcaag gtctttttcc
21661 ctatcaggga gaccatggtg atatgtatgt ttactctgca ggacatgcta caggcacaac
21721 tccacaaaag ttgtttgtag ctaactattc tcaggacgtc aaacagtttg ctaatgggtt
21781 tgtcgtccgt ataggagcag ctgccaattc cactggcact gttattatta gcccatctac
21841 cagcgctact atacgaaaaa tttaccctgc ttttatgctg ggttcttcag ttggtaattt
21901 ctcagatggt aaaatgggcc gcttcttcaa tcatactcta gttcttttgc ccgatggatg
21961 tggcacttta cttagagctt tttattgtat tctagagcct cgctctggaa atcattgtcc
22021 tgctggcaat tcctatactt cttttgccac ttatcacact cctgcaacag attgttctga
22081 tggcaattac aatcgtaatg ccagtctgaa ctcttttaag gagtatttta atttacgtaa
22141 ctgcaccttt atgtacactt ataacattac cgaagatgag attttagagt ggtttggcat
22201 tacacaaact gctcaaggtg ttcacctctt ctcatctcgg tatgttgatt tgtacggcgg
22261 caatatgttt caatttgcca ccttgcctgt ttatgatact attaagtatt attctatcat
22321 tcctcacagt attcgttcta tccaaagtga tagaaaagct tgggctgcct tctacgtata
22381 taaacttcaa ccgttaactt tcctgttgga tttttctgtt gatggttata tacgcagagc
22441 tatagactgt ggttttaatg atttgtcaca actccactgc tcatatgaat ccttcgatgt
22501 tgaatctgga gtttattcag tttcgtcttt cgaagcaaaa ccttctggct cagttgtgga
22561 acaggctgaa ggtgttgaat gtgatttttc acctcttctg tctggcacac ctcctcaggt
22621 ttataatttc aagcgtttgg tttttaccaa ttgcaattat aatcttacca aattgctttc
22681 acttttttct gtgaatgatt ttacttgtag tcaaatatct ccagcagcaa ttgctagcaa
22741 ctgttattct tcactgattt tggattattt ttcataccca cttagtatga aatccgatct
22801 cagtgttagt tctgctggtc caatatccca gtttaattat aaacagtcct tttctaatcc
22861 cacatgtttg attttagcga ctgttcctca taaccttact actattacta agcctcttaa
22921 gtacagctat attaacaagt gctctcgtct tctttctgat gatcgtactg aagtacctca
22981 gttagtgaac gctaatcaat actcaccctg tgtatccatt gtcccatcca ctgtgtggga
23041 agacggtgat tattatagga aacaactatc tccacttgaa ggtggtggct ggcttgttgc
23101 tagtggctca actgttgcca tgactgagca attacagatg ggctttggta ttacagttca
23161 atatggtaca gacaccaata gtgtttgccc caagcttgaa tttgctaatg acacaaaaat
23221 tgcctctcaa ttaggcaatt gcgtggaata ttccctctat ggtgtttcgg gccgtggtgt
23281 ttttcagaat tgcacagctg taggtgttcg acagcagcgc tttgtttatg atgcgtacca
23341 gaatttagtt ggctattatt ctgatgatgg caactactac tgtttgcgtg cttgtgttag
23401 tgttcctgtt tctgtcatct atgataaaga aactaaaacc cacgctactc tatttggtag
23461 tgttgcatgt gaacacattt cctctaccat gtctcaatac tcccgttcta cgcgatcaat
23521 gcttaaacgg cgagattcta catatggtcc ccttcagaca cctgttggtt gtgtcctagg
23581 acttgttaat tcctctttgt tcgtagagga ctgcaagttg cctcttggtc aatctctctg
23641 tgctcttcct gacacaccta gtactctcac acctcgcagt gtgcgctctg ttccaggtga
23701 aatgcgcttg gcatccattg cttttaatca tcctattcag gttgatcaac ttaatagtag
23761 ttattttaaa ttaagtatac ctactaattt ttcctttggt gtgactcagg agtacattca
23821 gacaaccatt cagaaagtta ctgttgattg taaacagtac gtttgcaatg gtttccagaa
23881 gtgtgagcaa ttactgcgcg agtatggcca gttttgttcc aaaataaacc aggctctcca
23941 tggtgccaat ttacgccagg atgattctgt acgtaatttg tttgcgagcg tgaaaagctc
24001 tcaatcatct cctatcatac caggttttgg aggtgacttt aatttgacac ttctagaacc
24061 tgtttctata tctactggca gtcgtagtgc acgtagtgct attgaggatt tgctatttga
24121 caaagtcact atagctgatc ctggttatat gcaaggttac gatgattgca tgcagcaagg
24181 tccagcatca gctcgtgatc ttatttgtgc tcaatatgtg gctggttaca aagtattacc
24241 tcctcttatg gatgttaata tggaagccgc gtatacctca tctttgcttg gcagcatagc
24301 aggtgttggc tggactgctg gcttatcctc ctttgctgct attccatttg cacagagtat
24361 cttttatagg ttaaacggtg ttggcattac tcaacaggtt ctttcagaga accaaaagct
24421 tattgccaat aagtttaatc aggctctggg agctatgcaa acaggcttca ctacaactaa
24481 tgaagctttt cggaaggttc aggatgctgt gaacaacaat gcacaggctc tatccaaatt
24541 agctagcgag ctatctaata cttttggtgc tatttccgcc tctattggag acatcataca
24601 acgtcttgat gttctcgaac aggacgccca aatagacaga cttattaatg gccgtttgac
24661 aacactaaat gcttttgttg cacagcagct tgttcgttcc gaatcagctg ctctttccgc
24721 tcaattggct aaagataaag tcaatgagtg tgtcaaggca caatccaagc gttctggatt
24781 ttgcggtcaa ggcacacata tagtgtcctt tgttgtaaat gcccctaatg gcctttactt
24841 catgcatgtt ggttattacc ctagcaacca cattgaggtt gtttctgctt atggtctttg
24901 cgatgcagct aaccctacta attgtatagc ccctgttaat ggctacttta ttaaaactaa
24961 taacactagg attgttgatg agtggtcata tactggctcg tccttctatg cacctgagcc
25021 catcacctct cttaatacta agtatgttgc accacaggtg acataccaaa acatttctac
25081 taacctccct cctcctcttc tcggcaattc caccgggatt gacttccaag atgagttgga
25141 tgagtttttc aaaaatgtta gcaccagtat acctaatttt ggttctctaa cacagattaa
25201 tactacatta ctcgatctta cctacgagat gttgtctctt caacaagttg ttaaagccct
25261 taatgagtct tacatagacc ttaaagagct tggcaattat acttattaca acaaatggcc
25321 gtggtacatt tggcttggtt tcattgctgg gcttgttgcc ttagctctat gcgccttctt
25381 catactgtgc tgcactggtt gtggcacaaa ctgtatggga aaacttaagt gtaatcgttg
25441 ttgtgataga tacgaggaat acgacctcga gccgcataag gttcatgttc actaattaac
25501 gaactatcaa tgagagttca aagaccaccc actctcttgt tagtgttctc actctctctt
25561 ttggtcactg cattttcaaa acctctctat gtacctgagc attgtcagaa ttattctggt
25621 tgcatgctta gggcttgtat taaaactgcc caagctgata cagctggtct ttatacaaat
25681 tttcgaattg acgtcccatc tgcagaatca actggtactc aatcagtttc tgtcgatcgt
25741 gagtcaactt caactcatga tggtcctacc gaacatgtta ctagtgtgaa tctttttgac
25801 gttggttact cagttaatta acgaactcta tggattacgt gtctctgctt aatcaaattt
25861 ggcagaagta ccttaattca ccgtatacta cttgtttgta tatccctaaa cccacagcta
25921 agtatacacc tttagttggc acttcattgc accctgtgct gtggaactgt cagctatcct
25981 ttgctggtta tactgaatct gctgttaatt ctacaaaagc tttggccaaa caggacgcag
26041 ctcagcgaat cgcttggttg ctacataagg atggaggaat ccctgatgga tgttccctct
26101 acctccggca ctcaagttta ttcgcgcaaa gcgaggaaga ggagtcattc tccaactaag
26161 aaactgcgct acgttaagcg tagattttct cttctgcgcc ctgaagacct tagtgttatt
26221 gtccaaccaa cacactatgt cagggttaca ttttcagacc ccaacatgtg gtatctacgt
26281 tcgggtcatc atttacactc agttcacaat tggcttaaac cttatggcgg ccaacctgtt
26341 tctgagtacc atattactct agctttgcta aatctcactg atgaagattt agctagagat
26401 ttttcaccca ttgcgctctt tttgcgcaat gtcagatttg agctacatga gttcgccttg
26461 ctgcgcaaaa ctcttgttct taatgcatca gagatctact gtgctaacat acatagattt
26521 aagcctgtgt atagagttaa cacggcaatc cctactatta aggattggct tctcgttcag
26581 ggattttccc tttaccatag tggcctccct ttacatatgt caatctctaa attgcatgca
26641 ctggatgatg ttactcgcaa ttacatcatt acaatgccat gctttagaac ttatcctcaa
26701 caaatgtttg ttactccttt ggccgtagat gttgtctcca tacggtcttc caatcagggt
26761 aataaacaaa ttgttcattc ttaccccatt ttacatcatc caggatttta acgaactatg
26821 gctttctcgg cgtctttatt taaacccgtc cagctagtcc cagtttctcc tgcatttcat
26881 cgcattgagt ctactgactc tattgttttc acatacattc ctgctagcgg ctatgtagct
26941 gctttagctg tcaatgtgtg tctcattccc ctattattac tgctacgtca agatacttgt
27001 cgtcgcagca ttatcagaac tatggttctc tatttccttg ttctgtataa ctttttatta
27061 gccattgtac tagtcaatgg tgtacattat ccaactggaa gttgcctgat agccttctta
27121 gttatcctca taatactttg gtttgtagat agaattcgtt tctgtctcat gctgaattcc
27181 tacattccac tgtttgacat gcgttctcac tttattcgtg ttagtacagt ttcttctcat
27241 ggtatggtcc ctgtcataca caccaaacca ttatttatta gaaacttcga tcagcgttgc
27301 agctgttctc gttgttttta tttgcactct tccacttata tagagtgcac ttatattagc
27361 cgttttagta agattagcct agtttctgta actgacttct ccttaaacgg caatgtttcc
27421 actgttttcg tgcctgcaac gcgcgattca gttcctcttc acataatcgc cccgagctcg
27481 cttatcgttt aagcagctct gcgctactat gggtcccgtg tagaggctaa tccattagtc
27541 tctctttgga catatggaaa acgaactatg ttaccctttg tccaagaacg aatagggttg
27601 ttcatagtaa actttttcat ttttaccgta gtatgtgcta taacactctt ggtgtgtatg
27661 gctttcctta cggctactag attatgtgtg caatgtatga caggcttcaa taccctgtta
27721 gttcagcccg cattatactt gtataatact ggacgttcag tctatgtaaa attccaggat
27781 agtaaacccc ctctaccacc tgacgagtgg gtttaacgaa ctccttcata atgtctaata
27841 tgacgcaact cactgaggcg cagattattg ccattattaa agactggaac tttgcatggt
27901 ccctgatctt tctcttaatt actatcgtac tacagtatgg atacccatcc cgtagtatga
27961 ctgtctatgt ctttaaaatg tttgttttat ggctcctatg gccatcttcc atggcgctat
28021 caatatttag cgccatttat ccaattgatc tagcttccca gataatctct ggcattgtag
28081 cagctgtttc agctatgatg tggatttcct actttgtgca gagtatccgg ctgtttatga
28141 gaactggatc atggtggtca ttcaatcctg agactaattg ccttttgaac gttccatttg
28201 gtggtacaac tgtcgtacgt ccactcgtag aggactctac cagtgtaact gctgttgtaa
28261 ccaatggcca cctcaaaatg gctggcatgc atttcggtgc ttgtgactac gacagacttc
28321 ctaatgaagt caccgtggcc aaacccaatg tgctgattgc tttaaaaatg gtgaagcggc
28381 aaagctacgg aactaattcc ggcgttgcca tttaccatag atataaggca ggtaattaca
28441 ggagtccgcc tattacggcg gatattgaac ttgcattgct tcgagcttag gctctttagt
28501 aagagtatct taattgattt taacgaatct caatttcatt gttatggcat cccctgctgc
28561 acctcgtgct gtttcctttg ccgataacaa tgatataaca aatacaaacc tgtctcgagg
28621 tagaggacgt aatccaaaac cacgagctgc accaaataac actgtctctt ggtacactgg
28681 gcttacccaa cacgggaaag tccctcttac ctttccacct gggcagggtg tacctcttaa
28741 tgccaattcc acccctgcgc aaaatgctgg gtattggcgg agacaggaca gaaaaattaa
28801 taccgggaat ggaattaagc aactggctcc caggtggtac ttctactaca ctggaactgg
28861 acccgaagca gcactcccat tccgggctgt taaggatggc atcgtttggg tccatgaaga
28921 tggcgccact gatgctcctt caacttttgg gacgcggaac cctaacaatg attcagctat
28981 tgttacacaa ttcgcgcccg gtactaagct tcctaaaaac ttccacattg aggggactgg
29041 aggcaatagt caatcatctt caagagcctc tagcgtaagc agaaactctt ccagatctag
29101 ttcacaaggt tcaagatcag gaaactctac ccgcggcact tctccaggtc catctggaat
29161 cggagcagta ggaggtgatc tactttacct tgatcttctg aacagactac aagcccttga
29221 gtctggcaaa gtaaagcaat cgcagccaaa agtaatcact aagaaggatg ctgctgctgc
29281 taaaaataag atgcgccaca agcgcacttc caccaaaagt ttcaacatgg tgcaagcttt
29341 tggtcttcgc ggaccaggag acctccaggg aaactttggt gatcttcaat tgaataaact
29401 cggcactgag gacccacgtt ggccccaaat tgctgagctt gctcctacag ccagtgcttt
29461 tatgggtatg tcgcaattta aacttaccca tcagaacaat gatgatcatg gcaaccctgt
29521 gtacttcctt cggtacagtg gagccattaa acttgaccca aagaatccca actacaataa
29581 gtggttggag cttcttgagc aaaatattga tgcctacaaa accttcccta agaaggaaaa
29641 gaaacaaaag gcaccaaaag aagaatcaac agaccaaatg tctgaacctc caaaggagca
29701 gcgtgtgcaa ggtagcatca ctcagcgcat tcgcacccgt ccaagtgttc agcctggtcc
29761 aatgattgat gttaacactg attagtgtca ctcaaagtaa caagatcgcg gcaatcgttt
29821 gtgtttggta accccatctc accatcgctt gtccactctt gcacagaatg gaatcatgtt
29881 gtaattacag tgcaataagg taattataac ccatttaatt gatagctatg ctttattaaa
29941 gtgtgtagct gtagagagaa tgttaaagac tgtcacctct gcgtgattgc aagtgaacag
30001 tgccccccgg gaagagctct acagtgtgaa atgtaaataa aaatagctat tattcaatta
30061 gattaggcta attagatgat ttgcaaaaaa aaaaaa

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Thu Jun 04, 2015 7:54 pm 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
Select seq gb|KR011266.1| Middle East respiratory syndrome coronavirus strain Hu/Riyadh-KSA-2049/2015, complete genome 54271 54271 100% 0.0 99% KR011266.1
Select seq gb|KR011265.1| Middle East respiratory syndrome coronavirus strain Hu/Riyadh-KSA-2466/2015, complete genome 54271 54271 100% 0.0 100% KR011265.1
Select seq gb|KR011264.1| Middle East respiratory syndrome coronavirus strain Hu/Riyadh-KSA-2343/2015, complete genome 54271 54271 100% 0.0 99% KR011264.1
Select seq gb|KR011263.1| Middle East respiratory syndrome coronavirus strain Hu/Riyadh-KSA-2345/2015, complete genome 54271 54271 100% 0.0 99% KR011263.1
Select seq gb|KJ713295.1| Middle East respiratory syndrome coronavirus isolate KSA-CAMEL-505, complete genome 54145 54145 99% 0.0 99% KJ713295.1
Select seq gb|KJ713296.1| Middle East respiratory syndrome coronavirus isolate KSA-CAMEL-378, complete genome 54123 54123 99% 0.0 99% KJ713296.1
Select seq gb|KJ650098.1| Middle East respiratory syndrome coronavirus isolate Camel/Qatar_2_2014, complete genome 54114 54114 100% 0.0 99% KJ650098.1
Select seq gb|KJ829365.1| Middle East respiratory syndrome coronavirus strain Florida/USA-2_Saudi Arabia_2014, complete genome 54100 54100 100% 0.0 99% KJ829365.1
Select seq gb|KP223131.1| Middle East respiratory syndrome coronavirus isolate Florida/USA-2_Saudi Arabia_2014, complete genome 54091 54091 100% 0.0 99% KP223131.1
Select seq gb|KJ713297.1| Middle East respiratory syndrome coronavirus isolate KSA-CAMEL-503, complete genome 54048 54048 99% 0.0 99% KJ713297.1
Select seq gb|KC164505.2| Betacoronavirus England 1, complete genome 54024 54024 100% 0.0 99% KC164505.2
Select seq gb|KC667074.1| Human betacoronavirus 2c England-Qatar/2012, complete genome 54024 54024 100% 0.0 99% KC667074.1
Select seq gb|KF192507.1| Middle East respiratory syndrome coronavirus, complete genome 54001 54001 100% 0.0 99% KF192507.1
Select seq gb|KJ713298.1| Middle East respiratory syndrome coronavirus isolate KSA-CAMEL-363, complete genome 53979 53979 99% 0.0 99% KJ713298.1
Select seq gb|KF600652.1| Middle East respiratory syndrome coronavirus isolate Riyadh_2_2012, complete genome 53963 53963 99% 0.0 99% KF600652.1
Select seq gb|KJ156944.1| Middle East respiratory syndrome coronavirus isolate Riyadh_5_2013, complete genome 53941 53941 99% 0.0 99% KJ156944.1
Select seq gb|KF600630.1| Middle East respiratory syndrome coronavirus isolate Buraidah_1_2013, complete genome 53938 53938 99% 0.0 99% KF600630.1
Select seq gb|KF600628.1| Middle East respiratory syndrome coronavirus isolate Hafr-Al-Batin_1_2013, complete genome 53936 53936 99% 0.0 99% KF600628.1
Select seq gb|KJ156952.1| Middle East respiratory syndrome coronavirus isolate Riyadh_4_2013, complete genome 53934 53934 99% 0.0 99% KJ156952.1
Select seq gb|KJ713299.1| Middle East respiratory syndrome coronavirus isolate KSA-CAMEL-376, complete genome 53925 53925 99% 0.0 99% KJ713299.1
Select seq gb|KF186567.1| Middle East respiratory syndrome coronavirus isolate Al-Hasa_1_2013, complete genome 53923 53923 99% 0.0 99% KF186567.1
Select seq gb|KF186566.1| Middle East respiratory syndrome coronavirus isolate Al-Hasa_2_2013, complete genome 53916 53916 100% 0.0 99% KF186566.1
Select seq gb|KJ156949.1| Middle East respiratory syndrome coronavirus isolate Taif_1_2013, complete genome 53914 53914 99% 0.0 99% KJ156949.1
Select seq gb|KP209312.1| Middle East respiratory syndrome coronavirus strain Abu Dhabi_UAE_9_2013, complete genome 53911 53911 100% 0.0 99% KP209312.1
Select seq gb|KP209306.1| Middle East respiratory syndrome coronavirus strain Abu Dhabi_UAE_8_2014, complete genome 53909 53909 100% 0.0 99% KP209306.1
Select seq gb|KJ156881.1| Middle East respiratory syndrome coronavirus isolate Wadi-Ad-Dawasir_1_2013, complete genome 53909 53909 99% 0.0 99% KJ156881.1
Select seq gb|KF600632.1| Middle East respiratory syndrome coronavirus isolate Al-Hasa_19_2013, complete genome 53909 53909 99% 0.0 99% KF600632.1
Select seq gb|KP209309.1| Middle East respiratory syndrome coronavirus strain Abu Dhabi_UAE_30_2014, complete genome 53907 53907 100% 0.0 99% KP209309.1
Select seq gb|KF600647.1| Middle East respiratory syndrome coronavirus isolate Al-Hasa_17_2013, complete genome 53907 53907 100% 0.0 99% KF600647.1
Select seq gb|KJ650295.1| Middle East respiratory syndrome coronavirus isolate KFU-HKU 13, complete genome 53905 53905 99% 0.0 99% KJ650295.1
Select seq gb|KF600613.1| Middle East respiratory syndrome coronavirus isolate Riyadh_3_2013, complete genome 53905 53905 99% 0.0 99% KF600613.1
Select seq gb|KJ650297.1| Middle East respiratory syndrome coronavirus isolate KFU-HKU 1, complete genome 53903 53903 99% 0.0 99% KJ650297.1
Select seq gb|KJ650296.1| Middle East respiratory syndrome coronavirus isolate KFU-HKU 19Dam, complete genome 53903 53903 99% 0.0 99% KJ650296.1
Select seq gb|KP209313.1| Middle East respiratory syndrome coronavirus strain Abu Dhabi_UAE_26_2014, complete genome 53902 53902 100% 0.0 99% KP209313.1
Select seq gb|KF600651.1| Middle East respiratory syndrome coronavirus isolate Al-Hasa_18_2013, complete genome 53902 53902 99% 0.0 99% KF600651.1
Select seq gb|KP209308.1| Middle East respiratory syndrome coronavirus strain Abu Dhabi_UAE_16_2014, complete genome 53900 53900 100% 0.0 99% KP209308.1
Select seq gb|KP209307.1| Middle East respiratory syndrome coronavirus strain Abu Dhabi_UAE_18_2014, complete genome 53898 53898 100% 0.0 99% KP209307.1
Select seq gb|KF600612.1| Middle East respiratory syndrome coronavirus isolate Riyadh_1_2012, complete genome 53894 53894 99% 0.0 99% KF600612.1
Select seq gb|KJ813439.1| Middle East respiratory syndrome coronavirus strain Indiana/USA-1_Saudi Arabia_2014, complete genome 53893 53893 100% 0.0 99% KJ813439.1
Select seq gb|KF961222.1| Middle East respiratory syndrome coronavirus isolate Qatar4, complete genome 53893 53893 99% 0.0 99% KF961222.1
Select seq gb|KF186564.1| Middle East respiratory syndrome coronavirus isolate Al-Hasa_4_2013, complete genome 53893 53893 99% 0.0 99% KF186564.1
Select seq gb|KP209310.1| Middle East respiratory syndrome coronavirus strain Abu Dhabi/Gayathi_UAE_2_2014, complete genome 53889 53889 100% 0.0 99% KP209310.1
Select seq gb|KF600627.1| Middle East respiratory syndrome coronavirus isolate Al-Hasa_12_2013, complete genome 53889 53889 99% 0.0 99% KF600627.1
Select seq gb|KF961221.1| Middle East respiratory syndrome coronavirus isolate Qatar3, complete genome 53885 53885 99% 0.0 99% KF961221.1
Select seq gb|KF600644.1| Middle East respiratory syndrome coronavirus isolate Al-Hasa_16_2013, complete genome 53878 53878 99% 0.0 99% KF600644.1
Select seq gb|KJ156874.1| Middle East respiratory syndrome coronavirus isolate Hafr-Al-Batin_6_2013, complete genome 53875 53875 99% 0.0 99% KJ156874.1
Select seq gb|KF600645.1| Middle East respiratory syndrome coronavirus isolate Al-Hasa_15_2013, complete genome 53875 53875 99% 0.0 99% KF600645.1
Select seq gb|KJ156910.1| Middle East respiratory syndrome coronavirus isolate Hafr-Al-Batin_2_2013, complete genome 53873 53873 99% 0.0 99% KJ156910.1
Select seq gb|KF186565.1| Middle East respiratory syndrome coronavirus isolate Al-Hasa_3_2013, complete genome 53871 53871 99% 0.0 99% KF186565.1
Select seq gb|KF600620.1| Middle East respiratory syndrome coronavirus isolate Bisha_1_2012, complete genome 53867 53867 99% 0.0 99% KF600620.1
Select seq gb|KJ156934.1| Middle East respiratory syndrome coronavirus isolate Riyadh_14_2013, complete genome 53866 53866 99% 0.0 99% KJ156934.1
Select seq gb|KM015348.1| Middle East respiratory syndrome coronavirus isolate England/2/2013, complete genome 53858 53858 99% 0.0 99% KM015348.1
Select seq gb|KF600634.1| Middle East respiratory syndrome coronavirus isolate Al-Hasa_21_2013, complete genome 53857 53857 99% 0.0 99% KF600634.1
Select seq gb|KM210278.1| Middle East respiratory syndrome coronavirus isolate England/3/2013, complete genome 53844 53844 99% 0.0 99% KM210278.1
Select seq gb|KJ156866.1| Middle East respiratory syndrome coronavirus isolate Al-Hasa_25_2013, complete genome 53840 53840 99% 0.0 99% KJ156866.1
Select seq gb|KM210277.1| Middle East respiratory syndrome coronavirus isolate England/4/2013, complete genome 53831 53831 99% 0.0 99% KM210277.1
Select seq gb|KJ156869.1| Middle East respiratory syndrome coronavirus isolate Riyadh_9_2013, complete genome 53830 53830 99% 0.0 99% KJ156869.1
Select seq gb|KJ361503.1| Middle East respiratory syndrome coronavirus isolate Hu-France - FRA2_130569-2013_Isolate_Sanger, complete genome 53815 53815 99% 0.0 99% KJ361503.1
Select seq gb|KM027256.1| Middle East respiratory syndrome coronavirus isolate Jeddah_C7569/KSA/2014-04-03, complete genome 53788 53788 99% 0.0 99% KM027256.1
Select seq gb|KM027259.1| Middle East respiratory syndrome coronavirus isolate Jeddah_C9055/KSA/2014-04-14, complete genome 53784 53784 99% 0.0 99% KM027259.1
Select seq gb|KM027255.1| Middle East respiratory syndrome coronavirus isolate Jeddah_C7149/KSA/2014-04-05, complete genome 53777 53777 99% 0.0 99% KM027255.1
Select seq gb|JX869059.2| Human betacoronavirus 2c EMC/2012, complete genome 53734 53734 100% 0.0 99% JX869059.2
Select seq gb|KM027260.1| Middle East respiratory syndrome coronavirus isolate Jeddah_C10306/KSA/2014-04-20, complete genome 53700 53700 99% 0.0 99% KM027260.1
Select seq gb|KJ614529.1| Human betacoronavirus 2c Jordan-N3/2012 isolate MG167, complete genome 53682 53682 99% 0.0 99% KJ614529.1
Select seq gb|KJ556336.1| Middle East respiratory syndrome coronavirus isolate Jeddah_1_2013, complete genome 53622 53622 99% 0.0 99% KJ556336.1
Select seq gb|KM027261.1| Middle East respiratory syndrome coronavirus isolate Makkah_C9355/KSA/Makkah/2014-04-15, complete genome 53588 53588 99% 0.0 99% KM027261.1
Select seq gb|KM027258.1| Middle East respiratory syndrome coronavirus isolate Jeddah_C8826/KSA/2014-04-12, complete genome 53582 53582 99% 0.0 99% KM027258.1
Select seq gb|KC776174.1| Human betacoronavirus 2c Jordan-N3/2012, complete genome 53582 53582 99% 0.0 99% KC776174.1
Select seq gb|KF745068.1| Middle East respiratory syndrome coronavirus isolate FRA/UAE, complete genome 53559 53559 99% 0.0 99% KF745068.1
Select seq gb|KM027262.1| Middle East respiratory syndrome coronavirus isolate Riyadh_2014KSA_683/KSA/2014, complete genome 53514 53514 99% 0.0 99% KM027262.1
Select seq gb|KF917527.1| Middle East respiratory syndrome coronavirus isolate MERS-CoV-Jeddah-Camel-1, complete genome 53512 53512 99% 0.0 99% KF917527.1
Select seq gb|KM027257.1| Middle East respiratory syndrome coronavirus isolate Jeddah_C7770/KSA/2014-04-07, complete genome 53510 53510 98% 0.0 99% KM027257.1
Select seq gb|KJ361501.1| Middle East respiratory syndrome coronavirus isolate Hu-France - FRA2_130569-2013_IS_HTS, complete genome 53417 53417 99% 0.0 99% KJ361501.1
Select seq gb|KJ477102.1| Middle East respiratory syndrome coronavirus, complete genome 53115 53115 99% 0.0 99% KJ477102.1
Select seq gb|KP719933.1| Middle East respiratory syndrome coronavirus isolate Camel/UAE/D1209/2014, complete genome 52948 52948 98% 0.0 99% KP719933.1
Select seq gb|KP719931.1| Middle East respiratory syndrome coronavirus isolate Camel/UAE/D1339.2/2014, complete genome 52930 52930 98% 0.0 99% KP719931.1
Select seq gb|KP719932.1| Middle East respiratory syndrome coronavirus isolate Camel/UAE/D1243.12/2014, complete genome 52924 52924 98% 0.0 99% KP719932.1
Select seq gb|KP719930.1| Middle East respiratory syndrome coronavirus isolate Camel/UAE/D1164.14/2014, complete genome 52924 52924 98% 0.0 99% KP719930.1
Select seq gb|KP719928.1| Middle East respiratory syndrome coronavirus isolate Camel/UAE/D1164.10/2014, complete genome 52915 52915 98% 0.0 99% KP719928.1
Select seq gb|KP719927.1| Middle East respiratory syndrome coronavirus isolate Camel/UAE/D1164.9/2014, complete genome 52915 52915 98% 0.0 99% KP719927.1
Select seq gb|KP719929.1| Middle East respiratory syndrome coronavirus isolate Camel/UAE/D1164.11/2014, complete genome 52913 52913 98% 0.0 99% KP719929.1
Select seq gb|KJ361500.1| Middle East respiratory syndrome coronavirus isolate Hu-France (UAE) - FRA1_1627-2013_BAL_Sanger, complete genome 52436 52436 97% 0.0 99% KJ361500.1
Select seq gb|KJ156916.1| Middle East respiratory syndrome coronavirus isolate Madinah_3b_2013, partial genome 50145 50145 92% 0.0 99% KJ156916.1
Select seq gb|KJ156942.1| Middle East respiratory syndrome coronavirus isolate Riyadh_8b_2013, partial genome 49572 49572 91% 0.0 99% KJ156942.1
Select seq gb|KJ361499.1| Middle East respiratory syndrome coronavirus isolate Hu-France (UAE) - FRA1_1627-2013_BAL_HTS, partial genome 46035 51825 96% 0.0 99% KJ361499.1
Select seq gb|KJ361502.1| Middle East respiratory syndrome coronavirus isolate Hu-France - FRA2_130569-2013_InSpu_Sanger, complete genome 41808 53247 98% 0.0 99% KJ361502.1
Select seq gb|KJ156937.1| Middle East respiratory syndrome coronavirus isolate Riyadh_7a_2013 ORF1ab gene, partial cds; and ORF1a gene, complete cds 34514 34514 64% 0.0 99% KJ156937.1
Select seq gb|KJ156891.1| Middle East respiratory syndrome coronavirus isolate Riyadh_10a_2013 ORF1ab gene, partial cds; and ORF1a gene, complete cds 34323 34323 63% 0.0 99% KJ156891.1
Select seq gb|KJ156946.1| Middle East respiratory syndrome coronavirus isolate Riyadh_11a_2013 ORF1ab gene, partial cds; and ORF1a gene, complete cds 34288 34288 63% 0.0 99% KJ156946.1
Select seq gb|KJ156888.1| Middle East respiratory syndrome coronavirus isolate Riyadh_13a_2013 ORF1ab gene, partial cds; and ORF1a gene, complete cds 33774 33774 62% 0.0 99% KJ156888.1
Select seq gb|KJ156926.1| Middle East respiratory syndrome coronavirus isolate Riyadh_12a_2013 ORF1ab gene, partial cds; and ORF1a gene, complete cds 33295 33295 61% 0.0 99% KJ156926.1
Select seq gb|KJ156941.1| Middle East respiratory syndrome coronavirus isolate Al-Hasa_26b_2013 ORF1ab gene, partial cds 33255 33255 61% 0.0 99% KJ156941.1
Select seq gb|KF600655.1| Middle East respiratory syndrome coronavirus isolate Al-Hasa_7a_2013, partial genome 33176 33176 61% 0.0 99% KF600655.1
Select seq gb|KJ156943.1| Middle East respiratory syndrome coronavirus isolate Al-Hasa_27a_2013 ORF1ab gene, partial cds; and ORF1a gene, complete cds 33159 33159 61% 0.0 99% KJ156943.1
Select seq gb|KJ156918.1| Middle East respiratory syndrome coronavirus isolate Riyadh_17a_2013 ORF1ab gene, partial cds; and ORF1a gene, complete cds 33154 33154 61% 0.0 99% KJ156918.1
Select seq gb|KJ156896.1| Middle East respiratory syndrome coronavirus isolate Taif_2a_2013 ORF1ab gene, partial cds; and ORF1a gene, complete cds 32782 32782 60% 0.0 99% KJ156896.1
Select seq gb|KF600643.1| Middle East respiratory syndrome coronavirus isolate Al-Hasa_14b_2013, partial genome 28573 28573 53% 0.0 99% KF600643.1
Select seq gb|KF600636.1| Middle East respiratory syndrome coronavirus isolate Al-Hasa_11c_2013, partial genome 27686 27686 51% 0.0 99% KF600636.1
Select seq gb|KC869678.4| Coronavirus Neoromicia/PML-PHE1/RSA/2011, complete genome 27470 35004 93% 0.0 88% KC869678.4
Select seq gb|KF600626.1| Middle East respiratory syndrome coronavirus isolate Al-Hasa_8c_2013, partial genome 20788 20788 38% 0.0 99% KF600626.1

_________________
www.twitter.com/hniman


Top
 Profile  
 
Display posts from previous:  Sort by  
Post new topic Reply to topic  [ 11 posts ]  Go to page 1, 2  Next

All times are UTC - 5 hours [ DST ]


Who is online

Users browsing this forum: Google [Bot], Yahoo [Bot] and 62 guests


You cannot post new topics in this forum
You cannot reply to topics in this forum
You cannot edit your posts in this forum
You cannot delete your posts in this forum
You cannot post attachments in this forum

Search for:
Jump to:  
cron
Powered by phpBB® Forum Software © phpBB Group