Rhiza Labs FluTracker Forum

The place to discuss the flu
It is currently Mon Oct 23, 2017 7:45 am

All times are UTC - 5 hours [ DST ]




Post new topic Reply to topic  [ 18 posts ]  Go to page 1, 2  Next
Author Message
PostPosted: Tue Feb 24, 2015 11:08 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
November 28 2014 Full H5N1 Egypt Human Sequence, A/Egypt/MOH-NRC-7305/2014.

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Tue Feb 24, 2015 11:09 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
LOCUS KP702173 1750 bp cRNA linear VRL 18-FEB-2015
DEFINITION Influenza A virus (A/Egypt/MOH-NRC-7305/2014(H5N1)) segment 4
hemagglutinin (HA) gene, complete cds.
ACCESSION KP702173
VERSION KP702173.1 GI:756762839
KEYWORDS .
SOURCE Influenza A virus (A/Egypt/MOH-NRC-7305/2014(H5N1))
ORGANISM Influenza A virus (A/Egypt/MOH-NRC-7305/2014(H5N1))
Viruses; ssRNA negative-strand viruses; Orthomyxoviridae;
Influenzavirus A.
REFERENCE 1 (bases 1 to 1750)
AUTHORS El-Shesheny,R., Kayed,A.S., Kandeil,A., Kandeel,A., Refaey,S.,
Kayali,G. and Ali,M.A.
TITLE Direct Submission
JOURNAL Submitted (26-JAN-2015) Center of Scientific Excellence for
Influenza Viruses, National Research Centre, Dokki, Giza, Cairo
12311, Egypt
COMMENT GenBank Accession Numbers KP702170-KP702177 represent sequences
from the 8 segments of Influenza A virus
(A/Egypt/MOH-NRC-7305/2014(H5N1)).

##Assembly-Data-START##
Assembly Method :: DNA star lasergene v. 7.1.0
Sequencing Technology :: Sanger dideoxy sequencing
##Assembly-Data-END##
FEATURES Location/Qualifiers
source 1..1750
/organism="Influenza A virus
(A/Egypt/MOH-NRC-7305/2014(H5N1))"
/mol_type="viral cRNA"
/strain="A/Egypt/MOH-NRC-7305/2014"
/serotype="H5N1"
/host="Homo sapiens; female"
/db_xref="taxon:1605263"
/segment="4"
/country="Egypt"
/collection_date="28-Nov-2014"
/note="passage details: E1"
gene 3..1706
/gene="HA"
CDS 3..1706
/gene="HA"
/function="receptor binding and fusion protein"
/codon_start=1
/product="hemagglutinin"
/protein_id="AJM70746.1"
/db_xref="GI:756762840"
/translation="MEKIVLLLAVVSIVKSDQICIGYHANNSTEQVDTIMEKNVTVTH
AQDILEKTHNGKLCNLDGVKPLILRDCSVAGWLLGNPMCDEFLNVPEWSYIVEKINPA
NDLCYPGNFNDYEELKHLLSRINHFEKIQIIPKDSWSDHEASGVSSACPYQGRSSFFR
NVVWLTKKNDAYPTIKKSYNNTNQEDLLVLWGIHHPNDAAEQTRLYQNPTTYISVGTS
TLNQRLVPKIATRSKVNGQSGRMEFFWTILKSNDAINFESNGNFIAPENAYKIVKKGD
STIMKSELEYSNCNTKCQTPIGAINSSMPFHNIHPLTIGECPKYVKSNRLVLATGLRN
SPQGEKRRKKRGLFGAIAGFIEGGWQGMVDGWYGYHHSNEQGSGYAADKESTQRAIDG
VTNKVNSIIDKMNTQFEAVGREFNNLERRIENLNKKMEDGFLDVWTYNAELLVLMENE
RTLDFHDSNVKNLYDKVRLQLRDNAKELGNGCFEFYHRCDNECMENVRNGTYDYPQYS
EEARLKREEISGVKLESIGTYQILSIYSTVASSLALAIMVAGLSLWMCSNGSLQCRIC
I"
sig_peptide 3..50
/gene="HA"
mat_peptide 51..1037
/gene="HA"
/product="HA1"
mat_peptide 1038..1703
/gene="HA"
/product="HA2"
ORIGIN
1 aaatggagaa aatagtgctt cttcttgcag tagtcagtat tgttaaaagt gatcagattt
61 gcattggtta ccatgcaaac aactcgacag agcaggttga cacaataatg gaaaagaatg
121 tcactgttac acacgcccaa gacatactgg aaaagacaca caacgggaaa ctctgcaatc
181 tagatggagt gaagcctctc attttgagag attgtagtgt agctggatgg ctcctcggga
241 acccaatgtg cgatgaattc ctcaatgtgc cggaatggtc ttacatagtg gagaaaatca
301 atccagccaa tgacctctgt tatccaggga atttcaacga ctatgaagaa ctgaaacacc
361 tattgagcag aataaaccat tttgagaaaa ttcagatcat tcccaaagat tcttggtcag
421 atcatgaagc ctcgggagtg agctcagcat gcccatacca aggaagatcc tcctttttta
481 gaaatgttgt atggcttacc aaaaagaacg atgcataccc aacaataaag aaaagttaca
541 ataatactaa ccaagaagat cttttggtac tatgggggat tcaccatcca aatgatgctg
601 cagagcagac aaggctttat caaaacccaa ctacctatat ctccgttggg acatcaacac
661 taaaccagag attggtaccc aaaatagcta ctagatctaa ggtaaacggg caaagtggaa
721 ggatggagtt cttttggaca attttaaaat cgaatgatgc aataaacttt gagagcaatg
781 gaaacttcat tgctccagaa aatgcataca aaattgtcaa gaaaggagat tcaacaatta
841 tgaaaagtga gttggaatat agtaactgca acaccaagtg tcagactcca ataggggcga
901 taaactccag tatgccattc cacaacatcc accctctcac catcggggaa tgccccaaat
961 atgtgaaatc aaacagatta gtccttgcta ctgggctcag gaatagccct caaggagaga
1021 aaagaagaaa aaagagagga ctattcggag ccatagcagg ctttatagag ggaggatggc
1081 agggaatggt agatggttgg tatgggtacc accatagcaa cgagcagggg agtgggtacg
1141 ctgcagacaa agaatccact caaagggcta tagatggagt caccaataag gtcaattcga
1201 tcattgacaa aatgaacact cagtttgagg ctgttggaag ggaatttaat aacttagaaa
1261 ggagaataga aaatttaaac aagaagatgg aagacggatt cctagatgtc tggacttata
1321 atgctgaact tctggttctc atggaaaatg agagaactct agactttcat gactcaaatg
1381 tcaagaatct ttatgacaag gtccgactac agcttaggga taatgcaaag gagcttggta
1441 acggttgttt cgagttctat cacagatgtg ataatgaatg tatggaaaat gtaagaaacg
1501 gaacgtatga ctaccctcaa tattcagaag aagcaagatt aaaaagagag gaaataagtg
1561 gagtaaaatt ggagtcaata ggaacttacc aaatactgtc aatttattca acagtggcga
1621 gctccctagc actggcaatc atggtggctg gtctatcttt atggatgtgc tccaatggat
1681 cgctacaatg cagaatttgc atttaaattt gtgagttcaa attgtagtta aaaacaccct
1741 tgtttctact

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Tue Feb 24, 2015 11:13 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
EPI500079 A/goose/Egypt/M7221D/2013 (A/H5N1) segment 4 (HA) 3037.0 0.000000e+00 1684/1704 (98%)
EPI500078 A/chicken/Egypt/M7217A/2013 (A/H5N1) segment 4 (HA) 3037.0 0.000000e+00 1684/1704 (98%)
EPI487342 A/chicken/Egypt/M7217B/2013 (A/H5N1) segment 4 (HA) 3037.0 0.000000e+00 1684/1704 (98%)
EPI500109 A/chicken/Egypt/Q5283C/2012 (A/H5N1) segment 4 (HA) 3022.2 0.000000e+00 1681/1704 (98%)
EPI504991 A/chicken/Egypt/BSU-BS-R24/2012 (A/H5N1) segment 4 (HA) 3020.4 0.000000e+00 1681/1704 (98%)
EPI504990 A/chicken/Egypt/BSU-BS-F27/2012 (A/H5N1) segment 4 (HA) 3020.4 0.000000e+00 1681/1704 (98%)
EPI500082 A/duck/Egypt/M7218B/2013 (A/H5N1) segment 4 (HA) 3020.4 0.000000e+00 1682/1705 (98%)
EPI348153 A/chicken/Egypt/11VIR4453-266/2010 (A/H5N1) segment 4 (HA) 3016.7 0.000000e+00 1680/1704 (98%)
EPI340133 A/goose/Egypt/1117SF/2011 (A/H5N1) segment 4 (HA) 3014.9 0.000000e+00 1680/1704 (98%)
EPI340135 A/chicken/Egypt/1113/2011 (A/H5N1) segment 4 (HA) 3009.3 0.000000e+00 1679/1704 (98%)
EPI338733 A/duck/Egypt/M2583B/2010 (A/H5N1) segment 4 (HA) 3009.3 0.000000e+00 1680/1705 (98%)
EPI338732 A/duck/Egypt/M2583C/2010 (A/H5N1) segment 4 (HA) 3009.3 0.000000e+00 1680/1705 (98%)
EPI338616 A/duck/Egypt/M2583D/2010 (A/H5N1) segment 4 (HA) 3009.3 0.000000e+00 1680/1705 (98%)
EPI372907 A/Egypt/N7562/2011 (A/H5N1) segment 4 (HA) 3003.8 0.000000e+00 1679/1705 (98%)
EPI348152 A/chicken/Egypt/11VIR4453-268/2010 (A/H5N1) segment 4 (HA) 3003.8 0.000000e+00 1678/1704 (98%)
EPI340138 A/duck/Egypt/1125S/2011 (A/H5N1) segment 4 (HA) 3003.8 0.000000e+00 1678/1704 (98%)
EPI340101 A/chicken/Egypt/1112AF/2011 (A/H5N1) segment 4 (HA) 3003.8 0.000000e+00 1678/1704 (98%)
EPI340087 A/duck/Egypt/11193SF/2011 (A/H5N1) segment 4 (HA) 3003.8 0.000000e+00 1678/1704 (98%)
EPI340085 A/chicken/Egypt/1118AF/2011 (A/H5N1) segment 4 (HA) 3003.8 0.000000e+00 1678/1704 (98%)
EPI338615 A/duck/Egypt/Q2645C/2010 (A/H5N1) segment 4 (HA) 3003.8 0.000000e+00 1678/1704 (98%)
EPI373013 A/Egypt/N00166/2011 (A/H5N1) segment 4 (HA) 2998.2 0.000000e+00 1678/1705 (98%)
EPI340151 A/chicken/Egypt/10513S/2010 (A/H5N1) segment 4 (HA) 2998.2 0.000000e+00 1677/1704 (98%)
EPI340104 A/chicken/Egypt/117AD/2011 (A/H5N1) segment 4 (HA) 2998.2 0.000000e+00 1677/1704 (98%)
EPI348158 A/chicken/Egypt/11VIR4453-109/VRLCU/2011 (A/H5N1) segment 4 (HA) 2996.4 0.000000e+00 1676/1703 (98%)
EPI373020 A/Egypt/N08932/2010 (A/H5N1) segment 4 (HA) 2994.5 0.000000e+00 1676/1704 (98%)
EPI348160 A/chicken/Egypt/11VIR4453-267/2010 (A/H5N1) segment 4 (HA) 2994.5 0.000000e+00 1675/1702 (98%)
EPI348157 A/chicken/Egypt/11VIR4453-15/VRLCU/2010 (A/H5N1) segment 4 (HA) 2994.5 0.000000e+00 1675/1702 (98%)
EPI348156 A/chicken/Egypt11VIR4453-269/2010 (A/H5N1) segment 4 (HA) 2994.5 0.000000e+00 1675/1703 (98%)
EPI373016 A/Egypt/N10954/2010 (A/H5N1) segment 4 (HA) 2992.7 0.000000e+00 1676/1704 (98%)
EPI340106 A/duck/Egypt/1110AF/2011 (A/H5N1) segment 4 (HA) 2992.7 0.000000e+00 1676/1704 (98%)
EPI340103 A/chicken/Egypt/111766V/2011 (A/H5N1) segment 4 (HA) 2992.7 0.000000e+00 1676/1704 (98%)
EPI340092 A/chicken/Egypt/1155/2011 (A/H5N1) segment 4 (HA) 2992.7 0.000000e+00 1676/1704 (98%)
EPI338618 A/duck/Egypt/M2583A/2010 (A/H5N1) segment 4 (HA) 2992.7 0.000000e+00 1677/1705 (98%)
EPI338610 A/duck/Egypt/M3075B/2011 (A/H5N1) segment 4 (HA) 2992.7 0.000000e+00 1677/1705 (98%)
EPI340118 A/chicken/Egypt/1158SF/2011 (A/H5N1) segment 4 (HA) 2989.0 0.000000e+00 1678/1707 (98%)
EPI537618 A/Egypt/N01754/2014 (A/H5N1) segment 4 (HA) 2987.2 0.000000e+00 1675/1704 (98%)
EPI373012 A/Egypt/N04286/2011 (A/H5N1) segment 4 (HA) 2987.2 0.000000e+00 1675/1704 (98%)
EPI373011 A/Egypt/N04288/2011 (A/H5N1) segment 4 (HA) 2987.2 0.000000e+00 1675/1704 (98%)
EPI372963 A/Egypt/N10621/2011 (A/H5N1) segment 4 (HA) 2987.2 0.000000e+00 1675/1704 (98%)
EPI372875 A/Egypt/N0677/2011 (A/H5N1) segment 4 (HA) 2987.2 0.000000e+00 1676/1705 (98%)
EPI340165 A/duck/Egypt/10228SF/2010 (A/H5N1) segment 4 (HA) 2987.2 0.000000e+00 1675/1704 (98%)
EPI340154 A/duck/Egypt/10118/2010 (A/H5N1) segment 4 (HA) 2987.2 0.000000e+00 1676/1705 (98%)
EPI340141 A/chicken/Egypt/112SG/2011 (A/H5N1) segment 4 (HA) 2987.2 0.000000e+00 1675/1704 (98%)
EPI340136 A/chicken/Egypt/1112/2011 (A/H5N1) segment 4 (HA) 2987.2 0.000000e+00 1675/1704 (98%)
EPI340131 A/chicken/Egypt/1117/2011 (A/H5N1) segment 4 (HA) 2987.2 0.000000e+00 1675/1704 (98%)
EPI340122 A/chicken/Egypt/1128/2011 (A/H5N1) segment 4 (HA) 2987.2 0.000000e+00 1675/1704 (98%)
EPI340107 A/chicken/Egypt/11184S/2011 (A/H5N1) segment 4 (HA) 2987.2 0.000000e+00 1676/1705 (98%)
EPI340102 A/chicken/Egypt/1134SD/2011 (A/H5N1) segment 4 (HA) 2987.2 0.000000e+00 1675/1704 (98%)
EPI340091 A/duck/Egypt/11117SS/2011 (A/H5N1) segment 4 (HA) 2987.2 0.000000e+00 1675/1704 (98%)
EPI373017 A/Egypt/N05860/2011 (A/H5N1) segment 4 (HA) 2983.5 0.000000e+00 1674/1704 (98%)
EPI348151 A/chicken/Egypt/11VIR4453-270/2010 (A/H5N1) segment 4 (HA) 2983.5 0.000000e+00 1670/1698 (98%)
EPI537617 A/Egypt/N01753/2014 (A/H5N1) segment 4 (HA) 2981.6 0.000000e+00 1673/1703 (98%)
EPI397334 A/duck/Egypt/1111sg/2011 (A/H5N1) segment 4 (HA) 2981.6 0.000000e+00 1674/1704 (98%)
EPI393783 A/Egypt/N00951/2012 (A/H5N1) segment 4 (HA) 2981.6 0.000000e+00 1674/1704 (98%)
EPI373015 A/Egypt/N04284/2011 (A/H5N1) segment 4 (HA) 2981.6 0.000000e+00 1674/1704 (98%)
EPI372851 A/Egypt/N0544/2011 (A/H5N1) segment 4 (HA) 2981.6 0.000000e+00 1674/1704 (98%)
EPI340126 A/chicken/Egypt/112AF/2011 (A/H5N1) segment 4 (HA) 2981.6 0.000000e+00 1674/1704 (98%)
EPI340124 A/chicken/Egypt/114AF/2011 (A/H5N1) segment 4 (HA) 2981.6 0.000000e+00 1674/1704 (98%)
EPI340123 A/chicken/Egypt/115AF/2011 (A/H5N1) segment 4 (HA) 2981.6 0.000000e+00 1674/1704 (98%)
EPI340121 A/chicken/Egypt/1146SF/2011 (A/H5N1) segment 4 (HA) 2981.6 0.000000e+00 1674/1704 (98%)
EPI340119 A/duck/Egypt/1148SF/2011 (A/H5N1) segment 4 (HA) 2981.6 0.000000e+00 1674/1704 (98%)
EPI340100 A/duck/Egypt/11211S/2011 (A/H5N1) segment 4 (HA) 2981.6 0.000000e+00 1674/1704 (98%)
EPI340094 A/duck/Egypt/1116AF/2011 (A/H5N1) segment 4 (HA) 2981.6 0.000000e+00 1674/1704 (98%)
EPI338614 A/chicken/Egypt/M2773A/2011 (A/H5N1) segment 4 (HA) 2981.6 0.000000e+00 1674/1704 (98%)
EPI338609 A/chicken/Egypt/S3280B/2011 (A/H5N1) segment 4 (HA) 2981.6 0.000000e+00 1675/1705 (98%)
EPI336862 A/turkey/Jenin/341/2011 (A/H5N1) segment 4 (HA) 2981.6 0.000000e+00 1674/1704 (98%)
EPI538767 A/chicken/Egypt/13VIR-2962-109/2013 (A/H5N1) segment 4 (HA) 2979.8 0.000000e+00 1665/1691 (98%)
EPI372923 A/Egypt/N7724/2011 (A/H5N1) segment 4 (HA) 2977.9 0.000000e+00 1673/1704 (98%)
EPI369189 A/chicken/Egypt/1188/2011 (A/H5N1) segment 4 (HA) 2977.9 0.000000e+00 1674/1705 (98%)
EPI493430 A/chicken/Egypt/S3280E/2011 (A/H5N1) segment 4 (HA) 2976.1 0.000000e+00 1674/1705 (98%)
EPI393786 A/Egypt/N02137/2012 (A/H5N1) segment 4 (HA) 2976.1 0.000000e+00 1673/1704 (98%)
EPI373019 A/Egypt/N04285/2011 (A/H5N1) segment 4 (HA) 2976.1 0.000000e+00 1673/1704 (98%)
EPI373018 A/Egypt/N00002/2011 (A/H5N1) segment 4 (HA) 2976.1 0.000000e+00 1673/1704 (98%)
EPI372859 A/Egypt/N6322/2011 (A/H5N1) segment 4 (HA) 2976.1 0.000000e+00 1673/1704 (98%)
EPI369181 A/chicken/Egypt/1176/2011 (A/H5N1) segment 4 (HA) 2976.1 0.000000e+00 1673/1704 (98%)
EPI369180 A/duck/Egypt/1120SMF/2011 (A/H5N1) segment 4 (HA) 2976.1 0.000000e+00 1673/1704 (98%)
EPI340173 A/chicken/Egypt/1021AD/2010 (A/H5N1) segment 4 (HA) 2976.1 0.000000e+00 1673/1704 (98%)
EPI340160 A/chicken/Egypt/10250SF/2010 (A/H5N1) segment 4 (HA) 2976.1 0.000000e+00 1673/1704 (98%)
EPI340127 A/chicken/Egypt/111AF/2011 (A/H5N1) segment 4 (HA) 2976.1 0.000000e+00 1673/1704 (98%)
EPI340109 A/chicken/Egypt/111640V/2011 (A/H5N1) segment 4 (HA) 2976.1 0.000000e+00 1673/1704 (98%)
EPI340082 A/quail/Egypt/1171SG/2011 (A/H5N1) segment 4 (HA) 2976.1 0.000000e+00 1673/1704 (98%)
EPI338731 A/goose/Egypt/M2794E/2011 (A/H5N1) segment 4 (HA) 2976.1 0.000000e+00 1673/1704 (98%)
EPI338613 A/goose/Egypt/M2788A/2011 (A/H5N1) segment 4 (HA) 2976.1 0.000000e+00 1673/1704 (98%)
EPI338612 A/goose/Egypt/M2788E/2011 (A/H5N1) segment 4 (HA) 2976.1 0.000000e+00 1673/1704 (98%)
EPI338611 A/goose/Egypt/M2794A/2011 (A/H5N1) segment 4 (HA) 2976.1 0.000000e+00 1673/1704 (98%)
EPI460395 A/chicken/Egypt/1094/2010 (A/H5N1) segment 4 (HA) 2974.2 0.000000e+00 1666/1694 (98%)
EPI348155 A/chicken/Egypt/11VIR4453-68/VRLCU/2011 (A/H5N1) segment 4 (HA) 2974.2 0.000000e+00 1664/1691 (98%)
EPI373022 A/Egypt/N09407/2010 (A/H5N1) segment 4 (HA) 2970.5 0.000000e+00 1672/1704 (98%)
EPI372867 A/Egypt/N6658/2011 (A/H5N1) segment 4 (HA) 2970.5 0.000000e+00 1672/1704 (98%)
EPI340152 A/duck/Egypt/10290SF/2010 (A/H5N1) segment 4 (HA) 2970.5 0.000000e+00 1672/1704 (98%)
EPI340149 A/duck/Egypt/10336SF/2010 (A/H5N1) segment 4 (HA) 2970.5 0.000000e+00 1672/1704 (98%)
EPI340147 A/chicken/Egypt/10132/2010 (A/H5N1) segment 4 (HA) 2970.5 0.000000e+00 1672/1704 (98%)
EPI340134 A/duck/Egypt/1113SD/2011 (A/H5N1) segment 4 (HA) 2970.5 0.000000e+00 1672/1704 (98%)
EPI340129 A/chicken/Egypt/1174S/2011 (A/H5N1) segment 4 (HA) 2970.5 0.000000e+00 1672/1704 (98%)
EPI340116 A/chicken/Egypt/116AF/2011 (A/H5N1) segment 4 (HA) 2970.5 0.000000e+00 1673/1705 (98%)
EPI340115 A/duck/Egypt/1174SF/2011 (A/H5N1) segment 4 (HA) 2970.5 0.000000e+00 1672/1704 (98%)
EPI340099 A/duck/Egypt/1153/2011 (A/H5N1) segment 4 (HA) 2970.5 0.000000e+00 1672/1704 (98%)
EPI340096 A/chicken/Egypt/111945V/2011 (A/H5N1) segment 4 (HA) 2970.5 0.000000e+00 1672/1704 (98%)
EPI338608 A/chicken/Egypt/S3280D/2011 (A/H5N1) segment 4 (HA) 2970.5 0.000000e+00 1673/1705 (98%)
EPI348154 A/chicken/Egypt/11VIR4453-264/2010 (A/H5N1) segment 4 (HA) 2968.7 0.000000e+00 1671/1704 (98%)

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Tue Feb 24, 2015 11:15 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
EPI538814 A/chicken/Egypt/13VIR-2962-203/2013 (A/H5N1) segment 6 (NA) 2427.6 0.000000e+00 1337/1349 (99%)
EPI538798 A/chicken/Egypt/13VIR-2962-199/2013 (A/H5N1) segment 6 (NA) 2427.6 0.000000e+00 1337/1349 (99%)
EPI493506 A/chicken/Egypt/Q5283C/2012 (A/H5N1) segment 6 (NA) 2427.6 0.000000e+00 1338/1350 (99%)
EPI538790 A/chicken/Egypt/13VIR-2962-198/2013 (A/H5N1) segment 6 (NA) 2425.8 0.000000e+00 1337/1349 (99%)
EPI504999 A/chicken/Egypt/BSU-BS-R24/2012 (A/H5N1) segment 6 (NA) 2414.7 0.000000e+00 1335/1349 (98%)
EPI504998 A/chicken/Egypt/BSU-BS-F27/2012 (A/H5N1) segment 6 (NA) 2414.7 0.000000e+00 1335/1349 (98%)
EPI504997 A/chicken/Egypt/BSU-FA-M28/2012 (H5N1) (A/H5N1) segment 6 (NA) 2414.7 0.000000e+00 1335/1349 (98%)
EPI536596 A/Egypt/N01753/2014 (A/H5N1) segment 6 (NA) 2411.0 0.000000e+00 1335/1350 (98%)
EPI493446 A/chicken/Egypt/M7217B/2013 (A/H5N1) segment 6 (NA) 2411.0 0.000000e+00 1335/1350 (98%)
EPI538774 A/duck/Egypt/13VIR-2962-195/2013 (A/H5N1) segment 6 (NA) 2405.5 0.000000e+00 1333/1349 (98%)
EPI537619 A/Egypt/N01754/2014 (A/H5N1) segment 6 (NA) 2405.5 0.000000e+00 1334/1350 (98%)
EPI493559 A/chicken/Egypt/M2773A/2011 (A/H5N1) segment 6 (NA) 2405.5 0.000000e+00 1334/1350 (98%)
EPI538782 A/duck/Egypt/13VIR-2962-196/2013 (A/H5N1) segment 6 (NA) 2403.6 0.000000e+00 1333/1349 (98%)
EPI493499 A/chicken/Egypt/S2938D/2011 (A/H5N1) segment 6 (NA) 2399.9 0.000000e+00 1333/1350 (98%)
EPI493432 A/chicken/Egypt/S3280E/2011 (A/H5N1) segment 6 (NA) 2394.4 0.000000e+00 1332/1350 (98%)
EPI493398 A/chicken/Egypt/S3280D/2011 (A/H5N1) segment 6 (NA) 2394.4 0.000000e+00 1332/1350 (98%)
EPI372850 A/Egypt/N0544/2011 (A/H5N1) segment 6 (NA) 2394.4 0.000000e+00 1332/1350 (98%)
EPI336859 A/turkey/Jenin/341/2011 (A/H5N1) segment 6 (NA) 2394.4 0.000000e+00 1332/1350 (98%)
EPI387566 A/duck/Egypt/1113SD/2011 (A/H5N1) segment 6 (NA) 2392.5 0.000000e+00 1331/1349 (98%)
EPI372890 A/Egypt/N6828/2011 (A/H5N1) segment 6 (NA) 2390.7 0.000000e+00 1331/1350 (98%)
EPI538822 A/chicken/Egypt/13VIR-2962-204/2013 (A/H5N1) segment 6 (NA) 2388.8 0.000000e+00 1327/1345 (98%)
EPI493356 A/duck/Egypt/M2583D/2010 (A/H5N1) segment 6 (NA) 2388.8 0.000000e+00 1331/1350 (98%)
EPI493348 A/chicken/Egypt/S3280B/2011 (A/H5N1) segment 6 (NA) 2388.8 0.000000e+00 1331/1350 (98%)
EPI493342 A/goose/Egypt/M2794A/2011 (A/H5N1) segment 6 (NA) 2388.8 0.000000e+00 1331/1350 (98%)
EPI493279 A/duck/Egypt/M2583A/2010 (A/H5N1) segment 6 (NA) 2388.8 0.000000e+00 1331/1350 (98%)
EPI493207 A/goose/Egypt/M2788A/2011 (A/H5N1) segment 6 (NA) 2388.8 0.000000e+00 1331/1350 (98%)
EPI493194 A/duck/Egypt/M2583B/2010 (A/H5N1) segment 6 (NA) 2388.8 0.000000e+00 1331/1350 (98%)
EPI493056 A/duck/Egypt/M2583C/2010 (A/H5N1) segment 6 (NA) 2388.8 0.000000e+00 1331/1350 (98%)
EPI372882 A/Egypt/N6774/2011 (A/H5N1) segment 6 (NA) 2385.1 0.000000e+00 1330/1350 (98%)
EPI493363 A/goose/Egypt/M2788E/2011 (A/H5N1) segment 6 (NA) 2383.3 0.000000e+00 1330/1350 (98%)
EPI493127 A/duck/Egypt/M3075B/2011 (A/H5N1) segment 6 (NA) 2383.3 0.000000e+00 1330/1350 (98%)
EPI372866 A/Egypt/N6658/2011 (A/H5N1) segment 6 (NA) 2383.3 0.000000e+00 1330/1350 (98%)
EPI538766 A/chicken/Egypt/13VIR-2962-109/2013 (A/H5N1) segment 6 (NA) 2381.5 0.000000e+00 1329/1349 (98%)
EPI372874 A/Egypt/N0677/2011 (A/H5N1) segment 6 (NA) 2377.8 0.000000e+00 1329/1350 (98%)
EPI255419 A/Egypt/N14604/2009 (A/H5N1) segment 6 (NA) 2377.8 0.000000e+00 1329/1350 (98%)
EPI538806 A/chicken/Egypt/13VIR-2962-200/2013 (A/H5N1) segment 6 (NA) 2375.9 0.000000e+00 1311/1324 (99%)
EPI372922 A/Egypt/N7724/2011 (A/H5N1) segment 6 (NA) 2374.1 0.000000e+00 1328/1350 (98%)
EPI393784 A/Egypt/N00951/2012 (A/H5N1) segment 6 (NA) 2372.2 0.000000e+00 1328/1350 (98%)
EPI372962 A/Egypt/N10621/2011 (A/H5N1) segment 6 (NA) 2372.2 0.000000e+00 1328/1350 (98%)
EPI387571 A/chicken/Egypt/1158SF/2011 (A/H5N1) segment 6 (NA) 2370.4 0.000000e+00 1327/1349 (98%)
EPI460396 A/chicken/Egypt/1094/2010 (A/H5N1) segment 6 (NA) 2368.5 0.000000e+00 1322/1342 (98%)
EPI393787 A/Egypt/N02137/2012 (A/H5N1) segment 6 (NA) 2366.7 0.000000e+00 1327/1350 (98%)
EPI372914 A/Egypt/N7592/2011 (A/H5N1) segment 6 (NA) 2366.7 0.000000e+00 1327/1350 (98%)
EPI372858 A/Egypt/N6322/2011 (A/H5N1) segment 6 (NA) 2366.7 0.000000e+00 1327/1350 (98%)
EPI338186 A/harrier/Israel/531/2011 (A/H5N1) segment 6 (NA) 2366.7 0.000000e+00 1328/1351 (98%)
EPI255372 A/Egypt/N02127/2010 (A/H5N1) segment 6 (NA) 2366.7 0.000000e+00 1327/1350 (98%)
EPI493067 A/chicken/Egypt/S3093A/2011 (A/H5N1) segment 6 (NA) 2361.1 0.000000e+00 1326/1350 (98%)
EPI372938 A/Egypt/N11126/2011 (A/H5N1) segment 6 (NA) 2361.1 0.000000e+00 1326/1350 (98%)
EPI372930 A/Egypt/N09966/2011 (A/H5N1) segment 6 (NA) 2361.1 0.000000e+00 1326/1350 (98%)
EPI372906 A/Egypt/N7562/2011 (A/H5N1) segment 6 (NA) 2361.1 0.000000e+00 1326/1350 (98%)
EPI255399 A/Egypt/N09174/2009 (A/H5N1) segment 6 (NA) 2361.1 0.000000e+00 1326/1350 (98%)
EPI255368 A/Egypt/N01982/2010 (A/H5N1) segment 6 (NA) 2361.1 0.000000e+00 1326/1350 (98%)
EPI493471 A/goose/Egypt/M2794E/2011 (A/H5N1) segment 6 (NA) 2355.6 0.000000e+00 1325/1350 (98%)
EPI372954 A/Egypt/N14976/2011 (A/H5N1) segment 6 (NA) 2355.6 0.000000e+00 1326/1351 (98%)
EPI372946 A/Egypt/N11470/2011 (A/H5N1) segment 6 (NA) 2355.6 0.000000e+00 1326/1351 (98%)
EPI294611 A/chicken/Egypt/3982-20/2010 (A/H5N1) segment 6 (NA) 2353.8 0.000000e+00 1324/1349 (98%)
EPI294490 A/chicken/Egypt/1553-15/2010 (A/H5N1) segment 6 (NA) 2353.8 0.000000e+00 1324/1349 (98%)
EPI493531 A/duck/Egypt/Q2645C/2010 (A/H5N1) segment 6 (NA) 2350.1 0.000000e+00 1324/1350 (98%)
EPI493169 A/duck/Egypt/Q4596A/2012 (A/H5N1) segment 6 (NA) 2350.1 0.000000e+00 1324/1350 (98%)
EPI493154 A/duck/Egypt/Q4596B/2012 (A/H5N1) segment 6 (NA) 2350.1 0.000000e+00 1324/1350 (98%)
EPI398580 A/duck/Egypt/Q4596D/2012 (A/H5N1) segment 6 (NA) 2350.1 0.000000e+00 1324/1350 (98%)
EPI255387 A/Egypt/N05049/2009 (A/H5N1) segment 6 (NA) 2350.1 0.000000e+00 1324/1350 (98%)
EPI255376 A/Egypt/N02770/2010 (A/H5N1) segment 6 (NA) 2350.1 0.000000e+00 1324/1350 (98%)
EPI372714 A/Egypt/9538-NAMRU3/2009 (A/H5N1) segment 6 (NA) 2346.4 0.000000e+00 1323/1350 (98%)
EPI294576 A/chicken/Egypt/3982-9/2010 (A/H5N1) segment 6 (NA) 2342.7 0.000000e+00 1322/1349 (97%)
EPI387567 A/goose/Egypt/1117SF/2011 (A/H5N1) segment 6 (NA) 2340.8 0.000000e+00 1299/1315 (98%)
EPI387570 A/duck/Egypt/1148SF/2011 (A/H5N1) segment 6 (NA) 2339.0 0.000000e+00 1304/1323 (98%)
EPI294569 A/chicken/Egypt/3982-5/2010 (A/H5N1) segment 6 (NA) 2335.3 0.000000e+00 1316/1342 (98%)
EPI493424 A/chicken/Egypt/S3806B/2011 (A/H5N1) segment 6 (NA) 2333.4 0.000000e+00 1321/1350 (97%)
EPI493404 A/chicken/Egypt/S3802B/2011 (A/H5N1) segment 6 (NA) 2333.4 0.000000e+00 1321/1350 (97%)
EPI493080 A/chicken/Egypt/S3806D/2011 (A/H5N1) segment 6 (NA) 2333.4 0.000000e+00 1321/1350 (97%)
EPI398574 A/duck/Egypt/Q4596C/2012 (A/H5N1) segment 6 (NA) 2333.4 0.000000e+00 1321/1350 (97%)
EPI255395 A/Egypt/N08835/2009 (A/H5N1) segment 6 (NA) 2333.4 0.000000e+00 1321/1350 (97%)
EPI255393 A/Egypt/N07908/2009 (A/H5N1) segment 6 (NA) 2333.4 0.000000e+00 1321/1350 (97%)
EPI255370 A/Egypt/N02038/2010 (A/H5N1) segment 6 (NA) 2333.4 0.000000e+00 1321/1350 (97%)
EPI255362 A/Egypt/N00270/2010 (A/H5N1) segment 6 (NA) 2333.4 0.000000e+00 1321/1350 (97%)
EPI504996 A/duck/Egypt/BSU-FA-1D/2012 (A/H5N1) segment 6 (NA) 2331.6 0.000000e+00 1320/1349 (97%)
EPI306404 A/duck/Egypt/09184SM-NLQP/2009 (A/H5N1) segment 6 (NA) 2331.6 0.000000e+00 1320/1349 (97%)
EPI184805 A/Egypt/N00585/2009 (A/H5N1) segment 6 (NA) 2331.6 0.000000e+00 1320/1349 (97%)
EPI538758 A/chicken/Egypt/13VIR-2962-24/2013 (A/H5N1) segment 6 (NA) 2327.9 0.000000e+00 1320/1349 (97%)
EPI184817 A/Egypt/N02563/2009 (A/H5N1) segment 6 (NA) 2326.1 0.000000e+00 1319/1349 (97%)
EPI184815 A/Egypt/N02407/2009 (A/H5N1) segment 6 (NA) 2326.1 0.000000e+00 1319/1349 (97%)
EPI184803 A/Egypt/N00001/2009 (A/H5N1) segment 6 (NA) 2326.1 0.000000e+00 1319/1349 (97%)
EPI255378 A/Egypt/N03071/2010 (A/H5N1) segment 6 (NA) 2322.4 0.000000e+00 1319/1350 (97%)
EPI255374 A/Egypt/N02554/2010 (A/H5N1) segment 6 (NA) 2322.4 0.000000e+00 1319/1350 (97%)
EPI504993 A/chicken/Egypt/BSU-BS-R8/2009 (A/H5N1) segment 6 (NA) 2320.5 0.000000e+00 1318/1349 (97%)
EPI255380 A/Egypt/N03072/2010 (A/H5N1) segment 6 (NA) 2320.5 0.000000e+00 1318/1349 (97%)
EPI184838 A/Egypt/N04396/2009 (A/H5N1) segment 6 (NA) 2320.5 0.000000e+00 1318/1349 (97%)
EPI184833 A/Egypt/N04316/2009 (A/H5N1) segment 6 (NA) 2320.5 0.000000e+00 1318/1349 (97%)
EPI184829 A/Egypt/N03439/2009 (A/H5N1) segment 6 (NA) 2320.5 0.000000e+00 1318/1349 (97%)
EPI184823 A/Egypt/N03272/2009 (A/H5N1) segment 6 (NA) 2320.5 0.000000e+00 1318/1349 (97%)
EPI184821 A/Egypt/N03228/2009 (A/H5N1) segment 6 (NA) 2320.5 0.000000e+00 1318/1349 (97%)
EPI307130 A/duck/Egypt/1011d/2010 (A/H5N1) segment 6 (NA) 2315.0 0.000000e+00 1301/1325 (98%)
EPI307118 A/chicken/Egypt/1034/2010 (A/H5N1) segment 6 (NA) 2315.0 0.000000e+00 1301/1325 (98%)
EPI307114 A/chicken/Egypt/10189s/2010 (A/H5N1) segment 6 (NA) 2315.0 0.000000e+00 1305/1331 (98%)
EPI255421 A/Egypt/N15262/2009 (A/H5N1) segment 6 (NA) 2315.0 0.000000e+00 1317/1349 (97%)
EPI184836 A/Egypt/N04395/2009 (A/H5N1) segment 6 (NA) 2315.0 0.000000e+00 1317/1349 (97%)
EPI184811 A/Egypt/N01310/2009 (A/H5N1) segment 6 (NA) 2315.0 0.000000e+00 1317/1349 (97%)
EPI184807 A/Egypt/N00605/2009 (A/H5N1) segment 6 (NA) 2315.0 0.000000e+00 1317/1349 (97%)
EPI504995 A/chicken/Egypt/BSU-BS-R10/2009 (A/H5N1) segment 6 (NA) 2309.4 0.000000e+00 1316/1349 (97%)

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Tue Feb 24, 2015 11:16 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
EPI493357 A/duck/Egypt/M2583D/2010 (A/H5N1) segment 7 (MP) 1772.1 0.000000e+00 973/980 (99%)
EPI493328 A/duck/Egypt/M2583A/2010 (A/H5N1) segment 7 (MP) 1772.1 0.000000e+00 973/980 (99%)
EPI493195 A/duck/Egypt/M2583B/2010 (A/H5N1) segment 7 (MP) 1772.1 0.000000e+00 973/980 (99%)
EPI493058 A/duck/Egypt/M2583C/2010 (A/H5N1) segment 7 (MP) 1772.1 0.000000e+00 973/980 (99%)
EPI493507 A/chicken/Egypt/Q5283C/2012 (A/H5N1) segment 7 (MP) 1768.4 0.000000e+00 973/981 (99%)
EPI493566 A/duck/Egypt/S6419C/2012 (A/H5N1) segment 7 (MP) 1766.5 0.000000e+00 972/980 (99%)
EPI493447 A/chicken/Egypt/M7217B/2013 (A/H5N1) segment 7 (MP) 1766.5 0.000000e+00 972/980 (99%)
EPI493036 A/turkey/Egypt/S6405A/2012 (A/H5N1) segment 7 (MP) 1766.5 0.000000e+00 972/980 (99%)
EPI398179 A/chicken/Giza/CAI26/2011 (A/H5) segment 7 (MP) 1766.5 0.000000e+00 972/980 (99%)
EPI493472 A/goose/Egypt/M2794E/2011 (A/H5N1) segment 7 (MP) 1761.0 0.000000e+00 971/980 (99%)
EPI493364 A/goose/Egypt/M2788E/2011 (A/H5N1) segment 7 (MP) 1761.0 0.000000e+00 971/980 (99%)
EPI493500 A/chicken/Egypt/S2938D/2011 (A/H5N1) segment 7 (MP) 1755.4 0.000000e+00 970/980 (98%)
EPI493418 A/duck/Egypt/Q4596D/2012 (A/H5N1) segment 7 (MP) 1755.4 0.000000e+00 970/980 (98%)
EPI493170 A/duck/Egypt/Q4596A/2012 (A/H5N1) segment 7 (MP) 1755.4 0.000000e+00 970/980 (98%)
EPI493155 A/duck/Egypt/Q4596B/2012 (A/H5N1) segment 7 (MP) 1755.4 0.000000e+00 970/980 (98%)
EPI493068 A/chicken/Egypt/S3093A/2011 (A/H5N1) segment 7 (MP) 1755.4 0.000000e+00 970/980 (98%)
EPI393788 A/Egypt/N02137/2012 (A/H5N1) segment 7 (MP) 1753.6 0.000000e+00 963/970 (99%)
EPI372854 A/Egypt/N6322/2011 (A/H5N1) segment 7 (MP) 1753.6 0.000000e+00 963/970 (99%)
EPI493532 A/duck/Egypt/Q2645C/2010 (A/H5N1) segment 7 (MP) 1749.9 0.000000e+00 969/980 (98%)
EPI372846 A/Egypt/N0544/2011 (A/H5N1) segment 7 (MP) 1748.1 0.000000e+00 962/970 (99%)
EPI493433 A/chicken/Egypt/S3280E/2011 (A/H5N1) segment 7 (MP) 1744.4 0.000000e+00 968/980 (98%)
EPI493425 A/chicken/Egypt/S3806B/2011 (A/H5N1) segment 7 (MP) 1744.4 0.000000e+00 968/980 (98%)
EPI493405 A/chicken/Egypt/S3802B/2011 (A/H5N1) segment 7 (MP) 1744.4 0.000000e+00 968/980 (98%)
EPI493121 A/chicken/Egypt/S3806D/2011 (A/H5N1) segment 7 (MP) 1744.4 0.000000e+00 968/980 (98%)
EPI538778 A/duck/Egypt/13VIR-2962-196/2013 (A/H5N1) segment 7 (MP) 1742.5 0.000000e+00 961/970 (99%)
EPI438244 A/duck/Egypt/M3075B/2011 (A/H5N1) segment 7 (MP) 1742.5 0.000000e+00 961/970 (99%)
EPI438242 A/goose/Egypt/M2788A/2011 (A/H5N1) segment 7 (MP) 1742.5 0.000000e+00 961/970 (99%)
EPI438240 A/goose/Egypt/M2794A/2011 (A/H5N1) segment 7 (MP) 1742.5 0.000000e+00 961/970 (99%)
EPI374700 A/chicken/Egypt/M2773A/2011 (A/H5N1) segment 7 (MP) 1742.5 0.000000e+00 961/970 (99%)
EPI372910 A/Egypt/N7592/2011 (A/H5N1) segment 7 (MP) 1742.5 0.000000e+00 961/970 (99%)
EPI372886 A/Egypt/N6828/2011 (A/H5N1) segment 7 (MP) 1742.5 0.000000e+00 961/970 (99%)
EPI372878 A/Egypt/N6774/2011 (A/H5N1) segment 7 (MP) 1742.5 0.000000e+00 961/970 (99%)
EPI372870 A/Egypt/N0677/2011 (A/H5N1) segment 7 (MP) 1742.5 0.000000e+00 961/970 (99%)
EPI372862 A/Egypt/N6658/2011 (A/H5N1) segment 7 (MP) 1742.5 0.000000e+00 961/970 (99%)
EPI372730 A/Egypt/9174-NAMRU3/2009 (A/H5N1) segment 7 (MP) 1742.5 0.000000e+00 961/970 (99%)
EPI372710 A/Egypt/9538-NAMRU3/2009 (A/H5N1) segment 7 (MP) 1742.5 0.000000e+00 961/970 (99%)
EPI294607 A/chicken/Egypt/3982-20/2010 (A/H5N1) segment 7 (MP) 1742.5 0.000000e+00 961/970 (99%)
EPI372902 A/Egypt/N7562/2011 (A/H5N1) segment 7 (MP) 1738.8 0.000000e+00 959/968 (99%)
EPI538802 A/chicken/Egypt/13VIR-2962-200/2013 (A/H5N1) segment 7 (MP) 1737.0 0.000000e+00 960/970 (98%)
EPI393785 A/Egypt/N00951/2012 (A/H5N1) segment 7 (MP) 1737.0 0.000000e+00 960/970 (98%)
EPI393224 A/chicken/Egypt/1034/2010 (A/H5N1) segment 7 (MP) 1737.0 0.000000e+00 960/970 (98%)
EPI372926 A/Egypt/N09966/2011 (A/H5N1) segment 7 (MP) 1737.0 0.000000e+00 960/970 (98%)
EPI372816 A/Egypt/N02038/2010 (A/H5N1) segment 7 (MP) 1737.0 0.000000e+00 960/970 (98%)
EPI538818 A/chicken/Egypt/13VIR-2962-204/2013 (A/H5N1) segment 7 (MP) 1731.4 0.000000e+00 959/970 (98%)
EPI538786 A/chicken/Egypt/13VIR-2962-198/2013 (A/H5N1) segment 7 (MP) 1731.4 0.000000e+00 957/967 (98%)
EPI393174 A/chicken/Egypt/11669S/2011 (A/H5N1) segment 7 (MP) 1731.4 0.000000e+00 959/970 (98%)
EPI372918 A/Egypt/N7724/2011 (A/H5N1) segment 7 (MP) 1731.4 0.000000e+00 959/970 (98%)
EPI372828 A/Egypt/N02554/2010 (A/H5N1) segment 7 (MP) 1731.4 0.000000e+00 959/970 (98%)
EPI372822 A/Egypt/N02127/2010 (A/H5N1) segment 7 (MP) 1731.4 0.000000e+00 959/970 (98%)
EPI294649 A/poultry/Egypt/3982-55/2010 (A/H5N1) segment 7 (MP) 1731.4 0.000000e+00 959/970 (98%)
EPI294465 A/chicken/Egypt/1553-1/2010 (A/H5N1) segment 7 (MP) 1731.4 0.000000e+00 959/970 (98%)
EPI538770 A/duck/Egypt/13VIR-2962-195/2013 (A/H5N1) segment 7 (MP) 1729.6 0.000000e+00 955/965 (98%)
EPI438243 A/chicken/Egypt/S3280D/2011 (A/H5N1) segment 7 (MP) 1725.9 0.000000e+00 958/970 (98%)
EPI438239 A/chicken/Egypt/S3280B/2011 (A/H5N1) segment 7 (MP) 1725.9 0.000000e+00 958/970 (98%)
EPI372958 A/Egypt/N10621/2011 (A/H5N1) segment 7 (MP) 1725.9 0.000000e+00 958/970 (98%)
EPI372934 A/Egypt/N11126/2011 (A/H5N1) segment 7 (MP) 1725.9 0.000000e+00 958/970 (98%)
EPI372834 A/Egypt/N03071/2010 (A/H5N1) segment 7 (MP) 1725.9 0.000000e+00 958/970 (98%)
EPI372724 A/Egypt/9539-NAMRU3/2009 (A/H5N1) segment 7 (MP) 1725.9 0.000000e+00 958/970 (98%)
EPI372704 A/Egypt/0585-NAMRU3/2009 (A/H5N1) segment 7 (MP) 1725.9 0.000000e+00 958/970 (98%)
EPI372698 A/Egypt/0001-NAMRU3/2009 (A/H5N1) segment 7 (MP) 1725.9 0.000000e+00 958/970 (98%)
EPI372674 A/Egypt/0605-NAMRU3/2009 (A/H5N1) segment 7 (MP) 1725.9 0.000000e+00 958/970 (98%)
EPI294628 A/chicken/Egypt/3982-44/2010 (A/H5N1) segment 7 (MP) 1725.9 0.000000e+00 958/970 (98%)
EPI538762 A/chicken/Egypt/13VIR-2962-109/2013 (A/H5N1) segment 7 (MP) 1722.2 0.000000e+00 954/965 (98%)
EPI393216 A/chicken/Egypt/0894-NLQP/2008 (A/H5N1) segment 7 (MP) 1720.4 0.000000e+00 957/970 (98%)
EPI372950 A/Egypt/N14976/2011 (A/H5N1) segment 7 (MP) 1720.4 0.000000e+00 957/970 (98%)
EPI372942 A/Egypt/N11470/2011 (A/H5N1) segment 7 (MP) 1720.4 0.000000e+00 957/970 (98%)
EPI372774 A/Egypt/4396-NAMRU3/2009 (A/H5N1) segment 7 (MP) 1720.4 0.000000e+00 957/970 (98%)
EPI372768 A/Egypt/3228-NAMRU3/2009 (A/H5N1) segment 7 (MP) 1720.4 0.000000e+00 957/970 (98%)
EPI372692 A/Egypt/2039-NAMRU3/2009 (A/H5N1) segment 7 (MP) 1720.4 0.000000e+00 957/970 (98%)
EPI372686 A/Egypt/1310-NAMRU3/2009 (A/H5N1) segment 7 (MP) 1720.4 0.000000e+00 957/970 (98%)
EPI393225 A/chicken/Egypt/0987-NLQP/2009 (A/H5N1) segment 7 (MP) 1714.8 0.000000e+00 956/970 (98%)
EPI393175 A/chicken/Egypt/11316SS/2011 (A/H5N1) segment 7 (MP) 1714.8 0.000000e+00 956/970 (98%)
EPI372810 A/Egypt/N01982/2010 (A/H5N1) segment 7 (MP) 1714.8 0.000000e+00 956/970 (98%)
EPI372786 A/Egypt/3450-NAMRU3/2009 (A/H5N1) segment 7 (MP) 1714.8 0.000000e+00 956/970 (98%)
EPI372762 A/Egypt/2563-NAMRU3/2009 (A/H5N1) segment 7 (MP) 1714.8 0.000000e+00 956/970 (98%)
EPI372748 A/Egypt/4935-NAMRU3/2009 (A/H5N1) segment 7 (MP) 1714.8 0.000000e+00 956/970 (98%)
EPI294572 A/chicken/Egypt/3982-9/2010 (A/H5N1) segment 7 (MP) 1713.0 0.000000e+00 947/957 (98%)
EPI372680 A/Egypt/0606-NAMRU3/2009 (A/H5N1) segment 7 (MP) 1709.3 0.000000e+00 955/970 (98%)
EPI294544 A/chicken/Egypt/3982-2/2010 (A/H5N1) segment 7 (MP) 1709.3 0.000000e+00 951/964 (98%)
EPI538794 A/chicken/Egypt/13VIR-2962-199/2013 (A/H5N1) segment 7 (MP) 1707.4 0.000000e+00 944/954 (98%)
EPI372804 A/Egypt/N01644/2010 (A/H5N1) segment 7 (MP) 1703.7 0.000000e+00 956/972 (98%)
EPI372792 A/Egypt/N11981/2009 (A/H5N1) segment 7 (MP) 1703.7 0.000000e+00 956/972 (98%)
EPI372780 A/Egypt/4394-NAMRU3/2009 (A/H5N1) segment 7 (MP) 1703.7 0.000000e+00 954/970 (98%)
EPI294656 A/poultry/Egypt/3982-56/2010 (A/H5N1) segment 7 (MP) 1701.9 0.000000e+00 943/954 (98%)
EPI372798 A/Egypt/N01360/2010 (A/H5N1) segment 7 (MP) 1700.0 0.000000e+00 953/970 (98%)
EPI314345 A/duck/Egypt/D2br10/2007 (A/H5N1) segment 7 (MP) 1700.0 0.000000e+00 960/980 (97%)
EPI225829 A/chicken/Gaza/714/2006 (A/H5N1) segment 7 (MP) 1700.0 0.000000e+00 960/980 (97%)
EPI225823 A/chicken/Gaza/450/2006 (A/H5N1) segment 7 (MP) 1700.0 0.000000e+00 960/980 (97%)
EPI132177 A/turkey/Israel/364/2006 (A/H5N1) segment 7 (MP) 1700.0 0.000000e+00 960/980 (97%)
EPI132174 A/turkey/Israel/345/2006 (A/H5N1) segment 7 (MP) 1700.0 0.000000e+00 960/980 (97%)
EPI58621 A/chicken/Egypt/2253-1/2006 (A/H5N1) segment 7 (MP) 1700.0 0.000000e+00 960/980 (97%)
EPI372756 A/Egypt/2752-NAMRU3/2009 (A/H5N1) segment 7 (MP) 1698.2 0.000000e+00 953/970 (98%)
EPI294565 A/chicken/Egypt/3982-5/2010 (A/H5N1) segment 7 (MP) 1694.5 0.000000e+00 941/953 (98%)
EPI294479 A/chicken/Egypt/1553-13/2010 (A/H5N1) segment 7 (MP) 1694.5 0.000000e+00 937/947 (98%)
EPI225069 A/duck/Egypt/2253-3/2006 (A/H5N1) segment 7 (MP) 1694.5 0.000000e+00 959/980 (97%)
EPI132186 A/chicken/Israel/625/2006 (A/H5N1) segment 7 (MP) 1694.5 0.000000e+00 959/980 (97%)
EPI132180 A/turkey/Israel/446/2006 (A/H5N1) segment 7 (MP) 1694.5 0.000000e+00 959/980 (97%)
EPI393223 A/chicken/Egypt/101604v/2010 (A/H5N1) segment 7 (MP) 1692.7 0.000000e+00 952/970 (98%)
EPI372840 A/Egypt/N03072/2010 (A/H5N1) segment 7 (MP) 1692.7 0.000000e+00 954/972 (98%)
EPI372576 A/Egypt/394-NAMRU3/2007 (A/H5N1) segment 7 (MP) 1692.7 0.000000e+00 952/970 (98%)

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Tue Feb 24, 2015 11:19 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
EPI493442 A/chicken/Egypt/M7217B/2013 (A/H5N1) segment 1 (PB2) 4095.1 0.000000e+00 2261/2282 (99%)
EPI493502 A/chicken/Egypt/Q5283C/2012 (A/H5N1) segment 1 (PB2) 4084.1 0.000000e+00 2259/2282 (98%)
EPI493352 A/duck/Egypt/M2583D/2010 (A/H5N1) segment 1 (PB2) 4039.7 0.000000e+00 2251/2282 (98%)
EPI493275 A/duck/Egypt/M2583A/2010 (A/H5N1) segment 1 (PB2) 4039.7 0.000000e+00 2251/2282 (98%)
EPI493053 A/duck/Egypt/M2583C/2010 (A/H5N1) segment 1 (PB2) 4039.7 0.000000e+00 2251/2282 (98%)
EPI493551 A/chicken/Egypt/M2773A/2011 (A/H5N1) segment 1 (PB2) 4034.2 0.000000e+00 2250/2282 (98%)
EPI493528 A/duck/Egypt/Q2645C/2010 (A/H5N1) segment 1 (PB2) 4028.7 0.000000e+00 2249/2282 (98%)
EPI493494 A/chicken/Egypt/S2938D/2011 (A/H5N1) segment 1 (PB2) 4028.7 0.000000e+00 2249/2282 (98%)
EPI493190 A/duck/Egypt/M2583B/2010 (A/H5N1) segment 1 (PB2) 4028.7 0.000000e+00 2249/2282 (98%)
EPI493122 A/duck/Egypt/M3075B/2011 (A/H5N1) segment 1 (PB2) 4028.7 0.000000e+00 2249/2282 (98%)
EPI493391 A/chicken/Egypt/S3280E/2011 (A/H5N1) segment 1 (PB2) 4023.1 0.000000e+00 2248/2282 (98%)
EPI493345 A/chicken/Egypt/S3280B/2011 (A/H5N1) segment 1 (PB2) 4023.1 0.000000e+00 2248/2282 (98%)
EPI493395 A/chicken/Egypt/S3280D/2011 (A/H5N1) segment 1 (PB2) 4017.6 0.000000e+00 2247/2282 (98%)
EPI372848 A/Egypt/N0544/2011 (A/H5N1) segment 1 (PB2) 4017.6 0.000000e+00 2247/2282 (98%)
EPI493339 A/goose/Egypt/M2794A/2011 (A/H5N1) segment 1 (PB2) 4012.0 0.000000e+00 2246/2282 (98%)
EPI493203 A/goose/Egypt/M2788A/2011 (A/H5N1) segment 1 (PB2) 4012.0 0.000000e+00 2246/2282 (98%)
EPI372912 A/Egypt/N7592/2011 (A/H5N1) segment 1 (PB2) 4012.0 0.000000e+00 2246/2282 (98%)
EPI372864 A/Egypt/N6658/2011 (A/H5N1) segment 1 (PB2) 4008.4 0.000000e+00 2245/2282 (98%)
EPI493475 A/goose/Egypt/M2794E/2011 (A/H5N1) segment 1 (PB2) 4006.5 0.000000e+00 2245/2282 (98%)
EPI372888 A/Egypt/N6828/2011 (A/H5N1) segment 1 (PB2) 4006.5 0.000000e+00 2245/2282 (98%)
EPI372880 A/Egypt/N6774/2011 (A/H5N1) segment 1 (PB2) 4006.5 0.000000e+00 2245/2282 (98%)
EPI372812 A/Egypt/N01982/2010 (A/H5N1) segment 1 (PB2) 4006.5 0.000000e+00 2245/2282 (98%)
EPI493359 A/goose/Egypt/M2788E/2011 (A/H5N1) segment 1 (PB2) 4001.0 0.000000e+00 2244/2282 (98%)
EPI372928 A/Egypt/N09966/2011 (A/H5N1) segment 1 (PB2) 4001.0 0.000000e+00 2244/2282 (98%)
EPI372904 A/Egypt/N7562/2011 (A/H5N1) segment 1 (PB2) 4001.0 0.000000e+00 2244/2282 (98%)
EPI372872 A/Egypt/N0677/2011 (A/H5N1) segment 1 (PB2) 4001.0 0.000000e+00 2244/2282 (98%)
EPI538788 A/chicken/Egypt/13VIR-2962-198/2013 (A/H5N1) segment 1 (PB2) 3997.3 0.000000e+00 2205/2225 (99%)
EPI538796 A/chicken/Egypt/13VIR-2962-199/2013 (A/H5N1) segment 1 (PB2) 3995.4 0.000000e+00 2204/2224 (99%)
EPI372952 A/Egypt/N14976/2011 (A/H5N1) segment 1 (PB2) 3995.4 0.000000e+00 2243/2282 (98%)
EPI372944 A/Egypt/N11470/2011 (A/H5N1) segment 1 (PB2) 3995.4 0.000000e+00 2243/2282 (98%)
EPI372920 A/Egypt/N7724/2011 (A/H5N1) segment 1 (PB2) 3995.4 0.000000e+00 2243/2282 (98%)
EPI372856 A/Egypt/N6322/2011 (A/H5N1) segment 1 (PB2) 3995.4 0.000000e+00 2243/2282 (98%)
EPI372824 A/Egypt/N02127/2010 (A/H5N1) segment 1 (PB2) 3995.4 0.000000e+00 2243/2282 (98%)
EPI372732 A/Egypt/9174-NAMRU3/2009 (A/H5N1) segment 1 (PB2) 3995.4 0.000000e+00 2243/2282 (98%)
EPI538804 A/chicken/Egypt/13VIR-2962-200/2013 (A/H5N1) segment 1 (PB2) 3993.6 0.000000e+00 2203/2223 (99%)
EPI493415 A/duck/Egypt/Q4596D/2012 (A/H5N1) segment 1 (PB2) 3989.9 0.000000e+00 2242/2282 (98%)
EPI493165 A/duck/Egypt/Q4596A/2012 (A/H5N1) segment 1 (PB2) 3989.9 0.000000e+00 2242/2282 (98%)
EPI493149 A/duck/Egypt/Q4596B/2012 (A/H5N1) segment 1 (PB2) 3989.9 0.000000e+00 2242/2282 (98%)
EPI372936 A/Egypt/N11126/2011 (A/H5N1) segment 1 (PB2) 3989.9 0.000000e+00 2242/2282 (98%)
EPI538812 A/chicken/Egypt/13VIR-2962-203/2013 (A/H5N1) segment 1 (PB2) 3988.0 0.000000e+00 2200/2220 (99%)
EPI493420 A/chicken/Egypt/S3806B/2011 (A/H5N1) segment 1 (PB2) 3984.3 0.000000e+00 2241/2282 (98%)
EPI493400 A/chicken/Egypt/S3802B/2011 (A/H5N1) segment 1 (PB2) 3984.3 0.000000e+00 2241/2282 (98%)
EPI493076 A/chicken/Egypt/S3806D/2011 (A/H5N1) segment 1 (PB2) 3984.3 0.000000e+00 2241/2282 (98%)
EPI372712 A/Egypt/9538-NAMRU3/2009 (A/H5N1) segment 1 (PB2) 3982.5 0.000000e+00 2240/2282 (98%)
EPI372960 A/Egypt/N10621/2011 (A/H5N1) segment 1 (PB2) 3978.8 0.000000e+00 2240/2282 (98%)
EPI538820 A/chicken/Egypt/13VIR-2962-204/2013 (A/H5N1) segment 1 (PB2) 3967.7 0.000000e+00 2196/2219 (98%)
EPI493063 A/chicken/Egypt/S3093A/2011 (A/H5N1) segment 1 (PB2) 3967.7 0.000000e+00 2238/2282 (98%)
EPI538764 A/chicken/Egypt/13VIR-2962-109/2013 (A/H5N1) segment 1 (PB2) 3951.1 0.000000e+00 2197/2225 (98%)
EPI372726 A/Egypt/9539-NAMRU3/2009 (A/H5N1) segment 1 (PB2) 3951.1 0.000000e+00 2235/2282 (97%)
EPI372706 A/Egypt/0585-NAMRU3/2009 (A/H5N1) segment 1 (PB2) 3940.0 0.000000e+00 2233/2282 (97%)
EPI294481 A/chicken/Egypt/1553-13/2010 (A/H5N1) segment 1 (PB2) 3938.2 0.000000e+00 2212/2251 (98%)
EPI372830 A/Egypt/N02554/2010 (A/H5N1) segment 1 (PB2) 3936.3 0.000000e+00 2232/2282 (97%)
EPI538780 A/duck/Egypt/13VIR-2962-196/2013 (A/H5N1) segment 1 (PB2) 3934.5 0.000000e+00 2190/2219 (98%)
EPI538772 A/duck/Egypt/13VIR-2962-195/2013 (A/H5N1) segment 1 (PB2) 3934.5 0.000000e+00 2190/2219 (98%)
EPI372836 A/Egypt/N03071/2010 (A/H5N1) segment 1 (PB2) 3934.5 0.000000e+00 2232/2282 (97%)
EPI372818 A/Egypt/N02038/2010 (A/H5N1) segment 1 (PB2) 3934.5 0.000000e+00 2232/2282 (97%)
EPI294609 A/chicken/Egypt/3982-20/2010 (A/H5N1) segment 1 (PB2) 3932.6 0.000000e+00 2217/2260 (98%)
EPI493561 A/duck/Egypt/S6419C/2012 (A/H5N1) segment 1 (PB2) 3917.9 0.000000e+00 2230/2283 (97%)
EPI493031 A/turkey/Egypt/S6405A/2012 (A/H5N1) segment 1 (PB2) 3917.9 0.000000e+00 2230/2283 (97%)
EPI372700 A/Egypt/0001-NAMRU3/2009 (A/H5N1) segment 1 (PB2) 3912.3 0.000000e+00 2228/2282 (97%)
EPI372694 A/Egypt/2039-NAMRU3/2009 (A/H5N1) segment 1 (PB2) 3912.3 0.000000e+00 2228/2282 (97%)
EPI372688 A/Egypt/1310-NAMRU3/2009 (A/H5N1) segment 1 (PB2) 3912.3 0.000000e+00 2228/2282 (97%)
EPI294658 A/poultry/Egypt/3982-56/2010 (A/H5N1) segment 1 (PB2) 3908.6 0.000000e+00 2202/2244 (98%)
EPI372676 A/Egypt/0605-NAMRU3/2009 (A/H5N1) segment 1 (PB2) 3906.8 0.000000e+00 2227/2282 (97%)
EPI372764 A/Egypt/2563-NAMRU3/2009 (A/H5N1) segment 1 (PB2) 3904.9 0.000000e+00 2226/2282 (97%)
EPI294651 A/poultry/Egypt/3982-55/2010 (A/H5N1) segment 1 (PB2) 3903.1 0.000000e+00 2201/2244 (98%)
EPI372770 A/Egypt/3228-NAMRU3/2009 (A/H5N1) segment 1 (PB2) 3895.7 0.000000e+00 2226/2283 (97%)
EPI372750 A/Egypt/4935-NAMRU3/2009 (A/H5N1) segment 1 (PB2) 3895.7 0.000000e+00 2225/2282 (97%)
EPI372782 A/Egypt/4394-NAMRU3/2009 (A/H5N1) segment 1 (PB2) 3893.9 0.000000e+00 2224/2282 (97%)
EPI294467 A/chicken/Egypt/1553-1/2010 (A/H5N1) segment 1 (PB2) 3888.3 0.000000e+00 2207/2257 (97%)
EPI372806 A/Egypt/N01644/2010 (A/H5N1) segment 1 (PB2) 3884.6 0.000000e+00 2223/2282 (97%)
EPI372794 A/Egypt/N11981/2009 (A/H5N1) segment 1 (PB2) 3884.6 0.000000e+00 2223/2282 (97%)
EPI372788 A/Egypt/3450-NAMRU3/2009 (A/H5N1) segment 1 (PB2) 3879.1 0.000000e+00 2222/2282 (97%)
EPI372682 A/Egypt/0606-NAMRU3/2009 (A/H5N1) segment 1 (PB2) 3879.1 0.000000e+00 2222/2282 (97%)
EPI372842 A/Egypt/N03072/2010 (A/H5N1) segment 1 (PB2) 3873.5 0.000000e+00 2221/2282 (97%)
EPI372800 A/Egypt/N01360/2010 (A/H5N1) segment 1 (PB2) 3862.5 0.000000e+00 2218/2281 (97%)
EPI294574 A/chicken/Egypt/3982-9/2010 (A/H5N1) segment 1 (PB2) 3853.2 0.000000e+00 2170/2211 (98%)
EPI372758 A/Egypt/2752-NAMRU3/2009 (A/H5N1) segment 1 (PB2) 3845.8 0.000000e+00 2218/2284 (97%)
EPI372896 A/Egypt/N0423/2011 (A/H5N1) segment 1 (PB2) 3840.3 0.000000e+00 2215/2282 (97%)
EPI372776 A/Egypt/4396-NAMRU3/2009 (A/H5N1) segment 1 (PB2) 3840.3 0.000000e+00 2213/2281 (97%)
EPI294546 A/chicken/Egypt/3982-2/2010 (A/H5N1) segment 1 (PB2) 3840.3 0.000000e+00 2167/2210 (98%)
EPI372578 A/Egypt/394-NAMRU3/2007 (A/H5N1) segment 1 (PB2) 3829.2 0.000000e+00 2214/2283 (96%)
EPI294581 A/duck/Egypt/3982-12/2010 (A/H5N1) segment 1 (PB2) 3820.0 0.000000e+00 2165/2213 (97%)
EPI294567 A/chicken/Egypt/3982-5/2010 (A/H5N1) segment 1 (PB2) 3801.5 0.000000e+00 2148/2192 (97%)
EPI259615 A/duck/Egypt/D1Br22/2007 (A/H5N1) segment 1 (PB2) 3801.5 0.000000e+00 2209/2283 (96%)
EPI372650 A/Egypt/2546-NAMRU3/2008 (A/H5N1) segment 1 (PB2) 3796.0 0.000000e+00 2208/2283 (96%)
EPI259616 A/duck/Egypt/D1Li216/2007 (A/H5N1) segment 1 (PB2) 3796.0 0.000000e+00 2208/2283 (96%)
EPI259614 A/duck/Egypt/D1Tr8/2007 (A/H5N1) segment 1 (PB2) 3796.0 0.000000e+00 2208/2283 (96%)
EPI154900 A/chicken/Egypt/452-2/2007 (A/H5N1) segment 1 (PB2) 3790.4 0.000000e+00 2207/2283 (96%)
EPI58655 A/turkey/Egypt/2253-2/2006 (A/H5N1) segment 1 (PB2) 3790.4 0.000000e+00 2207/2283 (96%)
EPI58636 A/chicken/Egypt/2253-1/2006 (A/H5N1) segment 1 (PB2) 3790.4 0.000000e+00 2207/2283 (96%)
EPI372644 A/Egypt/2289-NAMRU3/2008 (A/H5N1) segment 1 (PB2) 3779.4 0.000000e+00 2205/2283 (96%)
EPI352589 A/chicken/Qalubia/1/2006 (A/H5N1) segment 1 (PB2) 3779.4 0.000000e+00 2201/2278 (96%)
EPI225828 A/chicken/Gaza/450/2006 (A/H5N1) segment 1 (PB2) 3779.4 0.000000e+00 2205/2283 (96%)
EPI132252 A/turkey/Israel/345/2006 (A/H5N1) segment 1 (PB2) 3779.4 0.000000e+00 2205/2283 (96%)
EPI372590 A/Egypt/902-NAMRU3/2007 (A/H5N1) segment 1 (PB2) 3773.8 0.000000e+00 2204/2283 (96%)
EPI259618 A/duck/Egypt/D2Li218/2007 (A/H5N1) segment 1 (PB2) 3773.8 0.000000e+00 2204/2283 (96%)
EPI259617 A/duck/Egypt/D2Br212/2007 (A/H5N1) segment 1 (PB2) 3773.8 0.000000e+00 2204/2283 (96%)
EPI225834 A/chicken/Gaza/714/2006 (A/H5N1) segment 1 (PB2) 3773.8 0.000000e+00 2204/2283 (96%)
EPI152036 A/duck/Egypt/5169-1/2007 (A/H5N1) segment 1 (PB2) 3773.8 0.000000e+00 2203/2282 (96%)

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Tue Feb 24, 2015 11:23 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
EPI493503 A/chicken/Egypt/Q5283C/2012 (A/H5N1) segment 2 (PB1) 4095.1 0.000000e+00 2255/2274 (99%)
EPI538813 A/chicken/Egypt/13VIR-2962-203/2013 (A/H5N1) segment 2 (PB1) 4080.4 0.000000e+00 2247/2266 (99%)
EPI493443 A/chicken/Egypt/M7217B/2013 (A/H5N1) segment 2 (PB1) 4078.5 0.000000e+00 2252/2274 (99%)
EPI493346 A/chicken/Egypt/S3280B/2011 (A/H5N1) segment 2 (PB1) 4078.5 0.000000e+00 2252/2274 (99%)
EPI493428 A/chicken/Egypt/S3280E/2011 (A/H5N1) segment 2 (PB1) 4073.0 0.000000e+00 2251/2274 (98%)
EPI493396 A/chicken/Egypt/S3280D/2011 (A/H5N1) segment 2 (PB1) 4073.0 0.000000e+00 2251/2274 (98%)
EPI372849 A/Egypt/N0544/2011 (A/H5N1) segment 2 (PB1) 4067.4 0.000000e+00 2250/2274 (98%)
EPI538781 A/duck/Egypt/13VIR-2962-196/2013 (A/H5N1) segment 2 (PB1) 4063.7 0.000000e+00 2244/2266 (99%)
EPI538773 A/duck/Egypt/13VIR-2962-195/2013 (A/H5N1) segment 2 (PB1) 4063.7 0.000000e+00 2244/2266 (99%)
EPI493537 A/duck/Egypt/Q2645C/2010 (A/H5N1) segment 2 (PB1) 4061.9 0.000000e+00 2249/2274 (98%)
EPI493495 A/chicken/Egypt/S2938D/2011 (A/H5N1) segment 2 (PB1) 4061.9 0.000000e+00 2249/2274 (98%)
EPI493276 A/duck/Egypt/M2583A/2010 (A/H5N1) segment 2 (PB1) 4061.9 0.000000e+00 2249/2274 (98%)
EPI372929 A/Egypt/N09966/2011 (A/H5N1) segment 2 (PB1) 4061.9 0.000000e+00 2250/2275 (98%)
EPI372865 A/Egypt/N6658/2011 (A/H5N1) segment 2 (PB1) 4061.9 0.000000e+00 2249/2274 (98%)
EPI372857 A/Egypt/N6322/2011 (A/H5N1) segment 2 (PB1) 4061.9 0.000000e+00 2249/2274 (98%)
EPI493556 A/chicken/Egypt/M2773A/2011 (A/H5N1) segment 2 (PB1) 4056.4 0.000000e+00 2248/2274 (98%)
EPI493421 A/duck/Egypt/Q4596D/2012 (A/H5N1) segment 2 (PB1) 4056.4 0.000000e+00 2249/2275 (98%)
EPI493353 A/duck/Egypt/M2583D/2010 (A/H5N1) segment 2 (PB1) 4056.4 0.000000e+00 2248/2274 (98%)
EPI493191 A/duck/Egypt/M2583B/2010 (A/H5N1) segment 2 (PB1) 4056.4 0.000000e+00 2248/2274 (98%)
EPI372881 A/Egypt/N6774/2011 (A/H5N1) segment 2 (PB1) 4054.5 0.000000e+00 2247/2274 (98%)
EPI538821 A/chicken/Egypt/13VIR-2962-204/2013 (A/H5N1) segment 2 (PB1) 4052.7 0.000000e+00 2242/2266 (98%)
EPI493150 A/duck/Egypt/Q4596B/2012 (A/H5N1) segment 2 (PB1) 4050.8 0.000000e+00 2248/2275 (98%)
EPI372913 A/Egypt/N7592/2011 (A/H5N1) segment 2 (PB1) 4047.1 0.000000e+00 2246/2274 (98%)
EPI372889 A/Egypt/N6828/2011 (A/H5N1) segment 2 (PB1) 4047.1 0.000000e+00 2246/2274 (98%)
EPI493166 A/duck/Egypt/Q4596A/2012 (A/H5N1) segment 2 (PB1) 4045.3 0.000000e+00 2247/2275 (98%)
EPI493123 A/duck/Egypt/M3075B/2011 (A/H5N1) segment 2 (PB1) 4045.3 0.000000e+00 2246/2274 (98%)
EPI493054 A/duck/Egypt/M2583C/2010 (A/H5N1) segment 2 (PB1) 4039.7 0.000000e+00 2245/2274 (98%)
EPI372961 A/Egypt/N10621/2011 (A/H5N1) segment 2 (PB1) 4039.7 0.000000e+00 2245/2274 (98%)
EPI372921 A/Egypt/N7724/2011 (A/H5N1) segment 2 (PB1) 4034.2 0.000000e+00 2244/2274 (98%)
EPI372873 A/Egypt/N0677/2011 (A/H5N1) segment 2 (PB1) 4034.2 0.000000e+00 2244/2274 (98%)
EPI493468 A/goose/Egypt/M2794E/2011 (A/H5N1) segment 2 (PB1) 4028.7 0.000000e+00 2243/2274 (98%)
EPI493340 A/goose/Egypt/M2794A/2011 (A/H5N1) segment 2 (PB1) 4028.7 0.000000e+00 2243/2274 (98%)
EPI493204 A/goose/Egypt/M2788A/2011 (A/H5N1) segment 2 (PB1) 4028.7 0.000000e+00 2243/2274 (98%)
EPI372813 A/Egypt/N01982/2010 (A/H5N1) segment 2 (PB1) 4028.7 0.000000e+00 2243/2274 (98%)
EPI372953 A/Egypt/N14976/2011 (A/H5N1) segment 2 (PB1) 4023.1 0.000000e+00 2242/2274 (98%)
EPI372937 A/Egypt/N11126/2011 (A/H5N1) segment 2 (PB1) 4023.1 0.000000e+00 2242/2274 (98%)
EPI372905 A/Egypt/N7562/2011 (A/H5N1) segment 2 (PB1) 4023.1 0.000000e+00 2242/2274 (98%)
EPI372733 A/Egypt/9174-NAMRU3/2009 (A/H5N1) segment 2 (PB1) 4019.4 0.000000e+00 2241/2274 (98%)
EPI493360 A/goose/Egypt/M2788E/2011 (A/H5N1) segment 2 (PB1) 4012.0 0.000000e+00 2240/2274 (98%)
EPI372825 A/Egypt/N02127/2010 (A/H5N1) segment 2 (PB1) 4012.0 0.000000e+00 2240/2274 (98%)
EPI294547 A/chicken/Egypt/3982-2/2010 (A/H5N1) segment 2 (PB1) 4012.0 0.000000e+00 2240/2274 (98%)
EPI538789 A/chicken/Egypt/13VIR-2962-198/2013 (A/H5N1) segment 2 (PB1) 4006.5 0.000000e+00 2208/2228 (99%)
EPI372713 A/Egypt/9538-NAMRU3/2009 (A/H5N1) segment 2 (PB1) 4004.7 0.000000e+00 2238/2274 (98%)
EPI493077 A/chicken/Egypt/S3806D/2011 (A/H5N1) segment 2 (PB1) 4001.0 0.000000e+00 2238/2274 (98%)
EPI372945 A/Egypt/N11470/2011 (A/H5N1) segment 2 (PB1) 4001.0 0.000000e+00 2238/2274 (98%)
EPI372831 A/Egypt/N02554/2010 (A/H5N1) segment 2 (PB1) 4001.0 0.000000e+00 2239/2275 (98%)
EPI538797 A/chicken/Egypt/13VIR-2962-199/2013 (A/H5N1) segment 2 (PB1) 3999.1 0.000000e+00 2203/2222 (99%)
EPI538805 A/chicken/Egypt/13VIR-2962-200/2013 (A/H5N1) segment 2 (PB1) 3997.3 0.000000e+00 2203/2223 (99%)
EPI294610 A/chicken/Egypt/3982-20/2010 (A/H5N1) segment 2 (PB1) 3995.4 0.000000e+00 2233/2268 (98%)
EPI294575 A/chicken/Egypt/3982-9/2010 (A/H5N1) segment 2 (PB1) 3991.7 0.000000e+00 2236/2274 (98%)
EPI493562 A/duck/Egypt/S6419C/2012 (A/H5N1) segment 2 (PB1) 3989.9 0.000000e+00 2237/2275 (98%)
EPI493401 A/chicken/Egypt/S3802B/2011 (A/H5N1) segment 2 (PB1) 3989.9 0.000000e+00 2237/2275 (98%)
EPI493032 A/turkey/Egypt/S6405A/2012 (A/H5N1) segment 2 (PB1) 3989.9 0.000000e+00 2237/2275 (98%)
EPI493427 A/chicken/Egypt/S3806B/2011 (A/H5N1) segment 2 (PB1) 3984.3 0.000000e+00 2235/2274 (98%)
EPI294482 A/chicken/Egypt/1553-13/2010 (A/H5N1) segment 2 (PB1) 3984.3 0.000000e+00 2230/2267 (98%)
EPI294659 A/poultry/Egypt/3982-56/2010 (A/H5N1) segment 2 (PB1) 3980.7 0.000000e+00 2234/2274 (98%)
EPI372837 A/Egypt/N03071/2010 (A/H5N1) segment 2 (PB1) 3978.8 0.000000e+00 2235/2275 (98%)
EPI294652 A/poultry/Egypt/3982-55/2010 (A/H5N1) segment 2 (PB1) 3973.3 0.000000e+00 2229/2268 (98%)
EPI372707 A/Egypt/0585-NAMRU3/2009 (A/H5N1) segment 2 (PB1) 3967.7 0.000000e+00 2232/2274 (98%)
EPI294582 A/duck/Egypt/3982-12/2010 (A/H5N1) segment 2 (PB1) 3956.6 0.000000e+00 2230/2274 (98%)
EPI538765 A/chicken/Egypt/13VIR-2962-109/2013 (A/H5N1) segment 2 (PB1) 3954.8 0.000000e+00 2195/2222 (98%)
EPI294468 A/chicken/Egypt/1553-1/2010 (A/H5N1) segment 2 (PB1) 3951.1 0.000000e+00 2229/2274 (98%)
EPI372819 A/Egypt/N02038/2010 (A/H5N1) segment 2 (PB1) 3945.6 0.000000e+00 2228/2274 (97%)
EPI390990 A/chicken/Egypt/1029/2010 (A/H5N1) segment 2 (PB1) 3943.7 0.000000e+00 2213/2252 (98%)
EPI372727 A/Egypt/9539-NAMRU3/2009 (A/H5N1) segment 2 (PB1) 3943.7 0.000000e+00 2227/2274 (97%)
EPI372701 A/Egypt/0001-NAMRU3/2009 (A/H5N1) segment 2 (PB1) 3940.0 0.000000e+00 2227/2274 (97%)
EPI372677 A/Egypt/0605-NAMRU3/2009 (A/H5N1) segment 2 (PB1) 3940.0 0.000000e+00 2227/2274 (97%)
EPI372765 A/Egypt/2563-NAMRU3/2009 (A/H5N1) segment 2 (PB1) 3934.5 0.000000e+00 2226/2274 (97%)
EPI294568 A/chicken/Egypt/3982-5/2010 (A/H5N1) segment 2 (PB1) 3934.5 0.000000e+00 2215/2257 (98%)
EPI493064 A/chicken/Egypt/S3093A/2011 (A/H5N1) segment 2 (PB1) 3917.9 0.000000e+00 2223/2274 (97%)
EPI372771 A/Egypt/3228-NAMRU3/2009 (A/H5N1) segment 2 (PB1) 3917.9 0.000000e+00 2223/2274 (97%)
EPI372783 A/Egypt/4394-NAMRU3/2009 (A/H5N1) segment 2 (PB1) 3912.3 0.000000e+00 2222/2274 (97%)
EPI372789 A/Egypt/3450-NAMRU3/2009 (A/H5N1) segment 2 (PB1) 3908.6 0.000000e+00 2222/2275 (97%)
EPI372695 A/Egypt/2039-NAMRU3/2009 (A/H5N1) segment 2 (PB1) 3906.8 0.000000e+00 2221/2274 (97%)
EPI372689 A/Egypt/1310-NAMRU3/2009 (A/H5N1) segment 2 (PB1) 3906.8 0.000000e+00 2221/2274 (97%)
EPI372807 A/Egypt/N01644/2010 (A/H5N1) segment 2 (PB1) 3901.2 0.000000e+00 2220/2274 (97%)
EPI372795 A/Egypt/N11981/2009 (A/H5N1) segment 2 (PB1) 3895.7 0.000000e+00 2219/2274 (97%)
EPI372751 A/Egypt/4935-NAMRU3/2009 (A/H5N1) segment 2 (PB1) 3895.7 0.000000e+00 2219/2274 (97%)
EPI372777 A/Egypt/4396-NAMRU3/2009 (A/H5N1) segment 2 (PB1) 3892.0 0.000000e+00 2218/2274 (97%)
EPI538757 A/chicken/Egypt/13VIR-2962-24/2013 (A/H5N1) segment 2 (PB1) 3888.3 0.000000e+00 2183/2222 (98%)
EPI372759 A/Egypt/2752-NAMRU3/2009 (A/H5N1) segment 2 (PB1) 3884.6 0.000000e+00 2216/2274 (97%)
EPI372579 A/Egypt/394-NAMRU3/2007 (A/H5N1) segment 2 (PB1) 3884.6 0.000000e+00 2217/2274 (97%)
EPI372843 A/Egypt/N03072/2010 (A/H5N1) segment 2 (PB1) 3873.5 0.000000e+00 2216/2275 (97%)
EPI58633 A/chicken/Egypt/2253-1/2006 (A/H5N1) segment 2 (PB1) 3868.0 0.000000e+00 2214/2274 (97%)
EPI372801 A/Egypt/N01360/2010 (A/H5N1) segment 2 (PB1) 3862.5 0.000000e+00 2213/2274 (97%)
EPI372645 A/Egypt/2289-NAMRU3/2008 (A/H5N1) segment 2 (PB1) 3862.5 0.000000e+00 2213/2274 (97%)
EPI294631 A/chicken/Egypt/3982-44/2010 (A/H5N1) segment 2 (PB1) 3862.5 0.000000e+00 2206/2265 (97%)
EPI58652 A/turkey/Egypt/2253-2/2006 (A/H5N1) segment 2 (PB1) 3862.5 0.000000e+00 2213/2274 (97%)
EPI372897 A/Egypt/N0423/2011 (A/H5N1) segment 2 (PB1) 3856.9 0.000000e+00 2213/2275 (97%)
EPI372585 A/Egypt/321-NAMRU3/2007 (A/H5N1) segment 2 (PB1) 3856.9 0.000000e+00 2212/2274 (97%)
EPI225827 A/chicken/Gaza/450/2006 (A/H5N1) segment 2 (PB1) 3856.9 0.000000e+00 2212/2274 (97%)
EPI156770 A/chicken/Egypt/5169-3/2007 (A/H5N1) segment 2 (PB1) 3856.9 0.000000e+00 2212/2274 (97%)
EPI132246 A/chicken/Israel/625/2006 (A/H5N1) segment 2 (PB1) 3856.9 0.000000e+00 2212/2274 (97%)
EPI132240 A/turkey/Israel/446/2006 (A/H5N1) segment 2 (PB1) 3856.9 0.000000e+00 2212/2274 (97%)
EPI132234 A/turkey/Israel/345/2006 (A/H5N1) segment 2 (PB1) 3856.9 0.000000e+00 2212/2274 (97%)
EPI372651 A/Egypt/2546-NAMRU3/2008 (A/H5N1) segment 2 (PB1) 3851.4 0.000000e+00 2211/2274 (97%)
EPI259626 A/duck/Egypt/D1Li33/2007 (A/H5N1) segment 2 (PB1) 3851.4 0.000000e+00 2211/2274 (97%)
EPI259625 A/duck/Egypt/D1Br423/2007 (A/H5N1) segment 2 (PB1) 3851.4 0.000000e+00 2211/2274 (97%)
EPI124570 A/Egypt/902782/2006 (A/H5N1) segment 2 (PB1) 3851.4 0.000000e+00 2203/2262 (97%)
EPI132237 A/turkey/Israel/364/2006 (A/H5N1) segment 2 (PB1) 3847.7 0.000000e+00 2210/2274 (97%)

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Tue Feb 24, 2015 11:32 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
EPI538811 A/chicken/Egypt/13VIR-2962-203/2013 (A/H5N1) segment 3 (PA) 3919.7 0.000000e+00 2141/2151 (99%)
EPI538803 A/chicken/Egypt/13VIR-2962-200/2013 (A/H5N1) segment 3 (PA) 3914.2 0.000000e+00 2140/2151 (99%)
EPI538787 A/chicken/Egypt/13VIR-2962-198/2013 (A/H5N1) segment 3 (PA) 3908.6 0.000000e+00 2135/2145 (99%)
EPI538795 A/chicken/Egypt/13VIR-2962-199/2013 (A/H5N1) segment 3 (PA) 3903.1 0.000000e+00 2132/2142 (99%)
EPI493481 A/chicken/Egypt/M7217B/2013 (A/H5N1) segment 3 (PA) 3903.1 0.000000e+00 2138/2151 (99%)
EPI493536 A/chicken/Egypt/Q5283C/2012 (A/H5N1) segment 3 (PA) 3880.9 0.000000e+00 2134/2151 (99%)
EPI538763 A/chicken/Egypt/13VIR-2962-109/2013 (A/H5N1) segment 3 (PA) 3838.5 0.000000e+00 2127/2152 (98%)
EPI493558 A/chicken/Egypt/M2773A/2011 (A/H5N1) segment 3 (PA) 3836.6 0.000000e+00 2126/2151 (98%)
EPI493527 A/chicken/Egypt/S2938D/2011 (A/H5N1) segment 3 (PA) 3836.6 0.000000e+00 2126/2151 (98%)
EPI493408 A/chicken/Egypt/S3280D/2011 (A/H5N1) segment 3 (PA) 3836.6 0.000000e+00 2126/2151 (98%)
EPI493347 A/chicken/Egypt/S3280B/2011 (A/H5N1) segment 3 (PA) 3836.6 0.000000e+00 2126/2151 (98%)
EPI493341 A/goose/Egypt/M2794A/2011 (A/H5N1) segment 3 (PA) 3836.6 0.000000e+00 2126/2151 (98%)
EPI493205 A/goose/Egypt/M2788A/2011 (A/H5N1) segment 3 (PA) 3836.6 0.000000e+00 2126/2151 (98%)
EPI493467 A/chicken/Egypt/S3280E/2011 (A/H5N1) segment 3 (PA) 3831.1 0.000000e+00 2125/2151 (98%)
EPI493361 A/goose/Egypt/M2788E/2011 (A/H5N1) segment 3 (PA) 3831.1 0.000000e+00 2125/2151 (98%)
EPI372927 A/Egypt/N09966/2011 (A/H5N1) segment 3 (PA) 3831.1 0.000000e+00 2125/2151 (98%)
EPI493416 A/duck/Egypt/Q4596D/2012 (A/H5N1) segment 3 (PA) 3825.5 0.000000e+00 2124/2151 (98%)
EPI493354 A/duck/Egypt/M2583D/2010 (A/H5N1) segment 3 (PA) 3825.5 0.000000e+00 2124/2151 (98%)
EPI493277 A/duck/Egypt/M2583A/2010 (A/H5N1) segment 3 (PA) 3825.5 0.000000e+00 2124/2151 (98%)
EPI493199 A/duck/Egypt/Q4596A/2012 (A/H5N1) segment 3 (PA) 3825.5 0.000000e+00 2124/2151 (98%)
EPI493192 A/duck/Egypt/M2583B/2010 (A/H5N1) segment 3 (PA) 3825.5 0.000000e+00 2124/2151 (98%)
EPI493186 A/duck/Egypt/Q4596B/2012 (A/H5N1) segment 3 (PA) 3825.5 0.000000e+00 2124/2151 (98%)
EPI493055 A/duck/Egypt/M2583C/2010 (A/H5N1) segment 3 (PA) 3825.5 0.000000e+00 2124/2151 (98%)
EPI372879 A/Egypt/N6774/2011 (A/H5N1) segment 3 (PA) 3825.5 0.000000e+00 2124/2151 (98%)
EPI493529 A/duck/Egypt/Q2645C/2010 (A/H5N1) segment 3 (PA) 3820.0 0.000000e+00 2123/2151 (98%)
EPI493469 A/goose/Egypt/M2794E/2011 (A/H5N1) segment 3 (PA) 3820.0 0.000000e+00 2123/2151 (98%)
EPI372847 A/Egypt/N0544/2011 (A/H5N1) segment 3 (PA) 3820.0 0.000000e+00 2124/2152 (98%)
EPI538819 A/chicken/Egypt/13VIR-2962-204/2013 (A/H5N1) segment 3 (PA) 3818.1 0.000000e+00 2102/2120 (99%)
EPI372911 A/Egypt/N7592/2011 (A/H5N1) segment 3 (PA) 3816.3 0.000000e+00 2122/2151 (98%)
EPI538779 A/duck/Egypt/13VIR-2962-196/2013 (A/H5N1) segment 3 (PA) 3814.5 0.000000e+00 2122/2151 (98%)
EPI493125 A/duck/Egypt/M3075B/2011 (A/H5N1) segment 3 (PA) 3814.5 0.000000e+00 2122/2151 (98%)
EPI372887 A/Egypt/N6828/2011 (A/H5N1) segment 3 (PA) 3814.5 0.000000e+00 2122/2151 (98%)
EPI372855 A/Egypt/N6322/2011 (A/H5N1) segment 3 (PA) 3810.8 0.000000e+00 2121/2151 (98%)
EPI372919 A/Egypt/N7724/2011 (A/H5N1) segment 3 (PA) 3808.9 0.000000e+00 2121/2151 (98%)
EPI372863 A/Egypt/N6658/2011 (A/H5N1) segment 3 (PA) 3808.9 0.000000e+00 2121/2151 (98%)
EPI538771 A/duck/Egypt/13VIR-2962-195/2013 (A/H5N1) segment 3 (PA) 3801.5 0.000000e+00 2119/2151 (98%)
EPI372951 A/Egypt/N14976/2011 (A/H5N1) segment 3 (PA) 3797.8 0.000000e+00 2120/2152 (98%)
EPI372943 A/Egypt/N11470/2011 (A/H5N1) segment 3 (PA) 3797.8 0.000000e+00 2120/2152 (98%)
EPI372935 A/Egypt/N11126/2011 (A/H5N1) segment 3 (PA) 3797.8 0.000000e+00 2120/2152 (98%)
EPI493597 A/duck/Egypt/S6419C/2012 (A/H5N1) segment 3 (PA) 3786.8 0.000000e+00 2118/2152 (98%)
EPI493065 A/chicken/Egypt/S3093A/2011 (A/H5N1) segment 3 (PA) 3786.8 0.000000e+00 2117/2151 (98%)
EPI493062 A/turkey/Egypt/S6405A/2012 (A/H5N1) segment 3 (PA) 3786.8 0.000000e+00 2118/2152 (98%)
EPI372959 A/Egypt/N10621/2011 (A/H5N1) segment 3 (PA) 3781.2 0.000000e+00 2116/2151 (98%)
EPI372811 A/Egypt/N01982/2010 (A/H5N1) segment 3 (PA) 3781.2 0.000000e+00 2116/2151 (98%)
EPI372871 A/Egypt/N0677/2011 (A/H5N1) segment 3 (PA) 3775.7 0.000000e+00 2115/2151 (98%)
EPI372903 A/Egypt/N7562/2011 (A/H5N1) segment 3 (PA) 3770.1 0.000000e+00 2115/2152 (98%)
EPI294480 A/chicken/Egypt/1553-13/2010 (A/H5N1) segment 3 (PA) 3770.1 0.000000e+00 2114/2151 (98%)
EPI493422 A/chicken/Egypt/S3806B/2011 (A/H5N1) segment 3 (PA) 3764.6 0.000000e+00 2113/2151 (98%)
EPI493402 A/chicken/Egypt/S3802B/2011 (A/H5N1) segment 3 (PA) 3764.6 0.000000e+00 2113/2151 (98%)
EPI493078 A/chicken/Egypt/S3806D/2011 (A/H5N1) segment 3 (PA) 3764.6 0.000000e+00 2113/2151 (98%)
EPI372731 A/Egypt/9174-NAMRU3/2009 (A/H5N1) segment 3 (PA) 3759.1 0.000000e+00 2112/2151 (98%)
EPI372817 A/Egypt/N02038/2010 (A/H5N1) segment 3 (PA) 3753.5 0.000000e+00 2111/2151 (98%)
EPI372711 A/Egypt/9538-NAMRU3/2009 (A/H5N1) segment 3 (PA) 3751.7 0.000000e+00 2112/2152 (98%)
EPI294466 A/chicken/Egypt/1553-1/2010 (A/H5N1) segment 3 (PA) 3751.7 0.000000e+00 2108/2147 (98%)
EPI372705 A/Egypt/0585-NAMRU3/2009 (A/H5N1) segment 3 (PA) 3748.0 0.000000e+00 2110/2151 (98%)
EPI372823 A/Egypt/N02127/2010 (A/H5N1) segment 3 (PA) 3744.3 0.000000e+00 2109/2151 (98%)
EPI372835 A/Egypt/N03071/2010 (A/H5N1) segment 3 (PA) 3736.9 0.000000e+00 2108/2151 (98%)
EPI372725 A/Egypt/9539-NAMRU3/2009 (A/H5N1) segment 3 (PA) 3731.4 0.000000e+00 2108/2152 (97%)
EPI372829 A/Egypt/N02554/2010 (A/H5N1) segment 3 (PA) 3725.8 0.000000e+00 2106/2151 (97%)
EPI294650 A/poultry/Egypt/3982-55/2010 (A/H5N1) segment 3 (PA) 3714.7 0.000000e+00 2098/2142 (97%)
EPI493555 A/chicken/Egypt/Q1397D/2010 (A/H5N1) segment 3 (PA) 3712.9 0.000000e+00 2106/2153 (97%)
EPI294573 A/chicken/Egypt/3982-9/2010 (A/H5N1) segment 3 (PA) 3712.9 0.000000e+00 2087/2126 (98%)
EPI372763 A/Egypt/2563-NAMRU3/2009 (A/H5N1) segment 3 (PA) 3696.3 0.000000e+00 2102/2152 (97%)
EPI372749 A/Egypt/4935-NAMRU3/2009 (A/H5N1) segment 3 (PA) 3696.3 0.000000e+00 2103/2153 (97%)
EPI538755 A/chicken/Egypt/13VIR-2962-24/2013 (A/H5N1) segment 3 (PA) 3694.4 0.000000e+00 2101/2152 (97%)
EPI294657 A/poultry/Egypt/3982-56/2010 (A/H5N1) segment 3 (PA) 3692.6 0.000000e+00 2084/2127 (97%)
EPI372775 A/Egypt/4396-NAMRU3/2009 (A/H5N1) segment 3 (PA) 3690.7 0.000000e+00 2101/2152 (97%)
EPI372769 A/Egypt/3228-NAMRU3/2009 (A/H5N1) segment 3 (PA) 3690.7 0.000000e+00 2101/2152 (97%)
EPI294608 A/chicken/Egypt/3982-20/2010 (A/H5N1) segment 3 (PA) 3683.3 0.000000e+00 2075/2116 (98%)
EPI372787 A/Egypt/3450-NAMRU3/2009 (A/H5N1) segment 3 (PA) 3676.0 0.000000e+00 2098/2152 (97%)
EPI372693 A/Egypt/2039-NAMRU3/2009 (A/H5N1) segment 3 (PA) 3674.1 0.000000e+00 2098/2152 (97%)
EPI372687 A/Egypt/1310-NAMRU3/2009 (A/H5N1) segment 3 (PA) 3674.1 0.000000e+00 2098/2152 (97%)
EPI372577 A/Egypt/394-NAMRU3/2007 (A/H5N1) segment 3 (PA) 3674.1 0.000000e+00 2098/2152 (97%)
EPI294580 A/duck/Egypt/3982-12/2010 (A/H5N1) segment 3 (PA) 3672.3 0.000000e+00 2073/2116 (97%)
EPI372699 A/Egypt/0001-NAMRU3/2009 (A/H5N1) segment 3 (PA) 3668.6 0.000000e+00 2097/2152 (97%)
EPI372681 A/Egypt/0606-NAMRU3/2009 (A/H5N1) segment 3 (PA) 3668.6 0.000000e+00 2097/2152 (97%)
EPI372793 A/Egypt/N11981/2009 (A/H5N1) segment 3 (PA) 3663.0 0.000000e+00 2097/2153 (97%)
EPI372675 A/Egypt/0605-NAMRU3/2009 (A/H5N1) segment 3 (PA) 3663.0 0.000000e+00 2096/2152 (97%)
EPI152047 A/chicken/Egypt/5169-2/2007 (A/H5N1) segment 3 (PA) 3663.0 0.000000e+00 2096/2152 (97%)
EPI58650 A/turkey/Egypt/2253-2/2006 (A/H5N1) segment 3 (PA) 3663.0 0.000000e+00 2096/2152 (97%)
EPI294545 A/chicken/Egypt/3982-2/2010 (A/H5N1) segment 3 (PA) 3659.3 0.000000e+00 2058/2097 (98%)
EPI372781 A/Egypt/4394-NAMRU3/2009 (A/H5N1) segment 3 (PA) 3657.5 0.000000e+00 2095/2152 (97%)
EPI58631 A/chicken/Egypt/2253-1/2006 (A/H5N1) segment 3 (PA) 3657.5 0.000000e+00 2095/2152 (97%)
EPI372583 A/Egypt/321-NAMRU3/2007 (A/H5N1) segment 3 (PA) 3651.9 0.000000e+00 2094/2152 (97%)
EPI259639 A/duck/Egypt/D3Lu13/2007 (A/H5N1) segment 3 (PA) 3651.9 0.000000e+00 2094/2152 (97%)
EPI259635 A/duck/Egypt/D1Br17/2007 (A/H5N1) segment 3 (PA) 3651.9 0.000000e+00 2094/2152 (97%)
EPI259634 A/duck/Egypt/D1Tr2/2007 (A/H5N1) segment 3 (PA) 3651.9 0.000000e+00 2094/2152 (97%)
EPI225826 A/chicken/Gaza/450/2006 (A/H5N1) segment 3 (PA) 3651.9 0.000000e+00 2094/2152 (97%)
EPI132222 A/turkey/Israel/345/2006 (A/H5N1) segment 3 (PA) 3651.9 0.000000e+00 2094/2152 (97%)
EPI294566 A/chicken/Egypt/3982-5/2010 (A/H5N1) segment 3 (PA) 3650.1 0.000000e+00 2064/2108 (97%)
EPI372601 A/Egypt/4082-NAMRU3/2007 (A/H5N1) segment 3 (PA) 3646.4 0.000000e+00 2093/2152 (97%)
EPI225073 A/duck/Egypt/2253-3/2006 (A/H5N1) segment 3 (PA) 3646.4 0.000000e+00 2093/2152 (97%)
EPI124590 A/Egypt/902782/2006 (A/H5N1) segment 3 (PA) 3646.4 0.000000e+00 2093/2152 (97%)
EPI154911 A/chicken/Egypt/1709-1VIR08/2007 (A/H5N1) segment 3 (PA) 3644.6 0.000000e+00 2090/2148 (97%)
EPI372841 A/Egypt/N03072/2010 (A/H5N1) segment 3 (PA) 3640.9 0.000000e+00 2092/2152 (97%)
EPI372805 A/Egypt/N01644/2010 (A/H5N1) segment 3 (PA) 3640.9 0.000000e+00 2092/2152 (97%)
EPI372757 A/Egypt/2752-NAMRU3/2009 (A/H5N1) segment 3 (PA) 3640.9 0.000000e+00 2093/2153 (97%)
EPI372649 A/Egypt/2546-NAMRU3/2008 (A/H5N1) segment 3 (PA) 3640.9 0.000000e+00 2092/2152 (97%)
EPI352590 A/chicken/Qalubia/1/2006 (A/H5N1) segment 3 (PA) 3640.9 0.000000e+00 2092/2152 (97%)
EPI276253 A/chicken/Egypt/08124S-NLQP/2008 (A/H5N1) segment 3 (PA) 3640.9 0.000000e+00 2093/2153 (97%)

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Tue Feb 24, 2015 11:33 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
EPI538800 A/chicken/Egypt/13VIR-2962-200/2013 (A/H5N1) segment 5 (NP) 2699.1 0.000000e+00 1485/1497 (99%)
EPI538792 A/chicken/Egypt/13VIR-2962-199/2013 (A/H5N1) segment 5 (NP) 2699.1 0.000000e+00 1485/1497 (99%)
EPI538784 A/chicken/Egypt/13VIR-2962-198/2013 (A/H5N1) segment 5 (NP) 2699.1 0.000000e+00 1485/1497 (99%)
EPI538776 A/duck/Egypt/13VIR-2962-196/2013 (A/H5N1) segment 5 (NP) 2693.5 0.000000e+00 1484/1497 (99%)
EPI538768 A/duck/Egypt/13VIR-2962-195/2013 (A/H5N1) segment 5 (NP) 2693.5 0.000000e+00 1484/1497 (99%)
EPI493505 A/chicken/Egypt/Q5283C/2012 (A/H5N1) segment 5 (NP) 2693.5 0.000000e+00 1484/1497 (99%)
EPI538760 A/chicken/Egypt/13VIR-2962-109/2013 (A/H5N1) segment 5 (NP) 2688.0 0.000000e+00 1483/1497 (99%)
EPI538816 A/chicken/Egypt/13VIR-2962-204/2013 (A/H5N1) segment 5 (NP) 2660.3 0.000000e+00 1478/1497 (98%)
EPI493530 A/duck/Egypt/Q2645C/2010 (A/H5N1) segment 5 (NP) 2660.3 0.000000e+00 1478/1497 (98%)
EPI493431 A/chicken/Egypt/S3280E/2011 (A/H5N1) segment 5 (NP) 2660.3 0.000000e+00 1478/1497 (98%)
EPI493397 A/chicken/Egypt/S3280D/2011 (A/H5N1) segment 5 (NP) 2660.3 0.000000e+00 1478/1497 (98%)
EPI493557 A/chicken/Egypt/M2773A/2011 (A/H5N1) segment 5 (NP) 2654.8 0.000000e+00 1477/1497 (98%)
EPI493445 A/chicken/Egypt/M7217B/2013 (A/H5N1) segment 5 (NP) 2654.8 0.000000e+00 1477/1497 (98%)
EPI493349 A/chicken/Egypt/S3280B/2011 (A/H5N1) segment 5 (NP) 2654.8 0.000000e+00 1477/1497 (98%)
EPI493355 A/duck/Egypt/M2583D/2010 (A/H5N1) segment 5 (NP) 2649.2 0.000000e+00 1476/1497 (98%)
EPI493278 A/duck/Egypt/M2583A/2010 (A/H5N1) segment 5 (NP) 2649.2 0.000000e+00 1476/1497 (98%)
EPI493193 A/duck/Egypt/M2583B/2010 (A/H5N1) segment 5 (NP) 2649.2 0.000000e+00 1476/1497 (98%)
EPI493057 A/duck/Egypt/M2583C/2010 (A/H5N1) segment 5 (NP) 2649.2 0.000000e+00 1476/1497 (98%)
EPI493498 A/chicken/Egypt/S2938D/2011 (A/H5N1) segment 5 (NP) 2643.7 0.000000e+00 1475/1497 (98%)
EPI493168 A/duck/Egypt/Q4596A/2012 (A/H5N1) segment 5 (NP) 2643.7 0.000000e+00 1475/1497 (98%)
EPI493126 A/duck/Egypt/M3075B/2011 (A/H5N1) segment 5 (NP) 2643.7 0.000000e+00 1475/1497 (98%)
EPI372948 A/Egypt/N14976/2011 (A/H5N1) segment 5 (NP) 2643.7 0.000000e+00 1475/1497 (98%)
EPI372940 A/Egypt/N11470/2011 (A/H5N1) segment 5 (NP) 2643.7 0.000000e+00 1475/1497 (98%)
EPI372852 A/Egypt/N6322/2011 (A/H5N1) segment 5 (NP) 2643.7 0.000000e+00 1475/1497 (98%)
EPI493470 A/goose/Egypt/M2794E/2011 (A/H5N1) segment 5 (NP) 2638.1 0.000000e+00 1475/1498 (98%)
EPI493343 A/goose/Egypt/M2794A/2011 (A/H5N1) segment 5 (NP) 2638.1 0.000000e+00 1475/1498 (98%)
EPI493206 A/goose/Egypt/M2788A/2011 (A/H5N1) segment 5 (NP) 2638.1 0.000000e+00 1475/1498 (98%)
EPI493153 A/duck/Egypt/Q4596B/2012 (A/H5N1) segment 5 (NP) 2638.1 0.000000e+00 1474/1497 (98%)
EPI372924 A/Egypt/N09966/2011 (A/H5N1) segment 5 (NP) 2638.1 0.000000e+00 1474/1497 (98%)
EPI372884 A/Egypt/N6828/2011 (A/H5N1) segment 5 (NP) 2638.1 0.000000e+00 1474/1497 (98%)
EPI372932 A/Egypt/N11126/2011 (A/H5N1) segment 5 (NP) 2634.4 0.000000e+00 1473/1497 (98%)
EPI493362 A/goose/Egypt/M2788E/2011 (A/H5N1) segment 5 (NP) 2632.6 0.000000e+00 1474/1498 (98%)
EPI372956 A/Egypt/N10621/2011 (A/H5N1) segment 5 (NP) 2632.6 0.000000e+00 1473/1497 (98%)
EPI372900 A/Egypt/N7562/2011 (A/H5N1) segment 5 (NP) 2632.6 0.000000e+00 1473/1497 (98%)
EPI493564 A/duck/Egypt/S6419C/2012 (A/H5N1) segment 5 (NP) 2627.1 0.000000e+00 1472/1497 (98%)
EPI493417 A/duck/Egypt/Q4596D/2012 (A/H5N1) segment 5 (NP) 2627.1 0.000000e+00 1472/1497 (98%)
EPI493066 A/chicken/Egypt/S3093A/2011 (A/H5N1) segment 5 (NP) 2627.1 0.000000e+00 1472/1497 (98%)
EPI493034 A/turkey/Egypt/S6405A/2012 (A/H5N1) segment 5 (NP) 2627.1 0.000000e+00 1472/1497 (98%)
EPI372916 A/Egypt/N7724/2011 (A/H5N1) segment 5 (NP) 2627.1 0.000000e+00 1472/1497 (98%)
EPI372860 A/Egypt/N6658/2011 (A/H5N1) segment 5 (NP) 2627.1 0.000000e+00 1472/1497 (98%)
EPI372844 A/Egypt/N0544/2011 (A/H5N1) segment 5 (NP) 2627.1 0.000000e+00 1472/1497 (98%)
EPI372808 A/Egypt/N01982/2010 (A/H5N1) segment 5 (NP) 2627.1 0.000000e+00 1472/1497 (98%)
EPI372908 A/Egypt/N7592/2011 (A/H5N1) segment 5 (NP) 2621.5 0.000000e+00 1471/1497 (98%)
EPI372876 A/Egypt/N6774/2011 (A/H5N1) segment 5 (NP) 2621.5 0.000000e+00 1471/1497 (98%)
EPI493423 A/chicken/Egypt/S3806B/2011 (A/H5N1) segment 5 (NP) 2616.0 0.000000e+00 1470/1497 (98%)
EPI493403 A/chicken/Egypt/S3802B/2011 (A/H5N1) segment 5 (NP) 2616.0 0.000000e+00 1470/1497 (98%)
EPI493079 A/chicken/Egypt/S3806D/2011 (A/H5N1) segment 5 (NP) 2616.0 0.000000e+00 1470/1497 (98%)
EPI538752 A/chicken/Egypt/13VIR-2962-24/2013 (A/H5N1) segment 5 (NP) 2610.4 0.000000e+00 1470/1498 (98%)
EPI372820 A/Egypt/N02127/2010 (A/H5N1) segment 5 (NP) 2610.4 0.000000e+00 1470/1498 (98%)
EPI372814 A/Egypt/N02038/2010 (A/H5N1) segment 5 (NP) 2610.4 0.000000e+00 1469/1497 (98%)
EPI372868 A/Egypt/N0677/2011 (A/H5N1) segment 5 (NP) 2604.9 0.000000e+00 1468/1497 (98%)
EPI372728 A/Egypt/9174-NAMRU3/2009 (A/H5N1) segment 5 (NP) 2604.9 0.000000e+00 1468/1497 (98%)
EPI372832 A/Egypt/N03071/2010 (A/H5N1) segment 5 (NP) 2599.4 0.000000e+00 1467/1497 (97%)
EPI372702 A/Egypt/0585-NAMRU3/2009 (A/H5N1) segment 5 (NP) 2599.4 0.000000e+00 1467/1497 (97%)
EPI372722 A/Egypt/9539-NAMRU3/2009 (A/H5N1) segment 5 (NP) 2593.8 0.000000e+00 1466/1497 (97%)
EPI372826 A/Egypt/N02554/2010 (A/H5N1) segment 5 (NP) 2577.2 0.000000e+00 1463/1497 (97%)
EPI372708 A/Egypt/9538-NAMRU3/2009 (A/H5N1) segment 5 (NP) 2577.2 0.000000e+00 1463/1497 (97%)
EPI372696 A/Egypt/0001-NAMRU3/2009 (A/H5N1) segment 5 (NP) 2577.2 0.000000e+00 1463/1497 (97%)
EPI372690 A/Egypt/2039-NAMRU3/2009 (A/H5N1) segment 5 (NP) 2566.1 0.000000e+00 1461/1497 (97%)
EPI372684 A/Egypt/1310-NAMRU3/2009 (A/H5N1) segment 5 (NP) 2566.1 0.000000e+00 1461/1497 (97%)
EPI372838 A/Egypt/N03072/2010 (A/H5N1) segment 5 (NP) 2560.6 0.000000e+00 1460/1497 (97%)
EPI372772 A/Egypt/4396-NAMRU3/2009 (A/H5N1) segment 5 (NP) 2560.6 0.000000e+00 1460/1497 (97%)
EPI372766 A/Egypt/3228-NAMRU3/2009 (A/H5N1) segment 5 (NP) 2560.6 0.000000e+00 1460/1497 (97%)
EPI294477 A/chicken/Egypt/1553-13/2010 (A/H5N1) segment 5 (NP) 2560.6 0.000000e+00 1437/1462 (98%)
EPI538808 A/chicken/Egypt/13VIR-2962-203/2013 (A/H5N1) segment 5 (NP) 2556.9 0.000000e+00 1409/1422 (99%)
EPI372796 A/Egypt/N01360/2010 (A/H5N1) segment 5 (NP) 2555.0 0.000000e+00 1459/1497 (97%)
EPI372672 A/Egypt/0605-NAMRU3/2009 (A/H5N1) segment 5 (NP) 2555.0 0.000000e+00 1459/1497 (97%)
EPI372892 A/Egypt/N0423/2011 (A/H5N1) segment 5 (NP) 2549.5 0.000000e+00 1459/1498 (97%)
EPI372802 A/Egypt/N01644/2010 (A/H5N1) segment 5 (NP) 2549.5 0.000000e+00 1458/1497 (97%)
EPI372784 A/Egypt/3450-NAMRU3/2009 (A/H5N1) segment 5 (NP) 2549.5 0.000000e+00 1458/1497 (97%)
EPI372778 A/Egypt/4394-NAMRU3/2009 (A/H5N1) segment 5 (NP) 2549.5 0.000000e+00 1458/1497 (97%)
EPI372760 A/Egypt/2563-NAMRU3/2009 (A/H5N1) segment 5 (NP) 2549.5 0.000000e+00 1458/1497 (97%)
EPI372746 A/Egypt/4935-NAMRU3/2009 (A/H5N1) segment 5 (NP) 2549.5 0.000000e+00 1458/1497 (97%)
EPI372790 A/Egypt/N11981/2009 (A/H5N1) segment 5 (NP) 2544.0 0.000000e+00 1457/1497 (97%)
EPI372754 A/Egypt/2752-NAMRU3/2009 (A/H5N1) segment 5 (NP) 2532.9 0.000000e+00 1455/1497 (97%)
EPI372678 A/Egypt/0606-NAMRU3/2009 (A/H5N1) segment 5 (NP) 2527.3 0.000000e+00 1454/1497 (97%)
EPI294570 A/chicken/Egypt/3982-9/2010 (A/H5N1) segment 5 (NP) 2521.8 0.000000e+00 1425/1455 (97%)
EPI372574 A/Egypt/394-NAMRU3/2007 (A/H5N1) segment 5 (NP) 2512.6 0.000000e+00 1451/1497 (96%)
EPI294577 A/duck/Egypt/3982-12/2010 (A/H5N1) segment 5 (NP) 2510.7 0.000000e+00 1423/1455 (97%)
EPI294605 A/chicken/Egypt/3982-20/2010 (A/H5N1) segment 5 (NP) 2499.6 0.000000e+00 1413/1443 (97%)
EPI294542 A/chicken/Egypt/3982-2/2010 (A/H5N1) segment 5 (NP) 2495.9 0.000000e+00 1409/1438 (97%)
EPI372592 A/Egypt/4226-NAMRU3/2007 (A/H5N1) segment 5 (NP) 2494.1 0.000000e+00 1448/1497 (96%)
EPI294654 A/poultry/Egypt/3982-56/2010 (A/H5N1) segment 5 (NP) 2494.1 0.000000e+00 1412/1443 (97%)
EPI294563 A/chicken/Egypt/3982-5/2010 (A/H5N1) segment 5 (NP) 2490.4 0.000000e+00 1408/1438 (97%)
EPI171683 A/Peregrine falcon/Slovakia/Vh242/2006 (A/H5N1) segment 5 (NP) 2488.6 0.000000e+00 1447/1497 (96%)
EPI152045 A/chicken/Egypt/5169-2/2007 (A/H5N1) segment 5 (NP) 2488.6 0.000000e+00 1446/1495 (96%)
EPI372646 A/Egypt/2546-NAMRU3/2008 (A/H5N1) segment 5 (NP) 2483.0 0.000000e+00 1446/1497 (96%)
EPI372640 A/Egypt/2289-NAMRU3/2008 (A/H5N1) segment 5 (NP) 2483.0 0.000000e+00 1446/1497 (96%)
EPI372598 A/Egypt/4082-NAMRU3/2007 (A/H5N1) segment 5 (NP) 2483.0 0.000000e+00 1446/1497 (96%)
EPI372580 A/Egypt/321-NAMRU3/2007 (A/H5N1) segment 5 (NP) 2483.0 0.000000e+00 1447/1498 (96%)
EPI352588 A/chicken/Qalubia/1/2006 (A/H5N1) segment 5 (NP) 2483.0 0.000000e+00 1446/1497 (96%)
EPI259579 A/duck/Egypt/D3Lu13/2007 (A/H5N1) segment 5 (NP) 2483.0 0.000000e+00 1446/1497 (96%)
EPI259575 A/duck/Egypt/D1Br3/2007 (A/H5N1) segment 5 (NP) 2483.0 0.000000e+00 1446/1497 (96%)
EPI259574 A/duck/Egypt/D1Tr8/2007 (A/H5N1) segment 5 (NP) 2483.0 0.000000e+00 1446/1497 (96%)
EPI225824 A/chicken/Gaza/450/2006 (A/H5N1) segment 5 (NP) 2483.0 0.000000e+00 1446/1497 (96%)
EPI171682 A/Mergus albellus/Slovakia/Vh212/2006 (A/H5N1) segment 5 (NP) 2483.0 0.000000e+00 1447/1498 (96%)
EPI154336 A/falcon/Saudi Arabia/D1795/2005 (A/H5N1) segment 5 (NP) 2483.0 0.000000e+00 1446/1497 (96%)
EPI152315 A/chicken/Nigeria/228-10/2006 (A/H5N1) segment 5 (NP) 2483.0 0.000000e+00 1446/1497 (96%)
EPI136679 A/Mergus albellus/Slovakia/Vh212/2006 (A/H5N1) segment 5 (NP) 2483.0 0.000000e+00 1447/1498 (96%)
EPI136675 A/Cygnus olor/Czech Republic/5170/06 (A/H5N1) segment 5 (NP) 2483.0 0.000000e+00 1447/1498 (96%)

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Tue Feb 24, 2015 11:38 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
EPI493448 A/chicken/Egypt/M7217B/2013 (A/H5N1) segment 8 (NS) 1504.3 0.000000e+00 820/823 (99%)
EPI538809 A/chicken/Egypt/13VIR-2962-203/2013 (A/H5N1) segment 8 (NS) 1500.6 0.000000e+00 814/815 (99%)
EPI538801 A/chicken/Egypt/13VIR-2962-200/2013 (A/H5N1) segment 8 (NS) 1500.6 0.000000e+00 814/815 (99%)
EPI538793 A/chicken/Egypt/13VIR-2962-199/2013 (A/H5N1) segment 8 (NS) 1500.6 0.000000e+00 814/815 (99%)
EPI538785 A/chicken/Egypt/13VIR-2962-198/2013 (A/H5N1) segment 8 (NS) 1496.9 0.000000e+00 812/813 (99%)
EPI507243 A/chicken/Egypt/IT-2/2013 (A/H5N1) segment 8 (NS) 1493.2 0.000000e+00 818/823 (99%)
EPI507242 A/chicken/Egypt/IT-1/2013 (A/H5N1) segment 8 (NS) 1493.2 0.000000e+00 818/823 (99%)
EPI372925 A/Egypt/N09966/2011 (A/H5N1) segment 8 (NS) 1493.2 0.000000e+00 818/823 (99%)
EPI538761 A/chicken/Egypt/13VIR-2962-109/2013 (A/H5N1) segment 8 (NS) 1489.5 0.000000e+00 812/815 (99%)
EPI493508 A/chicken/Egypt/Q5283C/2012 (A/H5N1) segment 8 (NS) 1487.7 0.000000e+00 817/823 (99%)
EPI493419 A/duck/Egypt/Q4596D/2012 (A/H5N1) segment 8 (NS) 1487.7 0.000000e+00 817/823 (99%)
EPI493171 A/duck/Egypt/Q4596A/2012 (A/H5N1) segment 8 (NS) 1487.7 0.000000e+00 817/823 (99%)
EPI493156 A/duck/Egypt/Q4596B/2012 (A/H5N1) segment 8 (NS) 1487.7 0.000000e+00 817/823 (99%)
EPI493434 A/chicken/Egypt/S3280E/2011 (A/H5N1) segment 8 (NS) 1482.1 0.000000e+00 816/823 (99%)
EPI493351 A/chicken/Egypt/S3280B/2011 (A/H5N1) segment 8 (NS) 1482.1 0.000000e+00 816/823 (99%)
EPI398180 A/chicken/Giza/CAI26/2011 (A/H5) segment 8 (NS) 1482.1 0.000000e+00 816/823 (99%)
EPI538817 A/chicken/Egypt/13VIR-2962-204/2013 (A/H5N1) segment 8 (NS) 1476.6 0.000000e+00 809/814 (99%)
EPI493533 A/duck/Egypt/Q2645C/2010 (A/H5N1) segment 8 (NS) 1476.6 0.000000e+00 815/823 (99%)
EPI493473 A/goose/Egypt/M2794E/2011 (A/H5N1) segment 8 (NS) 1476.6 0.000000e+00 815/823 (99%)
EPI493399 A/chicken/Egypt/S3280D/2011 (A/H5N1) segment 8 (NS) 1476.6 0.000000e+00 815/823 (99%)
EPI493365 A/goose/Egypt/M2788E/2011 (A/H5N1) segment 8 (NS) 1476.6 0.000000e+00 815/823 (99%)
EPI493344 A/goose/Egypt/M2794A/2011 (A/H5N1) segment 8 (NS) 1476.6 0.000000e+00 815/823 (99%)
EPI493208 A/goose/Egypt/M2788A/2011 (A/H5N1) segment 8 (NS) 1476.6 0.000000e+00 815/823 (99%)
EPI538769 A/duck/Egypt/13VIR-2962-195/2013 (A/H5N1) segment 8 (NS) 1471.1 0.000000e+00 808/814 (99%)
EPI493560 A/chicken/Egypt/M2773A/2011 (A/H5N1) segment 8 (NS) 1471.1 0.000000e+00 814/823 (98%)
EPI493358 A/duck/Egypt/M2583D/2010 (A/H5N1) segment 8 (NS) 1471.1 0.000000e+00 814/823 (98%)
EPI493329 A/duck/Egypt/M2583A/2010 (A/H5N1) segment 8 (NS) 1471.1 0.000000e+00 814/823 (98%)
EPI493196 A/duck/Egypt/M2583B/2010 (A/H5N1) segment 8 (NS) 1471.1 0.000000e+00 814/823 (98%)
EPI493059 A/duck/Egypt/M2583C/2010 (A/H5N1) segment 8 (NS) 1471.1 0.000000e+00 814/823 (98%)
EPI372957 A/Egypt/N10621/2011 (A/H5N1) segment 8 (NS) 1471.1 0.000000e+00 814/823 (98%)
EPI372949 A/Egypt/N14976/2011 (A/H5N1) segment 8 (NS) 1471.1 0.000000e+00 814/823 (98%)
EPI372941 A/Egypt/N11470/2011 (A/H5N1) segment 8 (NS) 1471.1 0.000000e+00 814/823 (98%)
EPI372933 A/Egypt/N11126/2011 (A/H5N1) segment 8 (NS) 1471.1 0.000000e+00 814/823 (98%)
EPI372869 A/Egypt/N0677/2011 (A/H5N1) segment 8 (NS) 1471.1 0.000000e+00 814/823 (98%)
EPI372861 A/Egypt/N6658/2011 (A/H5N1) segment 8 (NS) 1471.1 0.000000e+00 814/823 (98%)
EPI372853 A/Egypt/N6322/2011 (A/H5N1) segment 8 (NS) 1471.1 0.000000e+00 814/823 (98%)
EPI372845 A/Egypt/N0544/2011 (A/H5N1) segment 8 (NS) 1471.1 0.000000e+00 814/823 (98%)
EPI538777 A/duck/Egypt/13VIR-2962-196/2013 (A/H5N1) segment 8 (NS) 1469.2 0.000000e+00 807/813 (99%)
EPI493501 A/chicken/Egypt/S2938D/2011 (A/H5N1) segment 8 (NS) 1465.5 0.000000e+00 813/823 (98%)
EPI493128 A/duck/Egypt/M3075B/2011 (A/H5N1) segment 8 (NS) 1465.5 0.000000e+00 813/823 (98%)
EPI372909 A/Egypt/N7592/2011 (A/H5N1) segment 8 (NS) 1465.5 0.000000e+00 813/823 (98%)
EPI372885 A/Egypt/N6828/2011 (A/H5N1) segment 8 (NS) 1465.5 0.000000e+00 813/823 (98%)
EPI372877 A/Egypt/N6774/2011 (A/H5N1) segment 8 (NS) 1465.5 0.000000e+00 813/823 (98%)
EPI372833 A/Egypt/N03071/2010 (A/H5N1) segment 8 (NS) 1460.0 0.000000e+00 812/823 (98%)
EPI372827 A/Egypt/N02554/2010 (A/H5N1) segment 8 (NS) 1460.0 0.000000e+00 812/823 (98%)
EPI372815 A/Egypt/N02038/2010 (A/H5N1) segment 8 (NS) 1460.0 0.000000e+00 812/823 (98%)
EPI493567 A/duck/Egypt/S6419C/2012 (A/H5N1) segment 8 (NS) 1458.1 0.000000e+00 811/822 (98%)
EPI493037 A/turkey/Egypt/S6405A/2012 (A/H5N1) segment 8 (NS) 1458.1 0.000000e+00 811/822 (98%)
EPI493426 A/chicken/Egypt/S3806B/2011 (A/H5N1) segment 8 (NS) 1454.4 0.000000e+00 811/823 (98%)
EPI493406 A/chicken/Egypt/S3802B/2011 (A/H5N1) segment 8 (NS) 1454.4 0.000000e+00 811/823 (98%)
EPI493124 A/chicken/Egypt/S3806D/2011 (A/H5N1) segment 8 (NS) 1454.4 0.000000e+00 811/823 (98%)
EPI372917 A/Egypt/N7724/2011 (A/H5N1) segment 8 (NS) 1454.4 0.000000e+00 811/823 (98%)
EPI372901 A/Egypt/N7562/2011 (A/H5N1) segment 8 (NS) 1454.4 0.000000e+00 811/823 (98%)
EPI372821 A/Egypt/N02127/2010 (A/H5N1) segment 8 (NS) 1454.4 0.000000e+00 811/823 (98%)
EPI372809 A/Egypt/N01982/2010 (A/H5N1) segment 8 (NS) 1454.4 0.000000e+00 811/823 (98%)
EPI372723 A/Egypt/9539-NAMRU3/2009 (A/H5N1) segment 8 (NS) 1454.4 0.000000e+00 811/823 (98%)
EPI372709 A/Egypt/9538-NAMRU3/2009 (A/H5N1) segment 8 (NS) 1454.4 0.000000e+00 811/823 (98%)
EPI493069 A/chicken/Egypt/S3093A/2011 (A/H5N1) segment 8 (NS) 1448.9 0.000000e+00 810/823 (98%)
EPI372703 A/Egypt/0585-NAMRU3/2009 (A/H5N1) segment 8 (NS) 1448.9 0.000000e+00 810/823 (98%)
EPI538753 A/chicken/Egypt/13VIR-2962-24/2013 (A/H5N1) segment 8 (NS) 1439.7 0.000000e+00 801/812 (98%)
EPI294648 A/poultry/Egypt/3982-55/2010 (A/H5N1) segment 8 (NS) 1437.8 0.000000e+00 798/808 (98%)
EPI372767 A/Egypt/3228-NAMRU3/2009 (A/H5N1) segment 8 (NS) 1432.3 0.000000e+00 807/823 (98%)
EPI372697 A/Egypt/0001-NAMRU3/2009 (A/H5N1) segment 8 (NS) 1432.3 0.000000e+00 807/823 (98%)
EPI372691 A/Egypt/2039-NAMRU3/2009 (A/H5N1) segment 8 (NS) 1432.3 0.000000e+00 807/823 (98%)
EPI372685 A/Egypt/1310-NAMRU3/2009 (A/H5N1) segment 8 (NS) 1432.3 0.000000e+00 807/823 (98%)
EPI372803 A/Egypt/N01644/2010 (A/H5N1) segment 8 (NS) 1426.7 0.000000e+00 806/823 (97%)
EPI372791 A/Egypt/N11981/2009 (A/H5N1) segment 8 (NS) 1426.7 0.000000e+00 806/823 (97%)
EPI372773 A/Egypt/4396-NAMRU3/2009 (A/H5N1) segment 8 (NS) 1426.7 0.000000e+00 806/823 (97%)
EPI372747 A/Egypt/4935-NAMRU3/2009 (A/H5N1) segment 8 (NS) 1426.7 0.000000e+00 806/823 (97%)
EPI294578 A/duck/Egypt/3982-12/2010 (A/H5N1) segment 8 (NS) 1426.7 0.000000e+00 796/808 (98%)
EPI372839 A/Egypt/N03072/2010 (A/H5N1) segment 8 (NS) 1421.2 0.000000e+00 805/823 (97%)
EPI372673 A/Egypt/0605-NAMRU3/2009 (A/H5N1) segment 8 (NS) 1421.2 0.000000e+00 807/825 (97%)
EPI294478 A/chicken/Egypt/1553-13/2010 (A/H5N1) segment 8 (NS) 1417.5 0.000000e+00 791/803 (98%)
EPI372797 A/Egypt/N01360/2010 (A/H5N1) segment 8 (NS) 1415.7 0.000000e+00 805/824 (97%)
EPI372761 A/Egypt/2563-NAMRU3/2009 (A/H5N1) segment 8 (NS) 1415.7 0.000000e+00 804/823 (97%)
EPI294464 A/chicken/Egypt/1553-1/2010 (A/H5N1) segment 8 (NS) 1412.0 0.000000e+00 790/803 (98%)
EPI372779 A/Egypt/4394-NAMRU3/2009 (A/H5N1) segment 8 (NS) 1410.1 0.000000e+00 803/823 (97%)
EPI123486 A/herring gull/Sweden/V1116/06 (A/H5N1) segment 8 (NS) 1404.6 0.000000e+00 802/823 (97%)
EPI58628 A/chicken/Egypt/2253-1/2006 (A/H5N1) segment 8 (NS) 1404.6 0.000000e+00 802/823 (97%)
EPI294627 A/chicken/Egypt/3982-44/2010 (A/H5N1) segment 8 (NS) 1402.7 0.000000e+00 791/807 (98%)
EPI294606 A/chicken/Egypt/3982-20/2010 (A/H5N1) segment 8 (NS) 1402.7 0.000000e+00 783/795 (98%)
EPI294564 A/chicken/Egypt/3982-5/2010 (A/H5N1) segment 8 (NS) 1402.7 0.000000e+00 787/801 (98%)
EPI294571 A/chicken/Egypt/3982-9/2010 (A/H5N1) segment 8 (NS) 1400.9 0.000000e+00 787/802 (98%)
EPI372755 A/Egypt/2752-NAMRU3/2009 (A/H5N1) segment 8 (NS) 1399.0 0.000000e+00 801/823 (97%)
EPI372653 A/Egypt/2472-NAMRU3/2008 (A/H5N1) segment 8 (NS) 1399.0 0.000000e+00 801/823 (97%)
EPI259610 A/duck/Egypt/D3Li2/2007 (A/H5N1) segment 8 (NS) 1399.0 0.000000e+00 801/823 (97%)
EPI259609 A/duck/Egypt/D3Lu1/2007 (A/H5N1) segment 8 (NS) 1399.0 0.000000e+00 801/823 (97%)
EPI259606 A/duck/Egypt/D1Li8/2007 (A/H5N1) segment 8 (NS) 1399.0 0.000000e+00 801/823 (97%)
EPI259605 A/duck/Egypt/D1Br6/2007 (A/H5N1) segment 8 (NS) 1399.0 0.000000e+00 801/823 (97%)
EPI259604 A/duck/Egypt/D1Tr4/2007 (A/H5N1) segment 8 (NS) 1399.0 0.000000e+00 801/823 (97%)
EPI232424 A/whooper swan/Mongolia/244/2005 (A/H5) segment 8 (NS) 1399.0 0.000000e+00 801/823 (97%)
EPI184091 A/mute swan/Hungary/4571/2006 (A/H5N1) segment 8 (NS) 1399.0 0.000000e+00 801/823 (97%)
EPI154926 A/duck/Egypt/1709-3VIR08/2007 (A/H5N1) segment 8 (NS) 1399.0 0.000000e+00 801/823 (97%)
EPI154339 A/falcon/Saudi Arabia/D1795/2005 (A/H5N1) segment 8 (NS) 1399.0 0.000000e+00 801/823 (97%)
EPI123438 A/tufted duck/Sweden/V599/06 (A/H5N1) segment 8 (NS) 1399.0 0.000000e+00 801/823 (97%)
EPI105787 A/turkey/Israel/446/2006 (A/H5N1) segment 8 (NS) 1399.0 0.000000e+00 801/823 (97%)
EPI105778 A/turkey/Israel/345/2006 (A/H5N1) segment 8 (NS) 1399.0 0.000000e+00 801/823 (97%)
EPI58685 A/chicken/Sudan/2115-9/2006 (A/H5N1) segment 8 (NS) 1399.0 0.000000e+00 801/823 (97%)
EPI57944 A/cygnus olor/Italy/808/2006 (A/H5N1) segment 8 (NS) 1399.0 0.000000e+00 801/823 (97%)
EPI47152 A/mallard/Italy/835/2006 (A/H5N1) segment 8 (NS) 1399.0 0.000000e+00 801/823 (97%)

_________________
www.twitter.com/hniman


Top
 Profile  
 
Display posts from previous:  Sort by  
Post new topic Reply to topic  [ 18 posts ]  Go to page 1, 2  Next

All times are UTC - 5 hours [ DST ]


Who is online

Users browsing this forum: Yahoo [Bot] and 71 guests


You cannot post new topics in this forum
You cannot reply to topics in this forum
You cannot edit your posts in this forum
You cannot delete your posts in this forum
You cannot post attachments in this forum

Search for:
Jump to:  
cron
Powered by phpBB® Forum Software © phpBB Group