Rhiza Labs FluTracker Forum

The place to discuss the flu
It is currently Fri Oct 20, 2017 7:05 pm

All times are UTC - 5 hours [ DST ]




Post new topic Reply to topic  [ 26 posts ]  Go to page 1, 2, 3  Next
Author Message
PostPosted: Fri Feb 20, 2015 12:41 pm 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
Douglas County H5N8 Sequence A/chicken/Oregon/41613-2/2014 at Genbank

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Fri Feb 20, 2015 12:44 pm 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
LOCUS KP739405 1744 bp cRNA linear VRL 18-FEB-2015
DEFINITION Influenza A virus (A/chicken/Oregon/41613-2/2014(H5N8)) segment 4
hemagglutinin (HA) gene, complete cds.
ACCESSION KP739405
VERSION KP739405.1 GI:756762548
KEYWORDS .
SOURCE Influenza A virus (A/chicken/Oregon/41613-2/2014(H5N8))
ORGANISM Influenza A virus (A/chicken/Oregon/41613-2/2014(H5N8))
Viruses; ssRNA negative-strand viruses; Orthomyxoviridae;
Influenzavirus A.
REFERENCE 1 (bases 1 to 1744)
AUTHORS Killian,M.L.
TITLE Direct Submission
JOURNAL Submitted (26-JAN-2015) Diagnostic Virology Laboratory, National
Veterinary Services Laboratories (NVSL), USDA, 1920 Dayton Avenue,
Ames, IA 50010, USA
COMMENT GenBank Accession Numbers KP739402-KP739409 represent sequences
from the 8 segments of Influenza A virus
(A/chicken/Oregon/41613-2/2014(H5N8)).

##Assembly-Data-START##
Assembly Method :: SeqMan NGen v. 4
Sequencing Technology :: IonTorrent
##Assembly-Data-END##
FEATURES Location/Qualifiers
source 1..1744
/organism="Influenza A virus
(A/chicken/Oregon/41613-2/2014(H5N8))"
/mol_type="viral cRNA"
/strain="A/chicken/Oregon/41613-2/2014"
/serotype="H5N8"
/isolation_source="tracheal swab"
/host="chicken; backyard poultry"
/db_xref="taxon:1609054"
/segment="4"
/country="USA: Douglas County, Oregon"
/collection_date="16-Dec-2014"
/note="NVSL 14-041613; EP1; Eurasian origin (EA-H5N8 clade
2.3.4.4)-related event"
gene 17..1720
/gene="HA"
CDS 17..1720
/gene="HA"
/codon_start=1
/product="hemagglutinin"
/protein_id="AJM70576.1"
/db_xref="GI:756762549"
/translation="MEKIVLLLAVISLVKSDQICIGYHANNSTKQVDTIMEKNVTVTH
AQDILEKTHNGKLCDLNGVKPLILKDCSVAGWLLGNPMCDEFIRVPEWSYIVERANPA
NDLCYPGTLNDYEELKHLLSRINHFEKTLIIPRSSWPNHETSLGVSAACPYQGASSFF
RNVVWLIKKNDAYPTIKISYNNTNREDLLILWGIHHSNNAAEQTNLYKNPDTYVSVGT
STLNQRLVPKIATRSQVNGQSGRMDFFWTILKPNDAIHFESNGNFIAPEYAYKIVKKG
DSTIMKSEMEYGHCNTKCQTPIGAINSSMPFHNIHPLTIGECPKYVKSNKLVLATGLR
NSPLRERRRKRGLFGAIAGFIEGGWQGMVDGWYGYHHSNEQGSGYAADKESTQKAIDG
VTNKVNSIIDKMNTQFEAVGREFNNLERRIENLNKKMEDGFLDVWTYNAELLVLMENE
RTLDFHDSNVKNLYDKVRLQLRDNAKELGNGCFEFYHKCDNECMESVRNGTYDYPKYS
EEAILKREEISGVKLESIGTYQILSIYSTVASSLALAIIVAGLSLWMCSNGSLQCRIC
I"
ORIGIN
1 ggttcaatct gtcaaaatgg agaaaatagt gcttcttctt gcagtgatta gccttgttaa
61 aagtgatcag atttgcattg gttaccatgc aaacaactca acaaagcagg ttgacacgat
121 aatggagaaa aacgtcactg ttacacatgc ccaagacata ctggaaaaga cacacaacgg
181 gaagctctgc gatcttaatg gagtgaagcc cctgattcta aaggattgta gcgtagctgg
241 gtggctcctt ggaaatccaa tgtgcgacga gttcatcagg gtaccggaat ggtcttacat
301 cgtggagagg gctaacccag ccaacgacct atgttaccca gggaccctca atgactatga
361 ggaactgaaa cacctattga gcagaataaa tcattttgag aaaactctga tcatccccag
421 gagttcttgg cccaatcatg aaacatcatt aggggtgagc gcagcatgtc cataccaggg
481 agcatcctca tttttcagaa atgtggtatg gctcatcaaa aagaacgatg catacccgac
541 aataaagata agctacaata ataccaatcg ggaagatctt ttgatactgt gggggattca
601 tcattccaac aatgcagcag agcagacaaa tctctataaa aacccagaca cttatgtttc
661 cgttgggaca tcaacattaa accagagatt ggtgccaaaa atagctacta gatcccaagt
721 aaacgggcag agtggaagaa tggatttctt ctggacaatt ttaaaaccga atgatgcaat
781 ccactttgag agtaatggaa atttcattgc tccagaatat gcatacaaaa ttgtcaagaa
841 aggggactca acaattatga aaagtgaaat ggagtatggc cactgcaaca ccaaatgtca
901 aactccaata ggggcgataa actctagcat gccattccac aatatacacc ctctcaccat
961 cggggaatgc cccaaatacg tgaagtcaaa caaattagtc cttgcgactg ggctcagaaa
1021 tagtcctcta agagaaagaa gaagaaaaag aggactattt ggagctatag cagggtttat
1081 agagggagga tggcagggaa tggtagacgg ttggtatggg tatcatcata gcaatgagca
1141 ggggagtggg tacgctgcag acaaagaatc cacccaaaag gcaatagatg gagttaccaa
1201 taaggtcaac tcaatcattg acaaaatgaa cactcaattt gaggccgttg gaagggaatt
1261 taataactta gaaaggagaa tagagaattt aaacaagaaa atggaagacg gattcctaga
1321 tgtctggact tataatgctg aacttttagt tctcatggaa aatgagagaa ctctagattt
1381 tcatgactca aatgtcaaga acctttacga caaagtccga ctacagctta gggataatgc
1441 aaaggagctg ggcaatggtt gtttcgagtt ctatcacaaa tgtgataacg aatgtatgga
1501 gagcgtaaga aatgggacgt atgactaccc taagtattca gaagaagcaa tattaaaaag
1561 agaagaaata agcggagtga aattagaatc aataggaact taccagatac tgtcaattta
1621 ttcaacagtg gcgagttccc tagcactggc aatcatagtg gctggtctat ctttatggat
1681 gtgctctaat gggtcgttac aatgcagaat ttgcatctaa atttgtgagc tcagattgta
1741 atta

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Fri Feb 20, 2015 12:46 pm 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
EPI553208 A/crane/Kagoshima/KU1/2014 (A/H5N8) segment 4 (HA) 3072.1 0.000000e+00 1689/1702 (99%)
EPI561570 A/Baikal teal/Korea/H96/2014 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%)
EPI561646 A/breeder duck/Korea/H249/2014 (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1690/1705 (99%)
EPI561626 A/mallard/Korea/H207/2014 (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1690/1705 (99%)
EPI561605 A/broiler duck/Korea/H145/2014 (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1690/1705 (99%)
EPI561591 A/breeder duck/Korea/H128/2014 (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1690/1705 (99%)
EPI561529 A/Baikal teal/Korea/H66/2014 (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1690/1705 (99%)
EPI561508 A/bean goose/Korea/H53/2014 (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1690/1705 (99%)
EPI561341 A/Baikal teal/Korea/H41/2014 (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1690/1705 (99%)
EPI561674 A/bean goose/Korea/H328/2014 (A/H5N8) segment 4 (HA) 3059.2 0.000000e+00 1689/1705 (99%)
EPI561612 A/breeder duck/Korea/H158/2014 (A/H5N8) segment 4 (HA) 3059.2 0.000000e+00 1689/1705 (99%)
EPI561577 A/breeder chicken/Korea/H122/2014 (A/H5N8) segment 4 (HA) 3059.2 0.000000e+00 1689/1705 (99%)
EPI561563 A/Baikal teal/Korea/H84/2014 (A/H5N8) segment 4 (HA) 3059.2 0.000000e+00 1689/1705 (99%)
EPI561542 A/Baikal teal/Korea/H68/2014 (A/H5N8) segment 4 (HA) 3059.2 0.000000e+00 1689/1705 (99%)
EPI561522 A/broiler duck/Korea/H65/2014 (A/H5N8) segment 4 (HA) 3059.2 0.000000e+00 1689/1705 (99%)
EPI561705 A/bean goose/Korea/H40/2014 (A/H5N8) segment 4 (HA) 3053.6 0.000000e+00 1688/1705 (99%)
EPI561667 A/mallard/Korea/H297/2014 (A/H5N8) segment 4 (HA) 3053.6 0.000000e+00 1689/1706 (99%)
EPI561653 A/breeder chicken/Korea/H250/2014 (A/H5N8) segment 4 (HA) 3053.6 0.000000e+00 1688/1705 (99%)
EPI561633 A/white-fronted goose/Korea/H231/2014 (A/H5N8) segment 4 (HA) 3053.6 0.000000e+00 1688/1705 (99%)
EPI509704 A/broiler duck/Korea/Buan2/2014 (A/H5N8) segment 4 (HA) 3053.6 0.000000e+00 1688/1705 (99%)
EPI561697 A/spot-billed duck/Korea/H455-42/2014 (A/H5N8) segment 4 (HA) 3048.1 0.000000e+00 1687/1705 (98%)
EPI561681 A/tundra swan/Korea/H411/2014 (A/H5N8) segment 4 (HA) 3048.1 0.000000e+00 1687/1705 (98%)
EPI561660 A/Korean native chicken/Korea/H257/2014 (A/H5N8) segment 4 (HA) 3048.1 0.000000e+00 1687/1705 (98%)
EPI561598 A/broiler duck/Korea/H133/2014 (A/H5N8) segment 4 (HA) 3048.1 0.000000e+00 1687/1705 (98%)
EPI561360 A/broiler duck/Korea/H49/2014 (A/H5N8) segment 4 (HA) 3048.1 0.000000e+00 1687/1705 (98%)
EPI561348 A/broiler duck/Korea/H47/2014 (A/H5N8) segment 4 (HA) 3048.1 0.000000e+00 1687/1705 (98%)
EPI561336 A/broiler duck/Korea/H48/2014 (A/H5N8) segment 4 (HA) 3048.1 0.000000e+00 1687/1705 (98%)
EPI561204 A/broiler duck/Korea/H31/2014 (A/H5N8) segment 4 (HA) 3048.1 0.000000e+00 1687/1705 (98%)
EPI561196 A/broiler duck/Korea/H29/2014 (A/H5N8) segment 4 (HA) 3048.1 0.000000e+00 1687/1705 (98%)
EPI561187 A/waterfowl/Korea/S005/2014 (A/H5N8) segment 4 (HA) 3048.1 0.000000e+00 1687/1705 (98%)
EPI517161 A/Chicken/Kumamoto/1-7/2014 (A/H5N8) segment 4 (HA) 3048.1 0.000000e+00 1687/1705 (98%)
EPI561690 A/common teal/Korea/H455-30/2014 (A/H5N8) segment 4 (HA) 3042.6 0.000000e+00 1686/1705 (98%)
EPI561556 A/Coot/Korea/H81/2014 (A/H5N8) segment 4 (HA) 3042.6 0.000000e+00 1686/1705 (98%)
EPI561549 A/Baikal teal/Korea/H80/2014 (A/H5N8) segment 4 (HA) 3042.6 0.000000e+00 1686/1705 (98%)
EPI561515 A/Baikal teal/Korea/H62/2014 (A/H5N8) segment 4 (HA) 3042.6 0.000000e+00 1686/1705 (98%)
EPI509709 A/baikal teal/Korea/Donglim3/2014 (A/H5N8) segment 4 (HA) 3042.6 0.000000e+00 1686/1705 (98%)
EPI561619 A/breeder duck/Korea/H200/2014 (A/H5N8) segment 4 (HA) 3031.5 0.000000e+00 1685/1706 (98%)
EPI542628 A/mallard/Korea/W452/2014 (A/H5N8) segment 4 (HA) 3025.9 0.000000e+00 1683/1705 (98%)
EPI550849 A/duck/England/36226/14 (A/H5N8) segment 4 (HA) 3014.9 0.000000e+00 1681/1705 (98%)
EPI550848 A/duck/England/36038/14 (A/H5N8) segment 4 (HA) 3014.9 0.000000e+00 1681/1705 (98%)
EPI553349 A/wigeon/Sakha/1/2014 (A/H5N8) segment 4 (HA) 3009.3 0.000000e+00 1680/1705 (98%)
EPI547673 A/duck/England/36254/14 (A/H5N8) segment 4 (HA) 3003.8 0.000000e+00 1679/1705 (98%)
EPI552746 A/turkey/Germany/R2474-L00899/2014 (A/H5N8) segment 4 (HA) 2992.7 0.000000e+00 1677/1705 (98%)
EPI548493 A/duck/Chiba/26-372-61/2014 (A/H5N8) segment 4 (HA) 2992.7 0.000000e+00 1677/1705 (98%)
EPI548485 A/duck/Chiba/26-372-48/2014 (A/H5N8) segment 4 (HA) 2992.7 0.000000e+00 1677/1705 (98%)
EPI547678 A/Chicken/Netherlands/14015526/2014 (A/H5N8) segment 4 (HA) 2992.7 0.000000e+00 1677/1705 (98%)
EPI548623 A/chicken/Netherlands/14015531/2014 (A/H5N8) segment 4 (HA) 2987.2 0.000000e+00 1676/1705 (98%)
EPI553362 A/environment/Kagoshima/KU-ngr-H/2014 (A/H5N8) segment 4 (HA) 2981.6 0.000000e+00 1675/1705 (98%)
EPI553343 A/chicken/Miyazaki/7/2014 (A/H5N8) segment 4 (HA) 2981.6 0.000000e+00 1676/1706 (98%)
EPI544756 A/turkey/Germany-MV/R2472/2014 (A/H5N8) segment 4 (HA) 2970.5 0.000000e+00 1665/1693 (98%)
EPI552776 A/chicken/Netherlands/emc-3/2014 (A/H5N8) segment 4 (HA) 2946.5 0.000000e+00 1655/1684 (98%)
EPI552768 A/eurasian wigeon/Netherlands/emc-2/2014 (A/H5N8) segment 4 (HA) 2946.5 0.000000e+00 1661/1693 (98%)
EPI552760 A/eurasian wigeon/Netherlands/emc-1/2014 (A/H5N8) segment 4 (HA) 2909.6 0.000000e+00 1626/1651 (98%)
EPI551149 A/eurasian wigeon/Netherlands/emc-2/2014 (A/H5N8) segment 4 (HA) 2900.4 0.000000e+00 1636/1668 (98%)
EPI543010 A/duck/Beijing/CT01/2014 (A/H5N8) segment 4 (HA) 2843.1 0.000000e+00 1586/1609 (98%)
EPI551143 A/eurasian wigeon/Netherlands/emc-1/2014 (A/H5N8) segment 4 (HA) 2837.6 0.000000e+00 1587/1612 (98%)
EPI543002 A/duck/Beijing/FS01/2014 (A/H5N8) segment 4 (HA) 2832.0 0.000000e+00 1585/1610 (98%)
EPI542617 A/duck/Beijing/FS01/2013 (A/H5N8) segment 4 (HA) 2826.5 0.000000e+00 1582/1609 (98%)
EPI442017 A/duck/Jiangsu/k1203/2010 (A/H5N8) segment 4 (HA) 2826.5 0.000000e+00 1650/1708 (96%)
EPI475579 A/wild duck/Shandong/628/2011 (A/H5N1) segment 4 (HA) 2821.0 0.000000e+00 1650/1709 (96%)
EPI399960 A/duck/Jiangsu/m234/2012 (A/H5N2) segment 4 (HA) 2782.2 0.000000e+00 1644/1710 (96%)
EPI398966 A/goose/Eastern China/1112/2011 (A/H5N2) segment 4 (HA) 2782.2 0.000000e+00 1643/1709 (96%)
EPI431456 A/duck/Hebei/3/2011 (A/H5N2) segment 4 (HA) 2771.1 0.000000e+00 1641/1709 (96%)
EPI398965 A/duck/Eastern China/1111/2011 (A/H5N2) segment 4 (HA) 2765.6 0.000000e+00 1640/1709 (95%)
EPI530054 A/duck/Jiangxi/95/2014 (A/H5N6) segment 4 (HA) 2754.5 0.000000e+00 1637/1708 (95%)
EPI544892 A/duck/Shandong/Q1/2013 (A/H5N8) segment 4 (HA) 2748.9 0.000000e+00 1639/1711 (95%)
EPI531456 A/duck/Guangdong/GD01/2014 (A/H5N6) segment 4 (HA) 2748.9 0.000000e+00 1636/1708 (95%)
EPI509698 A/breeder duck/Korea/Gochang1/2014 (A/H5N8) segment 4 (HA) 2748.9 0.000000e+00 1637/1709 (95%)
EPI561495 A/Baikal teal/Korea/H52/2014 (A/H5N8) segment 4 (HA) 2737.9 0.000000e+00 1635/1709 (95%)
EPI530985 A/duck/Zhejiang/W24/2013 (A/H5N8) segment 4 (HA) 2737.9 0.000000e+00 1633/1707 (95%)
EPI507673 A/mallard duck/Shanghai/SH-9/2013 (A/H5N8) segment 4 (HA) 2732.3 0.000000e+00 1633/1708 (95%)
EPI530063 A/environment/Shenzhen/25-24/2013 (A/H5N6) segment 4 (HA) 2726.8 0.000000e+00 1632/1708 (95%)
EPI553144 A/turkey/Italy/14VIR7898-10/2014 (A/H5N8) segment 4 (HA) 2723.1 0.000000e+00 1522/1546 (98%)
EPI530986 A/duck/Zhejiang/6D18/2013 (A/H5N8) segment 4 (HA) 2721.2 0.000000e+00 1632/1709 (95%)
EPI550768 A/duck/Laos/XBY004/2014 (A/H5N6) segment 4 (HA) 2715.7 0.000000e+00 1631/1709 (95%)
EPI550763 A/duck/Laos/XBY004/2014 (A/H5N6) segment 4 (HA) 2715.7 0.000000e+00 1631/1709 (95%)
EPI550759 A/chicken/Laos/XBY003/2014 (A/H5N6) segment 4 (HA) 2715.7 0.000000e+00 1631/1709 (95%)
EPI550757 A/duck/Laos/LPQ002/2014 (A/H5N6) segment 4 (HA) 2715.7 0.000000e+00 1631/1709 (95%)
EPI499478 A/chicken/China/AH/2012 (A/H5N1) segment 4 (HA) 2715.7 0.000000e+00 1630/1708 (95%)
EPI493825 A/duck/Guangdong/wy19/2008 (A/H5N5) segment 4 (HA) 2715.7 0.000000e+00 1632/1710 (95%)
EPI431448 A/duck/Hebei/2/2011 (A/H5N2) segment 4 (HA) 2712.0 0.000000e+00 1630/1709 (95%)
EPI550752 A/chicken/Laos/LPQ001/2014 (A/H5N6) segment 4 (HA) 2710.2 0.000000e+00 1630/1709 (95%)
EPI493817 A/duck/Guangdong/wy11/2008 (A/H5N5) segment 4 (HA) 2693.5 0.000000e+00 1629/1711 (95%)
EPI328878 A/duck/Eastern China/031/2009 (A/H5N5) segment 4 (HA) 2660.3 0.000000e+00 1621/1709 (94%)
EPI533583 A/Sichuan/26221/2014 (A/H5N6) segment 4 (HA) 2632.6 0.000000e+00 1617/1710 (94%)
EPI328870 A/duck/Eastern China/008/2008 (A/H5N5) segment 4 (HA) 2632.6 0.000000e+00 1617/1710 (94%)
EPI547402 A/environment/Zhenjiang/C13/2013 (A/H5N6) segment 4 (HA) 2627.1 0.000000e+00 1617/1711 (94%)
EPI328886 A/duck/Eastern China/108/2008 (A/H5N1) segment 4 (HA) 2627.1 0.000000e+00 1616/1710 (94%)
EPI493833 A/duck/Guangdong/wy24/2008 (A/H5N5) segment 4 (HA) 2617.8 0.000000e+00 1617/1713 (94%)
EPI442025 A/quail/Jiangsu/k0104/2010 (A/H5N5) segment 4 (HA) 2617.8 0.000000e+00 1617/1713 (94%)
EPI442001 A/goose/Shandong/k1204/2009 (A/H5N5) segment 4 (HA) 2571.7 0.000000e+00 1605/1709 (93%)
EPI442009 A/goose/Guangdong/k0103/2010 (A/H5N5) segment 4 (HA) 2562.4 0.000000e+00 1606/1712 (93%)
EPI127384 A/wild duck/Hunan/021/2005 (A/H5N1) segment 4 (HA) 2510.7 0.000000e+00 1594/1709 (93%)
EPI227309 A/Mallard/Huadong/lk/2005 (A/H5N1) segment 4 (HA) 2505.2 0.000000e+00 1592/1708 (93%)
EPI127406 A/wild duck/Hunan/211/2005 (A/H5N1) segment 4 (HA) 2505.2 0.000000e+00 1593/1709 (93%)
EPI439897 A/goose/Guangdong/08/2005 (A/H5N1) segment 4 (HA) 2503.3 0.000000e+00 1593/1709 (93%)
EPI399886 A/duck/HuBei/03/2010 (A/H5N5) segment 4 (HA) 2499.6 0.000000e+00 1593/1710 (93%)
EPI279949 A/Zhejiang/1/2006 (A/H5N1) segment 4 (HA) 2499.6 0.000000e+00 1592/1709 (93%)
EPI276046 A/goose/Hubei/65/2005 (A/H5N1) segment 4 (HA) 2499.6 0.000000e+00 1592/1709 (93%)
EPI181297 A/Zhejiang/1/2006 (A/H5N1) segment 4 (HA) 2499.6 0.000000e+00 1592/1709 (93%)

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Fri Feb 20, 2015 1:41 pm 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
EPI561544 A/Baikal teal/Korea/H68/2014 (A/H5N8) segment 6 (NA) 2564.3 0.000000e+00 1400/1406 (99%)
EPI561676 A/bean goose/Korea/H328/2014 (A/H5N8) segment 6 (NA) 2558.7 0.000000e+00 1399/1406 (99%)
EPI561662 A/Korean native chicken/Korea/H257/2014 (A/H5N8) segment 6 (NA) 2558.7 0.000000e+00 1399/1406 (99%)
EPI561655 A/breeder chicken/Korea/H250/2014 (A/H5N8) segment 6 (NA) 2558.7 0.000000e+00 1399/1406 (99%)
EPI561648 A/breeder duck/Korea/H249/2014 (A/H5N8) segment 6 (NA) 2558.7 0.000000e+00 1399/1406 (99%)
EPI561635 A/white-fronted goose/Korea/H231/2014 (A/H5N8) segment 6 (NA) 2558.7 0.000000e+00 1399/1406 (99%)
EPI561628 A/mallard/Korea/H207/2014 (A/H5N8) segment 6 (NA) 2558.7 0.000000e+00 1399/1406 (99%)
EPI561621 A/breeder duck/Korea/H200/2014 (A/H5N8) segment 6 (NA) 2558.7 0.000000e+00 1399/1406 (99%)
EPI561614 A/breeder duck/Korea/H158/2014 (A/H5N8) segment 6 (NA) 2558.7 0.000000e+00 1399/1406 (99%)
EPI561579 A/breeder chicken/Korea/H122/2014 (A/H5N8) segment 6 (NA) 2558.7 0.000000e+00 1399/1406 (99%)
EPI561510 A/bean goose/Korea/H53/2014 (A/H5N8) segment 6 (NA) 2558.7 0.000000e+00 1399/1406 (99%)
EPI561362 A/broiler duck/Korea/H49/2014 (A/H5N8) segment 6 (NA) 2558.7 0.000000e+00 1399/1406 (99%)
EPI561355 A/broiler duck/Korea/H48/2014 (A/H5N8) segment 6 (NA) 2558.7 0.000000e+00 1399/1406 (99%)
EPI561350 A/broiler duck/Korea/H47/2014 (A/H5N8) segment 6 (NA) 2558.7 0.000000e+00 1399/1406 (99%)
EPI561343 A/Baikal teal/Korea/H41/2014 (A/H5N8) segment 6 (NA) 2558.7 0.000000e+00 1399/1406 (99%)
EPI561209 A/broiler duck/Korea/H31/2014 (A/H5N8) segment 6 (NA) 2558.7 0.000000e+00 1399/1406 (99%)
EPI561198 A/broiler duck/Korea/H29/2014 (A/H5N8) segment 6 (NA) 2558.7 0.000000e+00 1399/1406 (99%)
EPI509714 A/baikal teal/Korea/Donglim3/2014 (A/H5N8) segment 6 (NA) 2558.7 0.000000e+00 1399/1406 (99%)
EPI509706 A/broiler duck/Korea/Buan2/2014 (A/H5N8) segment 6 (NA) 2558.7 0.000000e+00 1399/1406 (99%)
EPI561707 A/bean goose/Korea/H40/2014 (A/H5N8) segment 6 (NA) 2553.2 0.000000e+00 1398/1406 (99%)
EPI561699 A/spot-billed duck/Korea/H455-42/2014 (A/H5N8) segment 6 (NA) 2553.2 0.000000e+00 1398/1406 (99%)
EPI561683 A/tundra swan/Korea/H411/2014 (A/H5N8) segment 6 (NA) 2553.2 0.000000e+00 1398/1406 (99%)
EPI561669 A/mallard/Korea/H297/2014 (A/H5N8) segment 6 (NA) 2553.2 0.000000e+00 1398/1406 (99%)
EPI561607 A/broiler duck/Korea/H145/2014 (A/H5N8) segment 6 (NA) 2553.2 0.000000e+00 1398/1406 (99%)
EPI561600 A/broiler duck/Korea/H133/2014 (A/H5N8) segment 6 (NA) 2553.2 0.000000e+00 1399/1407 (99%)
EPI561593 A/breeder duck/Korea/H128/2014 (A/H5N8) segment 6 (NA) 2553.2 0.000000e+00 1398/1406 (99%)
EPI561572 A/Baikal teal/Korea/H96/2014 (A/H5N8) segment 6 (NA) 2553.2 0.000000e+00 1398/1406 (99%)
EPI561565 A/Baikal teal/Korea/H84/2014 (A/H5N8) segment 6 (NA) 2553.2 0.000000e+00 1398/1406 (99%)
EPI561558 A/Coot/Korea/H81/2014 (A/H5N8) segment 6 (NA) 2553.2 0.000000e+00 1398/1406 (99%)
EPI561551 A/Baikal teal/Korea/H80/2014 (A/H5N8) segment 6 (NA) 2553.2 0.000000e+00 1398/1406 (99%)
EPI561531 A/Baikal teal/Korea/H66/2014 (A/H5N8) segment 6 (NA) 2553.2 0.000000e+00 1398/1406 (99%)
EPI561524 A/broiler duck/Korea/H65/2014 (A/H5N8) segment 6 (NA) 2553.2 0.000000e+00 1398/1406 (99%)
EPI561517 A/Baikal teal/Korea/H62/2014 (A/H5N8) segment 6 (NA) 2553.2 0.000000e+00 1398/1406 (99%)
EPI561692 A/common teal/Korea/H455-30/2014 (A/H5N8) segment 6 (NA) 2547.7 0.000000e+00 1397/1406 (99%)
EPI561189 A/waterfowl/Korea/S005/2014 (A/H5N8) segment 6 (NA) 2547.7 0.000000e+00 1397/1406 (99%)
EPI542632 A/mallard/Korea/W452/2014 (A/H5N8) segment 6 (NA) 2547.7 0.000000e+00 1397/1406 (99%)
EPI552748 A/turkey/Germany/R2474-L00899/2014 (A/H5N8) segment 6 (NA) 2542.1 0.000000e+00 1396/1406 (99%)
EPI544759 A/turkey/Germany-MV/R2472/2014 (A/H5N8) segment 6 (NA) 2542.1 0.000000e+00 1396/1406 (99%)
EPI543012 A/duck/Beijing/CT01/2014 (A/H5N8) segment 6 (NA) 2542.1 0.000000e+00 1396/1406 (99%)
EPI517163 A/Chicken/Kumamoto/1-7/2014 (A/H5N8) segment 6 (NA) 2542.1 0.000000e+00 1396/1406 (99%)
EPI558000 A/duck/England/36226/14 (A/H5N8) segment 6 (NA) 2536.6 0.000000e+00 1395/1406 (99%)
EPI543004 A/duck/Beijing/FS01/2014 (A/H5N8) segment 6 (NA) 2536.6 0.000000e+00 1395/1406 (99%)
EPI558007 A/duck/England/36038/14 (A/H5N8) segment 6 (NA) 2531.0 0.000000e+00 1394/1406 (99%)
EPI553350 A/wigeon/Sakha/1/2014 (A/H5N8) segment 6 (NA) 2531.0 0.000000e+00 1394/1406 (99%)
EPI553345 A/chicken/Miyazaki/7/2014 (A/H5N8) segment 6 (NA) 2531.0 0.000000e+00 1394/1406 (99%)
EPI548495 A/duck/Chiba/26-372-61/2014 (A/H5N8) segment 6 (NA) 2531.0 0.000000e+00 1394/1406 (99%)
EPI548487 A/duck/Chiba/26-372-48/2014 (A/H5N8) segment 6 (NA) 2531.0 0.000000e+00 1394/1406 (99%)
EPI547683 A/Chicken/Netherlands/14015526/2014 (A/H5N8) segment 6 (NA) 2531.0 0.000000e+00 1394/1406 (99%)
EPI548626 A/chicken/Netherlands/14015531/2014 (A/H5N8) segment 6 (NA) 2525.5 0.000000e+00 1393/1406 (99%)
EPI553152 A/turkey/Germany-NI/R3372/2014 (A/H5N8) segment 6 (NA) 2520.0 0.000000e+00 1393/1407 (99%)
EPI547675 A/duck/England/36254/14 (A/H5N8) segment 6 (NA) 2520.0 0.000000e+00 1392/1406 (99%)
EPI555122 A/mallard/Germany-ST/R23/2015 (A/H5N8) segment 6 (NA) 2514.4 0.000000e+00 1391/1406 (98%)
EPI554606 A/domestic duck/Germany-NI/R3468/2014 (A/H5N8) segment 6 (NA) 2514.4 0.000000e+00 1392/1407 (98%)
EPI553210 A/crane/Kagoshima/KU1/2014 (A/H5N8) segment 6 (NA) 2514.4 0.000000e+00 1391/1406 (98%)
EPI555068 A/turkey/Italy/14VIR7898-10/2014 (A/H5N8) segment 6 (NA) 2510.7 0.000000e+00 1389/1405 (98%)
EPI551150 A/eurasian wigeon/Netherlands/emc-2/2014 (A/H5N8) segment 6 (NA) 2492.3 0.000000e+00 1373/1385 (99%)
EPI552778 A/chicken/Netherlands/emc-3/2014 (A/H5N8) segment 6 (NA) 2484.9 0.000000e+00 1369/1381 (99%)
EPI552770 A/eurasian wigeon/Netherlands/emc-2/2014 (A/H5N8) segment 6 (NA) 2483.0 0.000000e+00 1368/1380 (99%)
EPI552762 A/eurasian wigeon/Netherlands/emc-1/2014 (A/H5N8) segment 6 (NA) 2477.5 0.000000e+00 1365/1377 (99%)
EPI551144 A/eurasian wigeon/Netherlands/emc-1/2014 (A/H5N8) segment 6 (NA) 2477.5 0.000000e+00 1365/1377 (99%)
EPI553364 A/environment/Kagoshima/KU-ngr-H/2014 (A/H5N8) segment 6 (NA) 2466.4 0.000000e+00 1384/1408 (98%)
EPI542627 A/duck/Beijing/FS01/2013 (A/H5N8) segment 6 (NA) 2466.4 0.000000e+00 1367/1385 (98%)
EPI530990 A/duck/Zhejiang/6D18/2013 (A/H5N8) segment 6 (NA) 2409.2 0.000000e+00 1373/1407 (97%)
EPI530989 A/duck/Zhejiang/W24/2013 (A/H5N8) segment 6 (NA) 2403.6 0.000000e+00 1372/1407 (97%)
EPI507675 A/mallard duck/Shanghai/SH-9/2013 (A/H5N8) segment 6 (NA) 2403.6 0.000000e+00 1372/1407 (97%)
EPI561493 A/Baikal teal/Korea/H52/2014 (A/H5N8) segment 6 (NA) 2398.1 0.000000e+00 1371/1407 (97%)
EPI544894 A/duck/Shandong/Q1/2013 (A/H5N8) segment 6 (NA) 2398.1 0.000000e+00 1371/1407 (97%)
EPI509700 A/breeder duck/Korea/Gochang1/2014 (A/H5N8) segment 6 (NA) 2398.1 0.000000e+00 1371/1407 (97%)
EPI442019 A/duck/Jiangsu/k1203/2010 (A/H5N8) segment 6 (NA) 2392.5 0.000000e+00 1362/1395 (97%)
EPI485330 A/common shelduck/Mongolia/2185/2011 (A/H3N8) segment 6 (NA) 2126.6 0.000000e+00 1323/1408 (93%)
EPI132266 A/duck/Eastern China/90/2004 (A/H3N8) segment 6 (NA) 2115.5 0.000000e+00 1321/1408 (93%)
EPI132262 A/duck/Eastern China/19/2004 (A/H3N8) segment 6 (NA) 2104.5 0.000000e+00 1319/1408 (93%)
EPI326921 A/environment/Korea/SH12-6/2008 (A/H3N8) segment 6 (NA) 2093.4 0.000000e+00 1316/1407 (93%)
EPI416940 A/duck/Vietnam/OIE-2577/2011 (A/H3N8) segment 6 (NA) 2060.1 0.000000e+00 1311/1408 (93%)
EPI438257 A/duck/Vietnam/G18-1/2011 (A/H3N8) segment 6 (NA) 2043.5 0.000000e+00 1308/1408 (92%)
EPI387415 A/ruddy shelduck/Mongolia/1-26/2007 (A/H3N8) segment 6 (NA) 2043.5 0.000000e+00 1281/1367 (93%)
EPI387510 A/ruddy shelduck/Mongolia/2-79/2007 (A/H3N8) segment 6 (NA) 2021.4 0.000000e+00 1278/1368 (93%)
EPI387494 A/pintail/Mongolia/2-65/2007 (A/H3N8) segment 6 (NA) 2015.8 0.000000e+00 1277/1368 (93%)
EPI326920 A/environment/Korea/SH12-8/2008 (A/H3N8) segment 6 (NA) 2014.0 0.000000e+00 1273/1364 (93%)
EPI363489 A/duck/Guangxi/2736/2006 (A/H6N8) segment 6 (NA) 2004.7 0.000000e+00 1301/1408 (92%)
EPI485320 A/ruddy shelduck/Mongolia/1787/2011 (A/H3N8) segment 6 (NA) 1941.9 0.000000e+00 1280/1391 (92%)
EPI485328 A/common shelduck/Mongolia/2076/2011 (A/H3N8) segment 6 (NA) 1833.0 0.000000e+00 1252/1379 (90%)
EPI407886 A/duck/Ukraine/1963 (A/H3N8) segment 6 (NA) 1711.1 0.000000e+00 1255/1415 (88%)
EPI128912 A/duck/Ukraine/1/1963 (A/H3N8) segment 6 (NA) 1711.1 0.000000e+00 1254/1414 (88%)
EPI42182 A/duck/Ukraine/1/1963 (A/H3N8) segment 6 (NA) 1711.1 0.000000e+00 1255/1415 (88%)
EPI3107 A/duck/Ukraine/1/1963 (A/H3N8) segment 6 (NA) 1705.6 0.000000e+00 1254/1415 (88%)
EPI132460 A/duck/Ukraine/1/1963 (A/H3N8) segment 6 (NA) 1700.0 0.000000e+00 1253/1415 (88%)
EPI251642 A/mallard/Netherlands/10/1999 (A/H1N8) segment 6 (NA) 1685.3 0.000000e+00 1207/1352 (89%)
EPI128904 A/duck/Burjatia/652/1988 (A/H3N8) segment 6 (NA) 1633.6 0.000000e+00 1245/1419 (87%)
EPI2999 A/duck/Hong Kong/438/1977 (A/H4N8) segment 6 (NA) 1633.6 0.000000e+00 1242/1416 (87%)
EPI314410 A/mallard/Czech Republic/14516/2007 (A/H3N8) segment 6 (NA) 1628.0 0.000000e+00 1237/1412 (87%)
EPI182043 A/common eider/Netherlands/1/2006 (A/H3N8) segment 6 (NA) 1628.0 0.000000e+00 1240/1415 (87%)
EPI336006 A/teal/Chany/444/2009 (A/H8N8) segment 6 (NA) 1622.5 0.000000e+00 1239/1415 (87%)
EPI316502 A/duck/Hubei/126/1985 (A/H7N8) segment 6 (NA) 1622.5 0.000000e+00 1242/1418 (87%)
EPI251715 A/mallard/Sweden/45/2002 (A/H11N8) segment 6 (NA) 1622.5 0.000000e+00 1238/1414 (87%)
EPI398948 A/mallard/Norway/10_779/2009 (A/H3N8) segment 6 (NA) 1616.9 0.000000e+00 1238/1415 (87%)
EPI372503 A/mallard/Ukraine/05842-NAMRU3/2006 (A/H3N8) segment 6 (NA) 1616.9 0.000000e+00 1236/1413 (87%)
EPI339175 A/mallard/Germany-BY/R1353/2010 (A/H6N8) segment 6 (NA) 1616.9 0.000000e+00 1235/1412 (87%)
EPI339174 A/goose/Germany/R1767/2007 (A/H6N8) segment 6 (NA) 1616.9 0.000000e+00 1236/1413 (87%)
EPI316762 A/mallard/Czech Republic/13577-24K/2010 (A/H3N8) segment 6 (NA) 1616.9 0.000000e+00 1235/1412 (87%)

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Fri Feb 20, 2015 1:50 pm 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
EPI561700 A/spot-billed duck/Korea/H455-42/2014 (A/H5N8) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI561693 A/common teal/Korea/H455-30/2014 (A/H5N8) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI561684 A/tundra swan/Korea/H411/2014 (A/H5N8) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI561677 A/bean goose/Korea/H328/2014 (A/H5N8) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI561670 A/mallard/Korea/H297/2014 (A/H5N8) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI561656 A/breeder chicken/Korea/H250/2014 (A/H5N8) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI561649 A/breeder duck/Korea/H249/2014 (A/H5N8) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI561636 A/white-fronted goose/Korea/H231/2014 (A/H5N8) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI561629 A/mallard/Korea/H207/2014 (A/H5N8) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI561622 A/breeder duck/Korea/H200/2014 (A/H5N8) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI561601 A/broiler duck/Korea/H133/2014 (A/H5N8) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI561594 A/breeder duck/Korea/H128/2014 (A/H5N8) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI561580 A/breeder chicken/Korea/H122/2014 (A/H5N8) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI561573 A/Baikal teal/Korea/H96/2014 (A/H5N8) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI561566 A/Baikal teal/Korea/H84/2014 (A/H5N8) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI561559 A/Coot/Korea/H81/2014 (A/H5N8) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI561552 A/Baikal teal/Korea/H80/2014 (A/H5N8) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI561532 A/Baikal teal/Korea/H66/2014 (A/H5N8) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI561525 A/broiler duck/Korea/H65/2014 (A/H5N8) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI561511 A/bean goose/Korea/H53/2014 (A/H5N8) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI561351 A/broiler duck/Korea/H47/2014 (A/H5N8) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI561344 A/Baikal teal/Korea/H41/2014 (A/H5N8) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI561211 A/broiler duck/Korea/H31/2014 (A/H5N8) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI561199 A/broiler duck/Korea/H29/2014 (A/H5N8) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI561190 A/waterfowl/Korea/S005/2014 (A/H5N8) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI553211 A/crane/Kagoshima/KU1/2014 (A/H5N8) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI542633 A/mallard/Korea/W452/2014 (A/H5N8) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI517164 A/Chicken/Kumamoto/1-7/2014 (A/H5N8) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI509756 A/baikal teal/Korea/Donglim3/2014 (A/H5N8) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI509711 A/broiler duck/Korea/Buan2/2014 (A/H5N8) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI561708 A/bean goose/Korea/H40/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI561663 A/Korean native chicken/Korea/H257/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI561615 A/breeder duck/Korea/H158/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI561608 A/broiler duck/Korea/H145/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI561545 A/Baikal teal/Korea/H68/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI561518 A/Baikal teal/Korea/H62/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI561363 A/broiler duck/Korea/H49/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI561356 A/broiler duck/Korea/H48/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI554603 A/turkey/Germany-NI/R3372/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI553346 A/chicken/Miyazaki/7/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI552749 A/turkey/Germany/R2474-L00899/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI548627 A/chicken/Netherlands/14015531/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI547684 A/Chicken/Netherlands/14015526/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI558012 A/duck/England/36038/14 (A/H5N8) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI558005 A/duck/England/36226/14 (A/H5N8) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI553365 A/environment/Kagoshima/KU-ngr-H/2014 (A/H5N8) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI548496 A/duck/Chiba/26-372-61/2014 (A/H5N8) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI548488 A/duck/Chiba/26-372-48/2014 (A/H5N8) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI547676 A/duck/England/36254/14 (A/H5N8) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI555124 A/domestic duck/Germany-NI/R3468/2014 (A/H5N8) segment 7 (MP) 1796.1 0.000000e+00 976/978 (99%)
EPI553181 A/turkey/Italy/14VIR7898-10/2014 (A/H5N8) segment 7 (MP) 1796.1 0.000000e+00 976/978 (99%)
EPI548426 A/turkey/Germany-MV/R2472/2014 (A/H5N8) segment 7 (MP) 1796.1 0.000000e+00 976/978 (99%)
EPI542997 A/duck/Beijing/FS01/2013 (A/H5N8) segment 7 (MP) 1792.4 0.000000e+00 976/979 (99%)
EPI543005 A/duck/Beijing/FS01/2014 (A/H5N8) segment 7 (MP) 1786.8 0.000000e+00 975/979 (99%)
EPI431451 A/duck/Hebei/2/2011 (A/H5N2) segment 7 (MP) 1764.7 0.000000e+00 973/982 (99%)
EPI414241 A/duck/Jiangsu/1-15/2011 (A/H4N2) segment 7 (MP) 1759.1 0.000000e+00 972/982 (98%)
EPI398977 A/duck/Eastern China/1111/2011 (A/H5N2) segment 7 (MP) 1759.1 0.000000e+00 972/982 (98%)
EPI552763 A/eurasian wigeon/Netherlands/emc-1/2014 (A/H5N8) segment 7 (MP) 1716.7 0.000000e+00 947/955 (99%)
EPI475582 A/wild duck/Shandong/628/2011 (A/H5N1) segment 7 (MP) 1714.8 0.000000e+00 964/982 (98%)
EPI399963 A/duck/Jiangsu/m234/2012 (A/H5N2) segment 7 (MP) 1709.3 0.000000e+00 963/982 (98%)
EPI328891 A/duck/Eastern China/909/2009 (A/H5N1) segment 7 (MP) 1709.3 0.000000e+00 963/982 (98%)
EPI328875 A/duck/Eastern China/031/2009 (A/H5N5) segment 7 (MP) 1709.3 0.000000e+00 963/982 (98%)
EPI328867 A/duck/Eastern China/008/2008 (A/H5N5) segment 7 (MP) 1709.3 0.000000e+00 963/982 (98%)
EPI328883 A/duck/Eastern China/108/2008 (A/H5N1) segment 7 (MP) 1703.7 0.000000e+00 962/982 (97%)
EPI442028 A/quail/Jiangsu/k0104/2010 (A/H5N5) segment 7 (MP) 1698.2 0.000000e+00 961/982 (97%)
EPI398978 A/goose/Eastern China/1112/2011 (A/H5N2) segment 7 (MP) 1698.2 0.000000e+00 961/982 (97%)
EPI442004 A/goose/Shandong/k1204/2009 (A/H5N5) segment 7 (MP) 1687.1 0.000000e+00 960/983 (97%)
EPI431459 A/duck/Hebei/3/2011 (A/H5N2) segment 7 (MP) 1681.6 0.000000e+00 958/982 (97%)
EPI552779 A/chicken/Netherlands/emc-3/2014 (A/H5N8) segment 7 (MP) 1677.9 0.000000e+00 912/914 (99%)
EPI442020 A/duck/Jiangsu/k1203/2010 (A/H5N8) segment 7 (MP) 1676.0 0.000000e+00 957/982 (97%)
EPI493836 A/duck/Guangdong/wy24/2008 (A/H5N5) segment 7 (MP) 1670.5 0.000000e+00 956/982 (97%)
EPI493820 A/duck/Guangdong/wy11/2008 (A/H5N5) segment 7 (MP) 1670.5 0.000000e+00 956/982 (97%)
EPI442012 A/goose/Guangdong/k0103/2010 (A/H5N5) segment 7 (MP) 1670.5 0.000000e+00 958/984 (97%)
EPI280107 A/Shanghai/1/2006 (A/H5N1) segment 7 (MP) 1670.5 0.000000e+00 956/982 (97%)
EPI280099 A/Guangdong/1/2006 (A/H5N1) segment 7 (MP) 1670.5 0.000000e+00 956/982 (97%)
EPI227312 A/Mallard/Huadong/lk/2005 (A/H5N1) segment 7 (MP) 1670.5 0.000000e+00 956/982 (97%)
EPI164233 A/Sichuan/2/2006 (A/H5N1) segment 7 (MP) 1670.5 0.000000e+00 956/982 (97%)
EPI164225 A/Sichuan/1/2006 (A/H5N1) segment 7 (MP) 1670.5 0.000000e+00 956/982 (97%)
EPI111857 A/chicken/Guiyang/3923/2005 (A/H5N1) segment 7 (MP) 1670.5 0.000000e+00 956/982 (97%)
EPI106032 A/China/GD01/2006 (A/H5N1) segment 7 (MP) 1670.5 0.000000e+00 956/982 (97%)
EPI552771 A/eurasian wigeon/Netherlands/emc-2/2014 (A/H5N8) segment 7 (MP) 1666.8 0.000000e+00 908/911 (99%)
EPI493828 A/duck/Guangdong/wy19/2008 (A/H5N5) segment 7 (MP) 1665.0 0.000000e+00 956/983 (97%)
EPI399889 A/duck/HuBei/03/2010 (A/H5N5) segment 7 (MP) 1665.0 0.000000e+00 955/982 (97%)
EPI276073 A/shrike/Tibet/13/2006 (A/H5N1) segment 7 (MP) 1665.0 0.000000e+00 955/982 (97%)
EPI275985 A/duck/Hubei/49/2005 (A/H5N1) segment 7 (MP) 1665.0 0.000000e+00 955/982 (97%)
EPI275389 A/Anhui/2/2005 (A/H5N1) segment 7 (MP) 1665.0 0.000000e+00 955/982 (97%)
EPI251445 A/Anhui/1/2006 (A/H5N1) segment 7 (MP) 1665.0 0.000000e+00 955/982 (97%)
EPI251423 A/Sichuan/3/2006 (A/H5N1) segment 7 (MP) 1665.0 0.000000e+00 955/982 (97%)
EPI251419 A/Zhejiang/1/2006 (A/H5N1) segment 7 (MP) 1665.0 0.000000e+00 955/982 (97%)
EPI224780 A/Shanghai/1/2006 (A/H5N1) segment 7 (MP) 1665.0 0.000000e+00 955/982 (97%)
EPI167956 A/long-tailed shrike/Hong Kong/2762/2007 (A/H5N1) segment 7 (MP) 1665.0 0.000000e+00 955/982 (97%)
EPI164241 A/Anhui/2/2005 (A/H5N1) segment 7 (MP) 1665.0 0.000000e+00 955/982 (97%)
EPI164217 A/Anhui/1/2005 (A/H5N1) segment 7 (MP) 1665.0 0.000000e+00 955/982 (97%)
EPI127390 A/wild duck/Hunan/021/2005 (A/H5N1) segment 7 (MP) 1665.0 0.000000e+00 955/982 (97%)
EPI111872 A/duck/Guiyang/1558/2006 (A/H5N1) segment 7 (MP) 1665.0 0.000000e+00 955/982 (97%)
EPI111860 A/goose/Guiyang/4030/2005 (A/H5N1) segment 7 (MP) 1665.0 0.000000e+00 955/982 (97%)
EPI111674 A/duck/Hunan/5472/2005 (A/H5N1) segment 7 (MP) 1665.0 0.000000e+00 955/982 (97%)
EPI111656 A/goose/Shantou/3265/2006 (A/H5N1) segment 7 (MP) 1665.0 0.000000e+00 955/982 (97%)
EPI111644 A/goose/Guiyang/538/2006 (A/H5N1) segment 7 (MP) 1665.0 0.000000e+00 955/982 (97%)
EPI111632 A/chicken/Guiyang/4059/2005 (A/H5N1) segment 7 (MP) 1665.0 0.000000e+00 955/982 (97%)

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Fri Feb 20, 2015 1:51 pm 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
Segment-ID Name Score E-Value Identity
EPI553205 A/crane/Kagoshima/KU1/2014 (A/H5N8) segment 1 (PB2) 4161.6 0.000000e+00 2271/2280 (99%)
EPI561702 A/bean goose/Korea/H40/2014 (A/H5N8) segment 1 (PB2) 4156.1 0.000000e+00 2270/2280 (99%)
EPI561672 A/bean goose/Korea/H328/2014 (A/H5N8) segment 1 (PB2) 4156.1 0.000000e+00 2270/2280 (99%)
EPI561631 A/white-fronted goose/Korea/H231/2014 (A/H5N8) segment 1 (PB2) 4156.1 0.000000e+00 2270/2280 (99%)
EPI561624 A/mallard/Korea/H207/2014 (A/H5N8) segment 1 (PB2) 4156.1 0.000000e+00 2270/2280 (99%)
EPI561568 A/Baikal teal/Korea/H96/2014 (A/H5N8) segment 1 (PB2) 4156.1 0.000000e+00 2270/2280 (99%)
EPI561540 A/Baikal teal/Korea/H68/2014 (A/H5N8) segment 1 (PB2) 4156.1 0.000000e+00 2270/2280 (99%)
EPI561527 A/Baikal teal/Korea/H66/2014 (A/H5N8) segment 1 (PB2) 4156.1 0.000000e+00 2270/2280 (99%)
EPI561506 A/bean goose/Korea/H53/2014 (A/H5N8) segment 1 (PB2) 4156.1 0.000000e+00 2270/2280 (99%)
EPI561358 A/broiler duck/Korea/H49/2014 (A/H5N8) segment 1 (PB2) 4156.1 0.000000e+00 2270/2280 (99%)
EPI561610 A/breeder duck/Korea/H158/2014 (A/H5N8) segment 1 (PB2) 4150.5 0.000000e+00 2269/2280 (99%)
EPI561603 A/broiler duck/Korea/H145/2014 (A/H5N8) segment 1 (PB2) 4150.5 0.000000e+00 2269/2280 (99%)
EPI561575 A/breeder chicken/Korea/H122/2014 (A/H5N8) segment 1 (PB2) 4150.5 0.000000e+00 2269/2280 (99%)
EPI561561 A/Baikal teal/Korea/H84/2014 (A/H5N8) segment 1 (PB2) 4150.5 0.000000e+00 2269/2280 (99%)
EPI561513 A/Baikal teal/Korea/H62/2014 (A/H5N8) segment 1 (PB2) 4150.5 0.000000e+00 2269/2280 (99%)
EPI561353 A/broiler duck/Korea/H48/2014 (A/H5N8) segment 1 (PB2) 4150.5 0.000000e+00 2269/2280 (99%)
EPI561339 A/Baikal teal/Korea/H41/2014 (A/H5N8) segment 1 (PB2) 4150.5 0.000000e+00 2269/2280 (99%)
EPI561679 A/tundra swan/Korea/H411/2014 (A/H5N8) segment 1 (PB2) 4145.0 0.000000e+00 2268/2280 (99%)
EPI561665 A/mallard/Korea/H297/2014 (A/H5N8) segment 1 (PB2) 4145.0 0.000000e+00 2268/2280 (99%)
EPI561651 A/breeder chicken/Korea/H250/2014 (A/H5N8) segment 1 (PB2) 4145.0 0.000000e+00 2268/2280 (99%)
EPI561644 A/breeder duck/Korea/H249/2014 (A/H5N8) segment 1 (PB2) 4145.0 0.000000e+00 2268/2280 (99%)
EPI561596 A/broiler duck/Korea/H133/2014 (A/H5N8) segment 1 (PB2) 4145.0 0.000000e+00 2268/2280 (99%)
EPI561589 A/breeder duck/Korea/H128/2014 (A/H5N8) segment 1 (PB2) 4145.0 0.000000e+00 2268/2280 (99%)
EPI561554 A/Coot/Korea/H81/2014 (A/H5N8) segment 1 (PB2) 4145.0 0.000000e+00 2268/2280 (99%)
EPI561547 A/Baikal teal/Korea/H80/2014 (A/H5N8) segment 1 (PB2) 4145.0 0.000000e+00 2268/2280 (99%)
EPI561520 A/broiler duck/Korea/H65/2014 (A/H5N8) segment 1 (PB2) 4145.0 0.000000e+00 2268/2280 (99%)
EPI561346 A/broiler duck/Korea/H47/2014 (A/H5N8) segment 1 (PB2) 4145.0 0.000000e+00 2268/2280 (99%)
EPI561201 A/broiler duck/Korea/H31/2014 (A/H5N8) segment 1 (PB2) 4145.0 0.000000e+00 2268/2280 (99%)
EPI561194 A/broiler duck/Korea/H29/2014 (A/H5N8) segment 1 (PB2) 4145.0 0.000000e+00 2268/2280 (99%)
EPI561185 A/waterfowl/Korea/S005/2014 (A/H5N8) segment 1 (PB2) 4145.0 0.000000e+00 2268/2280 (99%)
EPI542630 A/mallard/Korea/W452/2014 (A/H5N8) segment 1 (PB2) 4145.0 0.000000e+00 2268/2280 (99%)
EPI509707 A/baikal teal/Korea/Donglim3/2014 (A/H5N8) segment 1 (PB2) 4145.0 0.000000e+00 2268/2280 (99%)
EPI509702 A/broiler duck/Korea/Buan2/2014 (A/H5N8) segment 1 (PB2) 4145.0 0.000000e+00 2268/2280 (99%)
EPI561695 A/spot-billed duck/Korea/H455-42/2014 (A/H5N8) segment 1 (PB2) 4139.5 0.000000e+00 2267/2280 (99%)
EPI561658 A/Korean native chicken/Korea/H257/2014 (A/H5N8) segment 1 (PB2) 4139.5 0.000000e+00 2267/2280 (99%)
EPI561617 A/breeder duck/Korea/H200/2014 (A/H5N8) segment 1 (PB2) 4139.5 0.000000e+00 2267/2280 (99%)
EPI517158 A/Chicken/Kumamoto/1-7/2014 (A/H5N8) segment 1 (PB2) 4139.5 0.000000e+00 2267/2280 (99%)
EPI561688 A/common teal/Korea/H455-30/2014 (A/H5N8) segment 1 (PB2) 4133.9 0.000000e+00 2266/2280 (99%)
EPI553340 A/chicken/Miyazaki/7/2014 (A/H5N8) segment 1 (PB2) 4106.2 0.000000e+00 2261/2280 (99%)
EPI547679 A/Chicken/Netherlands/14015526/2014 (A/H5N8) segment 1 (PB2) 4106.2 0.000000e+00 2261/2280 (99%)
EPI552743 A/turkey/Germany/R2474-L00899/2014 (A/H5N8) segment 1 (PB2) 4100.7 0.000000e+00 2260/2280 (99%)
EPI548620 A/chicken/Netherlands/14015531/2014 (A/H5N8) segment 1 (PB2) 4100.7 0.000000e+00 2260/2280 (99%)
EPI547670 A/duck/England/36254/14 (A/H5N8) segment 1 (PB2) 4100.7 0.000000e+00 2260/2280 (99%)
EPI558008 A/duck/England/36038/14 (A/H5N8) segment 1 (PB2) 4095.1 0.000000e+00 2259/2280 (99%)
EPI558001 A/duck/England/36226/14 (A/H5N8) segment 1 (PB2) 4095.1 0.000000e+00 2259/2280 (99%)
EPI548490 A/duck/Chiba/26-372-61/2014 (A/H5N8) segment 1 (PB2) 4095.1 0.000000e+00 2259/2280 (99%)
EPI548482 A/duck/Chiba/26-372-48/2014 (A/H5N8) segment 1 (PB2) 4095.1 0.000000e+00 2259/2280 (99%)
EPI543007 A/duck/Beijing/CT01/2014 (A/H5N8) segment 1 (PB2) 4091.4 0.000000e+00 2255/2277 (99%)
EPI542999 A/duck/Beijing/FS01/2014 (A/H5N8) segment 1 (PB2) 4082.2 0.000000e+00 2252/2277 (98%)
EPI553359 A/environment/Kagoshima/KU-ngr-H/2014 (A/H5N8) segment 1 (PB2) 4078.5 0.000000e+00 2256/2280 (98%)
EPI553186 A/turkey/Italy/14VIR7898-10/2014 (A/H5N8) segment 1 (PB2) 4045.3 0.000000e+00 2235/2258 (98%)
EPI552773 A/chicken/Netherlands/emc-3/2014 (A/H5N8) segment 1 (PB2) 4045.3 0.000000e+00 2234/2256 (99%)
EPI552765 A/eurasian wigeon/Netherlands/emc-2/2014 (A/H5N8) segment 1 (PB2) 4002.8 0.000000e+00 2205/2224 (99%)
EPI475576 A/wild duck/Shandong/628/2011 (A/H5N1) segment 1 (PB2) 4001.0 0.000000e+00 2242/2280 (98%)
EPI552757 A/eurasian wigeon/Netherlands/emc-1/2014 (A/H5N8) segment 1 (PB2) 3993.6 0.000000e+00 2204/2225 (99%)
EPI442014 A/duck/Jiangsu/k1203/2010 (A/H5N8) segment 1 (PB2) 3984.3 0.000000e+00 2229/2265 (98%)
EPI399957 A/duck/Jiangsu/m234/2012 (A/H5N2) segment 1 (PB2) 3967.7 0.000000e+00 2236/2280 (98%)
EPI544889 A/duck/Shandong/Q1/2013 (A/H5N8) segment 1 (PB2) 3954.8 0.000000e+00 2233/2279 (97%)
EPI493814 A/duck/Guangdong/wy11/2008 (A/H5N5) segment 1 (PB2) 3884.6 0.000000e+00 2222/2281 (97%)
EPI493822 A/duck/Guangdong/wy19/2008 (A/H5N5) segment 1 (PB2) 3873.5 0.000000e+00 2219/2280 (97%)
EPI493830 A/duck/Guangdong/wy24/2008 (A/H5N5) segment 1 (PB2) 3801.5 0.000000e+00 2206/2280 (96%)
EPI548431 A/turkey/Germany-MV/R2472/2014 (A/H5N8) segment 1 (PB2) 3796.0 0.000000e+00 2092/2111 (99%)
EPI328897 A/duck/Eastern China/909/2009 (A/H5N1) segment 1 (PB2) 3746.1 0.000000e+00 2196/2280 (96%)
EPI328889 A/duck/Eastern China/108/2008 (A/H5N1) segment 1 (PB2) 3740.6 0.000000e+00 2195/2280 (96%)
EPI328881 A/duck/Eastern China/031/2009 (A/H5N5) segment 1 (PB2) 3740.6 0.000000e+00 2195/2280 (96%)
EPI328873 A/duck/Eastern China/008/2008 (A/H5N5) segment 1 (PB2) 3740.6 0.000000e+00 2195/2280 (96%)
EPI441998 A/goose/Shandong/k1204/2009 (A/H5N5) segment 1 (PB2) 3707.3 0.000000e+00 2190/2281 (96%)
EPI442006 A/goose/Guangdong/k0103/2010 (A/H5N5) segment 1 (PB2) 3701.8 0.000000e+00 2188/2280 (95%)
EPI398954 A/goose/Eastern China/1112/2011 (A/H5N2) segment 1 (PB2) 3663.0 0.000000e+00 2182/2281 (95%)
EPI431453 A/duck/Hebei/3/2011 (A/H5N2) segment 1 (PB2) 3646.4 0.000000e+00 2180/2282 (95%)
EPI431445 A/duck/Hebei/2/2011 (A/H5N2) segment 1 (PB2) 3646.4 0.000000e+00 2179/2281 (95%)
EPI414235 A/duck/Jiangsu/1-15/2011 (A/H4N2) segment 1 (PB2) 3646.4 0.000000e+00 2180/2282 (95%)
EPI398953 A/duck/Eastern China/1111/2011 (A/H5N2) segment 1 (PB2) 3613.2 0.000000e+00 2174/2282 (95%)
EPI326731 A/environment/Korea/CSM3/2002 (A/H3N6) segment 1 (PB2) 3613.2 0.000000e+00 2169/2275 (95%)
EPI387371 A/whooper swan/Mongolia/1-14/2007 (A/H3N8) segment 1 (PB2) 3609.5 0.000000e+00 2172/2280 (95%)
EPI387471 A/canvasback/Mongolia/2-69/2007 (A/H10) segment 1 (PB2) 3598.4 0.000000e+00 2170/2280 (95%)
EPI387468 A/ruddy shelduck/Mongolia/2-29/2007 (A/H3N2) segment 1 (PB2) 3592.9 0.000000e+00 2169/2280 (95%)
EPI387467 A/pintail/Mongolia/2-11/2007 (A/H4N2) segment 1 (PB2) 3585.5 0.000000e+00 2167/2279 (95%)
EPI387473 A/pintail/Mongolia/2-80/2007 (A/H4N6) segment 1 (PB2) 3583.6 0.000000e+00 2164/2275 (95%)
EPI272278 A/duck/Korea/A14/2008 (A/H5N2) segment 1 (PB2) 3574.4 0.000000e+00 2167/2282 (94%)
EPI387375 A/whooper swan/Mongolia/1-25/2007 (A/H3N8) segment 1 (PB2) 3568.8 0.000000e+00 2165/2280 (94%)
EPI231142 A/spot-billed duck/Korea/527/2008 (A/H6N1) segment 1 (PB2) 3557.8 0.000000e+00 2164/2282 (94%)
EPI469140 A/duck/Guangdong/4323/2007 (A/H11N9) segment 1 (PB2) 3555.9 0.000000e+00 2163/2282 (94%)
EPI231150 A/spot-billed duck/Korea/528/2008 (A/H6N8) segment 1 (PB2) 3554.1 0.000000e+00 2160/2277 (94%)
EPI401351 A/wild duck/Korea/SH5-60/2008 (A/H4N6) segment 1 (PB2) 3552.2 0.000000e+00 2164/2283 (94%)
EPI231182 A/spot-billed duck/Korea/540/2008 (A/H6N1) segment 1 (PB2) 3548.5 0.000000e+00 2155/2271 (94%)
EPI508023 A/wild duck/Korea/SH20-27/2008 (A/H7N9) segment 1 (PB2) 3546.7 0.000000e+00 2163/2283 (94%)
EPI387376 A/ruddy shelduck/Mongolia/1-26/2007 (A/H3N8) segment 1 (PB2) 3544.8 0.000000e+00 2141/2251 (95%)
EPI231190 A/spot-billed duck/Korea/545/2008 (A/H6N1) segment 1 (PB2) 3543.0 0.000000e+00 2154/2271 (94%)
EPI231174 A/spot-billed duck/Korea/537/2008 (A/H6N1) segment 1 (PB2) 3543.0 0.000000e+00 2154/2271 (94%)
EPI508024 A/wild duck/Korea/CSM27-12/2009 (A/H7N6) segment 1 (PB2) 3541.1 0.000000e+00 2161/2282 (94%)
EPI503958 A/wild duck/SH17-1/2008 (A/H2N3) segment 1 (PB2) 3541.1 0.000000e+00 2162/2283 (94%)
EPI272279 A/duck/Korea/A93/2008 (A/H5N2) segment 1 (PB2) 3541.1 0.000000e+00 2161/2282 (94%)
EPI231206 A/spot-billed duck/Korea/619/2008 (A/H6N2) segment 1 (PB2) 3541.1 0.000000e+00 2161/2282 (94%)
EPI21386 A/duck/Zhejiang/11/2000 (A/H5N1) segment 1 (PB2) 3541.1 0.000000e+00 2160/2281 (94%)
EPI387374 A/whooper swan/Mongolia/1-23/2007 (A/H3N8) segment 1 (PB2) 3537.5 0.000000e+00 2160/2281 (94%)
EPI227118 A/duck/Beijing/61/05 (A/H3N8) segment 1 (PB2) 3535.6 0.000000e+00 2160/2282 (94%)
EPI469202 A/duck/Jiangxi/3286/2009 (A/H7N9) segment 1 (PB2) 3530.1 0.000000e+00 2159/2282 (94%)
EPI469201 A/duck/Jiangxi/3230/2009 (A/H7N9) segment 1 (PB2) 3530.1 0.000000e+00 2159/2282 (94%)
EPI469200 A/duck/Jiangxi/3214/2009 (A/H7N9) segment 1 (PB2) 3530.1 0.000000e+00 2159/2282 (94%)

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Fri Feb 20, 2015 1:54 pm 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
EPI561666 A/mallard/Korea/H297/2014 (A/H5N8) segment 2 (PB1) 4117.3 0.000000e+00 2259/2274 (99%)
EPI561659 A/Korean native chicken/Korea/H257/2014 (A/H5N8) segment 2 (PB1) 4117.3 0.000000e+00 2259/2274 (99%)
EPI561645 A/breeder duck/Korea/H249/2014 (A/H5N8) segment 2 (PB1) 4117.3 0.000000e+00 2259/2274 (99%)
EPI561611 A/breeder duck/Korea/H158/2014 (A/H5N8) segment 2 (PB1) 4117.3 0.000000e+00 2259/2274 (99%)
EPI561604 A/broiler duck/Korea/H145/2014 (A/H5N8) segment 2 (PB1) 4117.3 0.000000e+00 2259/2274 (99%)
EPI561597 A/broiler duck/Korea/H133/2014 (A/H5N8) segment 2 (PB1) 4117.3 0.000000e+00 2259/2274 (99%)
EPI561590 A/breeder duck/Korea/H128/2014 (A/H5N8) segment 2 (PB1) 4117.3 0.000000e+00 2259/2274 (99%)
EPI561562 A/Baikal teal/Korea/H84/2014 (A/H5N8) segment 2 (PB1) 4117.3 0.000000e+00 2259/2274 (99%)
EPI561528 A/Baikal teal/Korea/H66/2014 (A/H5N8) segment 2 (PB1) 4117.3 0.000000e+00 2259/2274 (99%)
EPI561347 A/broiler duck/Korea/H47/2014 (A/H5N8) segment 2 (PB1) 4117.3 0.000000e+00 2259/2274 (99%)
EPI561340 A/Baikal teal/Korea/H41/2014 (A/H5N8) segment 2 (PB1) 4117.3 0.000000e+00 2259/2274 (99%)
EPI561202 A/broiler duck/Korea/H31/2014 (A/H5N8) segment 2 (PB1) 4117.3 0.000000e+00 2259/2274 (99%)
EPI561195 A/broiler duck/Korea/H29/2014 (A/H5N8) segment 2 (PB1) 4117.3 0.000000e+00 2259/2274 (99%)
EPI553206 A/crane/Kagoshima/KU1/2014 (A/H5N8) segment 2 (PB1) 4117.3 0.000000e+00 2259/2274 (99%)
EPI542631 A/mallard/Korea/W452/2014 (A/H5N8) segment 2 (PB1) 4117.3 0.000000e+00 2259/2274 (99%)
EPI561703 A/bean goose/Korea/H40/2014 (A/H5N8) segment 2 (PB1) 4111.8 0.000000e+00 2258/2274 (99%)
EPI561689 A/common teal/Korea/H455-30/2014 (A/H5N8) segment 2 (PB1) 4111.8 0.000000e+00 2258/2274 (99%)
EPI561625 A/mallard/Korea/H207/2014 (A/H5N8) segment 2 (PB1) 4111.8 0.000000e+00 2258/2274 (99%)
EPI561618 A/breeder duck/Korea/H200/2014 (A/H5N8) segment 2 (PB1) 4111.8 0.000000e+00 2258/2274 (99%)
EPI561569 A/Baikal teal/Korea/H96/2014 (A/H5N8) segment 2 (PB1) 4111.8 0.000000e+00 2258/2274 (99%)
EPI561555 A/Coot/Korea/H81/2014 (A/H5N8) segment 2 (PB1) 4111.8 0.000000e+00 2258/2274 (99%)
EPI561541 A/Baikal teal/Korea/H68/2014 (A/H5N8) segment 2 (PB1) 4111.8 0.000000e+00 2258/2274 (99%)
EPI561514 A/Baikal teal/Korea/H62/2014 (A/H5N8) segment 2 (PB1) 4111.8 0.000000e+00 2258/2274 (99%)
EPI509708 A/baikal teal/Korea/Donglim3/2014 (A/H5N8) segment 2 (PB1) 4111.8 0.000000e+00 2258/2274 (99%)
EPI561186 A/waterfowl/Korea/S005/2014 (A/H5N8) segment 2 (PB1) 4109.9 0.000000e+00 2257/2274 (99%)
EPI561696 A/spot-billed duck/Korea/H455-42/2014 (A/H5N8) segment 2 (PB1) 4106.2 0.000000e+00 2257/2274 (99%)
EPI561680 A/tundra swan/Korea/H411/2014 (A/H5N8) segment 2 (PB1) 4106.2 0.000000e+00 2257/2274 (99%)
EPI561548 A/Baikal teal/Korea/H80/2014 (A/H5N8) segment 2 (PB1) 4106.2 0.000000e+00 2257/2274 (99%)
EPI561521 A/broiler duck/Korea/H65/2014 (A/H5N8) segment 2 (PB1) 4106.2 0.000000e+00 2257/2274 (99%)
EPI561359 A/broiler duck/Korea/H49/2014 (A/H5N8) segment 2 (PB1) 4106.2 0.000000e+00 2257/2274 (99%)
EPI561652 A/breeder chicken/Korea/H250/2014 (A/H5N8) segment 2 (PB1) 4100.7 0.000000e+00 2256/2274 (99%)
EPI561632 A/white-fronted goose/Korea/H231/2014 (A/H5N8) segment 2 (PB1) 4100.7 0.000000e+00 2256/2274 (99%)
EPI561576 A/breeder chicken/Korea/H122/2014 (A/H5N8) segment 2 (PB1) 4100.7 0.000000e+00 2256/2274 (99%)
EPI561337 A/broiler duck/Korea/H48/2014 (A/H5N8) segment 2 (PB1) 4100.7 0.000000e+00 2256/2274 (99%)
EPI509703 A/broiler duck/Korea/Buan2/2014 (A/H5N8) segment 2 (PB1) 4100.7 0.000000e+00 2256/2274 (99%)
EPI561673 A/bean goose/Korea/H328/2014 (A/H5N8) segment 2 (PB1) 4095.1 0.000000e+00 2255/2274 (99%)
EPI561507 A/bean goose/Korea/H53/2014 (A/H5N8) segment 2 (PB1) 4095.1 0.000000e+00 2255/2274 (99%)
EPI517159 A/Chicken/Kumamoto/1-7/2014 (A/H5N8) segment 2 (PB1) 4095.1 0.000000e+00 2255/2274 (99%)
EPI543000 A/duck/Beijing/FS01/2014 (A/H5N8) segment 2 (PB1) 4091.4 0.000000e+00 2255/2275 (99%)
EPI552744 A/turkey/Germany/R2474-L00899/2014 (A/H5N8) segment 2 (PB1) 4089.6 0.000000e+00 2254/2274 (99%)
EPI548430 A/turkey/Germany-MV/R2472/2014 (A/H5N8) segment 2 (PB1) 4089.6 0.000000e+00 2254/2274 (99%)
EPI558009 A/duck/England/36038/14 (A/H5N8) segment 2 (PB1) 4084.1 0.000000e+00 2253/2274 (99%)
EPI558002 A/duck/England/36226/14 (A/H5N8) segment 2 (PB1) 4084.1 0.000000e+00 2253/2274 (99%)
EPI547671 A/duck/England/36254/14 (A/H5N8) segment 2 (PB1) 4084.1 0.000000e+00 2253/2274 (99%)
EPI548621 A/chicken/Netherlands/14015531/2014 (A/H5N8) segment 2 (PB1) 4078.5 0.000000e+00 2252/2274 (99%)
EPI547680 A/Chicken/Netherlands/14015526/2014 (A/H5N8) segment 2 (PB1) 4078.5 0.000000e+00 2252/2274 (99%)
EPI554600 A/turkey/Germany-NI/R3372/2014 (A/H5N8) segment 2 (PB1) 4073.0 0.000000e+00 2251/2274 (98%)
EPI553360 A/environment/Kagoshima/KU-ngr-H/2014 (A/H5N8) segment 2 (PB1) 4073.0 0.000000e+00 2251/2274 (98%)
EPI548491 A/duck/Chiba/26-372-61/2014 (A/H5N8) segment 2 (PB1) 4067.4 0.000000e+00 2250/2274 (98%)
EPI548483 A/duck/Chiba/26-372-48/2014 (A/H5N8) segment 2 (PB1) 4067.4 0.000000e+00 2250/2274 (98%)
EPI553185 A/turkey/Italy/14VIR7898-10/2014 (A/H5N8) segment 2 (PB1) 4065.6 0.000000e+00 2248/2274 (98%)
EPI553341 A/chicken/Miyazaki/7/2014 (A/H5N8) segment 2 (PB1) 4061.9 0.000000e+00 2249/2274 (98%)
EPI543008 A/duck/Beijing/CT01/2014 (A/H5N8) segment 2 (PB1) 4058.2 0.000000e+00 2249/2275 (98%)
EPI542598 A/duck/Beijing/FS01/2013 (A/H5N8) segment 2 (PB1) 4032.4 0.000000e+00 2222/2241 (99%)
EPI552774 A/chicken/Netherlands/emc-3/2014 (A/H5N8) segment 2 (PB1) 4013.9 0.000000e+00 2219/2242 (98%)
EPI431446 A/duck/Hebei/2/2011 (A/H5N2) segment 2 (PB1) 3962.2 0.000000e+00 2229/2271 (98%)
EPI552766 A/eurasian wigeon/Netherlands/emc-2/2014 (A/H5N8) segment 2 (PB1) 3953.0 0.000000e+00 2180/2200 (99%)
EPI414236 A/duck/Jiangsu/1-15/2011 (A/H4N2) segment 2 (PB1) 3951.1 0.000000e+00 2231/2276 (98%)
EPI398957 A/duck/Eastern China/1111/2011 (A/H5N2) segment 2 (PB1) 3934.5 0.000000e+00 2228/2276 (97%)
EPI552758 A/eurasian wigeon/Netherlands/emc-1/2014 (A/H5N8) segment 2 (PB1) 3910.5 0.000000e+00 2161/2183 (98%)
EPI398958 A/goose/Eastern China/1112/2011 (A/H5N2) segment 2 (PB1) 3884.6 0.000000e+00 2219/2276 (97%)
EPI328880 A/duck/Eastern China/031/2009 (A/H5N5) segment 2 (PB1) 3862.5 0.000000e+00 2214/2275 (97%)
EPI328872 A/duck/Eastern China/008/2008 (A/H5N5) segment 2 (PB1) 3862.5 0.000000e+00 2214/2275 (97%)
EPI328896 A/duck/Eastern China/909/2009 (A/H5N1) segment 2 (PB1) 3845.8 0.000000e+00 2211/2275 (97%)
EPI442007 A/goose/Guangdong/k0103/2010 (A/H5N5) segment 2 (PB1) 3812.6 0.000000e+00 2204/2273 (96%)
EPI441999 A/goose/Shandong/k1204/2009 (A/H5N5) segment 2 (PB1) 3799.7 0.000000e+00 2200/2271 (96%)
EPI493815 A/duck/Guangdong/wy11/2008 (A/H5N5) segment 2 (PB1) 3762.7 0.000000e+00 2196/2275 (96%)
EPI493823 A/duck/Guangdong/wy19/2008 (A/H5N5) segment 2 (PB1) 3751.7 0.000000e+00 2194/2275 (96%)
EPI493831 A/duck/Guangdong/wy24/2008 (A/H5N5) segment 2 (PB1) 3746.1 0.000000e+00 2193/2275 (96%)
EPI243255 A/R(duck/Mongolia/54/01-duck/Mongolia/47/01) (A/H5N1) segment 2 (PB1) 3657.5 0.000000e+00 2177/2275 (95%)
EPI3417 A/duck/Mongolia/54/01 (A/H5N2) segment 2 (PB1) 3651.9 0.000000e+00 2176/2275 (95%)
EPI1646 A/duck/Hokkaido/Vac-1/04 (A/H5N1) segment 2 (PB1) 3651.9 0.000000e+00 2176/2275 (95%)
EPI174878 A/mallard/Denmark/77-64849-G2/2005 (A/H1N3) segment 2 (PB1) 3602.1 0.000000e+00 2168/2276 (95%)
EPI461809 A/environment/Hunan/S4350/2011 (A/H3N8) segment 2 (PB1) 3585.5 0.000000e+00 2163/2273 (95%)
EPI414136 A/duck/Jiangsu/26/2004 (A/H3N2) segment 2 (PB1) 3585.5 0.000000e+00 2165/2276 (95%)
EPI372518 A/garganey/Ukraine/05839-NAMRU3/2006 (A/H14N6) segment 2 (PB1) 3585.5 0.000000e+00 2163/2273 (95%)
EPI181959 A/mallard/Netherlands/3/2005 (A/H3N8) segment 2 (PB1) 3585.5 0.000000e+00 2165/2276 (95%)
EPI140270 A/migratory duck/Jiang Xi/6568/2004 (A/H4N6) segment 2 (PB1) 3585.5 0.000000e+00 2165/2276 (95%)
EPI296269 A/wild duck/Korea/YS44/2004 (A/H1N2) segment 2 (PB1) 3579.9 0.000000e+00 2161/2272 (95%)
EPI514603 A/mallard/Sweden/50108/2006 (A/H4N6) segment 2 (PB1) 3568.8 0.000000e+00 2161/2275 (94%)
EPI190362 A/gadwall/Netherlands/1/2006 (A/H9N2) segment 2 (PB1) 3552.2 0.000000e+00 2159/2276 (94%)
EPI140268 A/migratory duck/Hong Kong/MP2553/2003 (A/H8N4) segment 2 (PB1) 3550.4 0.000000e+00 2157/2274 (94%)
EPI296534 A/mallard/Netherlands/4/2006 (A/H10N6) segment 2 (PB1) 3548.5 0.000000e+00 2158/2275 (94%)
EPI447400 A/mallard/Italy/3401/2005 (A/H5N1) segment 2 (PB1) 3524.5 0.000000e+00 2155/2277 (94%)
EPI447390 A/mallard/Italy/3401/2005 (A/H5N1) segment 2 (PB1) 3524.5 0.000000e+00 2155/2277 (94%)
EPI447376 A/mallard/Italy/3401/2005 (A/H5N1) segment 2 (PB1) 3524.5 0.000000e+00 2155/2277 (94%)
EPI447365 A/mallard/Italy/3401/2005 (A/H5N1) segment 2 (PB1) 3524.5 0.000000e+00 2155/2277 (94%)
EPI442015 A/duck/Jiangsu/k1203/2010 (A/H5N8) segment 2 (PB1) 3524.5 0.000000e+00 2154/2275 (94%)
EPI140266 A/migratory duck/Hong Kong/MPS180/2003 (A/H4N6) segment 2 (PB1) 3524.5 0.000000e+00 2154/2276 (94%)
EPI60381 A/mallard/Italy/3401/2005 (A/H5N1) segment 2 (PB1) 3524.5 0.000000e+00 2155/2277 (94%)
EPI475577 A/wild duck/Shandong/628/2011 (A/H5N1) segment 2 (PB1) 3519.0 0.000000e+00 2153/2275 (94%)
EPI251806 A/mallard/Sweden/81/2002 (A/H6N1) segment 2 (PB1) 3519.0 0.000000e+00 2154/2277 (94%)
EPI169687 A/duck/Mongolia/47/01 (A/H7N1) segment 2 (PB1) 3519.0 0.000000e+00 2154/2277 (94%)
EPI222077 A/gadwall/Altai/1328/2007 (A/H3N8) segment 2 (PB1) 3502.4 0.000000e+00 2151/2277 (94%)
EPI222069 A/gadwall/Altai/1326/2007 (A/H3N8) segment 2 (PB1) 3502.4 0.000000e+00 2151/2277 (94%)
EPI251623 A/mallard/Netherlands/1/1999 (A/H4N6) segment 2 (PB1) 3496.8 0.000000e+00 2150/2277 (94%)
EPI222053 A/gadwall/Altai/1324/2007 (A/H3N8) segment 2 (PB1) 3496.8 0.000000e+00 2150/2277 (94%)
EPI514938 A/mallard/Sweden/622/2002 (A/H4N6) segment 2 (PB1) 3491.3 0.000000e+00 2149/2277 (94%)
EPI485717 A/mallard/Sweden/111/2002 (A/H2N6) segment 2 (PB1) 3491.3 0.000000e+00 2149/2277 (94%)
EPI377755 A/mallard/Sweden/112/2002 (A/H2N7) segment 2 (PB1) 3491.3 0.000000e+00 2149/2277 (94%)

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Fri Feb 20, 2015 1:56 pm 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
EPI553207 A/crane/Kagoshima/KU1/2014 (A/H5N8) segment 3 (PA) 3906.8 0.000000e+00 2139/2151 (99%)
EPI561712 A/bean goose/Korea/H40/2014 (A/H5N8) segment 3 (PA) 3895.7 0.000000e+00 2137/2151 (99%)
EPI561643 A/tundra swan/Korea/H411/2014 (A/H5N8) segment 3 (PA) 3895.7 0.000000e+00 2137/2151 (99%)
EPI561583 A/broiler duck/Korea/H133/2014 (A/H5N8) segment 3 (PA) 3895.7 0.000000e+00 2137/2151 (99%)
EPI561537 A/Baikal teal/Korea/H84/2014 (A/H5N8) segment 3 (PA) 3895.7 0.000000e+00 2137/2151 (99%)
EPI561534 A/Baikal teal/Korea/H68/2014 (A/H5N8) segment 3 (PA) 3895.7 0.000000e+00 2137/2151 (99%)
EPI561502 A/Baikal teal/Korea/H66/2014 (A/H5N8) segment 3 (PA) 3895.7 0.000000e+00 2137/2151 (99%)
EPI561500 A/Baikal teal/Korea/H62/2014 (A/H5N8) segment 3 (PA) 3895.7 0.000000e+00 2137/2151 (99%)
EPI561338 A/broiler duck/Korea/H49/2014 (A/H5N8) segment 3 (PA) 3895.7 0.000000e+00 2137/2151 (99%)
EPI561334 A/broiler duck/Korea/H47/2014 (A/H5N8) segment 3 (PA) 3895.7 0.000000e+00 2137/2151 (99%)
EPI509694 A/baikal teal/Korea/Donglim3/2014 (A/H5N8) segment 3 (PA) 3895.7 0.000000e+00 2137/2151 (99%)
EPI561687 A/spot-billed duck/Korea/H455-42/2014 (A/H5N8) segment 3 (PA) 3890.2 0.000000e+00 2136/2151 (99%)
EPI561686 A/common teal/Korea/H455-30/2014 (A/H5N8) segment 3 (PA) 3890.2 0.000000e+00 2136/2151 (99%)
EPI561642 A/bean goose/Korea/H328/2014 (A/H5N8) segment 3 (PA) 3890.2 0.000000e+00 2136/2151 (99%)
EPI561640 A/Korean native chicken/Korea/H257/2014 (A/H5N8) segment 3 (PA) 3890.2 0.000000e+00 2136/2151 (99%)
EPI561588 A/white-fronted goose/Korea/H231/2014 (A/H5N8) segment 3 (PA) 3890.2 0.000000e+00 2136/2151 (99%)
EPI561587 A/mallard/Korea/H207/2014 (A/H5N8) segment 3 (PA) 3890.2 0.000000e+00 2136/2151 (99%)
EPI561586 A/breeder duck/Korea/H200/2014 (A/H5N8) segment 3 (PA) 3890.2 0.000000e+00 2136/2151 (99%)
EPI561584 A/broiler duck/Korea/H145/2014 (A/H5N8) segment 3 (PA) 3890.2 0.000000e+00 2136/2151 (99%)
EPI561582 A/breeder duck/Korea/H128/2014 (A/H5N8) segment 3 (PA) 3890.2 0.000000e+00 2136/2151 (99%)
EPI561501 A/broiler duck/Korea/H65/2014 (A/H5N8) segment 3 (PA) 3890.2 0.000000e+00 2136/2151 (99%)
EPI561335 A/broiler duck/Korea/H48/2014 (A/H5N8) segment 3 (PA) 3890.2 0.000000e+00 2136/2151 (99%)
EPI561333 A/Baikal teal/Korea/H41/2014 (A/H5N8) segment 3 (PA) 3890.2 0.000000e+00 2136/2151 (99%)
EPI561193 A/broiler duck/Korea/H31/2014 (A/H5N8) segment 3 (PA) 3890.2 0.000000e+00 2136/2151 (99%)
EPI561192 A/broiler duck/Korea/H29/2014 (A/H5N8) segment 3 (PA) 3890.2 0.000000e+00 2136/2151 (99%)
EPI561641 A/mallard/Korea/H297/2014 (A/H5N8) segment 3 (PA) 3884.6 0.000000e+00 2135/2151 (99%)
EPI561639 A/breeder chicken/Korea/H250/2014 (A/H5N8) segment 3 (PA) 3884.6 0.000000e+00 2135/2151 (99%)
EPI561585 A/breeder duck/Korea/H158/2014 (A/H5N8) segment 3 (PA) 3884.6 0.000000e+00 2135/2151 (99%)
EPI561539 A/breeder chicken/Korea/H122/2014 (A/H5N8) segment 3 (PA) 3884.6 0.000000e+00 2135/2151 (99%)
EPI561538 A/Baikal teal/Korea/H96/2014 (A/H5N8) segment 3 (PA) 3884.6 0.000000e+00 2135/2151 (99%)
EPI561536 A/Coot/Korea/H81/2014 (A/H5N8) segment 3 (PA) 3884.6 0.000000e+00 2135/2151 (99%)
EPI561535 A/Baikal teal/Korea/H80/2014 (A/H5N8) segment 3 (PA) 3884.6 0.000000e+00 2135/2151 (99%)
EPI561499 A/bean goose/Korea/H53/2014 (A/H5N8) segment 3 (PA) 3884.6 0.000000e+00 2135/2151 (99%)
EPI561184 A/waterfowl/Korea/S005/2014 (A/H5N8) segment 3 (PA) 3884.6 0.000000e+00 2135/2151 (99%)
EPI509693 A/broiler duck/Korea/Buan2/2014 (A/H5N8) segment 3 (PA) 3884.6 0.000000e+00 2135/2151 (99%)
EPI561638 A/breeder duck/Korea/H249/2014 (A/H5N8) segment 3 (PA) 3879.1 0.000000e+00 2134/2151 (99%)
EPI542618 A/mallard/Korea/W452/2014 (A/H5N8) segment 3 (PA) 3879.1 0.000000e+00 2134/2151 (99%)
EPI542602 A/duck/Beijing/FS01/2013 (A/H5N8) segment 3 (PA) 3868.0 0.000000e+00 2131/2149 (99%)
EPI558010 A/duck/England/36038/14 (A/H5N8) segment 3 (PA) 3856.9 0.000000e+00 2130/2151 (99%)
EPI553342 A/chicken/Miyazaki/7/2014 (A/H5N8) segment 3 (PA) 3856.9 0.000000e+00 2130/2151 (99%)
EPI547672 A/duck/England/36254/14 (A/H5N8) segment 3 (PA) 3856.9 0.000000e+00 2130/2151 (99%)
EPI558003 A/duck/England/36226/14 (A/H5N8) segment 3 (PA) 3851.4 0.000000e+00 2129/2151 (98%)
EPI553184 A/turkey/Italy/14VIR7898-10/2014 (A/H5N8) segment 3 (PA) 3851.4 0.000000e+00 2129/2151 (98%)
EPI548492 A/duck/Chiba/26-372-61/2014 (A/H5N8) segment 3 (PA) 3851.4 0.000000e+00 2129/2151 (98%)
EPI548484 A/duck/Chiba/26-372-48/2014 (A/H5N8) segment 3 (PA) 3851.4 0.000000e+00 2129/2151 (98%)
EPI547681 A/Chicken/Netherlands/14015526/2014 (A/H5N8) segment 3 (PA) 3851.4 0.000000e+00 2129/2151 (98%)
EPI517160 A/Chicken/Kumamoto/1-7/2014 (A/H5N8) segment 3 (PA) 3851.4 0.000000e+00 2129/2151 (98%)
EPI543001 A/duck/Beijing/FS01/2014 (A/H5N8) segment 3 (PA) 3844.0 0.000000e+00 2125/2148 (98%)
EPI552745 A/turkey/Germany/R2474-L00899/2014 (A/H5N8) segment 3 (PA) 3840.3 0.000000e+00 2127/2151 (98%)
EPI548622 A/chicken/Netherlands/14015531/2014 (A/H5N8) segment 3 (PA) 3840.3 0.000000e+00 2127/2151 (98%)
EPI548429 A/turkey/Germany-MV/R2472/2014 (A/H5N8) segment 3 (PA) 3836.6 0.000000e+00 2126/2151 (98%)
EPI554601 A/turkey/Germany-NI/R3372/2014 (A/H5N8) segment 3 (PA) 3834.8 0.000000e+00 2126/2151 (98%)
EPI543009 A/duck/Beijing/CT01/2014 (A/H5N8) segment 3 (PA) 3834.8 0.000000e+00 2123/2148 (98%)
EPI555125 A/domestic duck/Germany-NI/R3468/2014 (A/H5N8) segment 3 (PA) 3829.2 0.000000e+00 2125/2151 (98%)
EPI553361 A/environment/Kagoshima/KU-ngr-H/2014 (A/H5N8) segment 3 (PA) 3829.2 0.000000e+00 2125/2151 (98%)
EPI552759 A/eurasian wigeon/Netherlands/emc-1/2014 (A/H5N8) segment 3 (PA) 3784.9 0.000000e+00 2098/2122 (98%)
EPI431447 A/duck/Hebei/2/2011 (A/H5N2) segment 3 (PA) 3762.7 0.000000e+00 2113/2151 (98%)
EPI552775 A/chicken/Netherlands/emc-3/2014 (A/H5N8) segment 3 (PA) 3757.2 0.000000e+00 2090/2118 (98%)
EPI552767 A/eurasian wigeon/Netherlands/emc-2/2014 (A/H5N8) segment 3 (PA) 3749.8 0.000000e+00 2084/2111 (98%)
EPI414237 A/duck/Jiangsu/1-15/2011 (A/H4N2) segment 3 (PA) 3712.9 0.000000e+00 2104/2151 (97%)
EPI398961 A/duck/Eastern China/1111/2011 (A/H5N2) segment 3 (PA) 3696.3 0.000000e+00 2102/2152 (97%)
EPI398962 A/goose/Eastern China/1112/2011 (A/H5N2) segment 3 (PA) 3635.3 0.000000e+00 2090/2151 (97%)
EPI328887 A/duck/Eastern China/108/2008 (A/H5N1) segment 3 (PA) 3624.2 0.000000e+00 2088/2151 (97%)
EPI328879 A/duck/Eastern China/031/2009 (A/H5N5) segment 3 (PA) 3602.1 0.000000e+00 2084/2151 (96%)
EPI493832 A/duck/Guangdong/wy24/2008 (A/H5N5) segment 3 (PA) 3585.5 0.000000e+00 2081/2151 (96%)
EPI442024 A/quail/Jiangsu/k0104/2010 (A/H5N5) segment 3 (PA) 3579.9 0.000000e+00 2080/2151 (96%)
EPI431455 A/duck/Hebei/3/2011 (A/H5N2) segment 3 (PA) 3579.9 0.000000e+00 2080/2151 (96%)
EPI493816 A/duck/Guangdong/wy11/2008 (A/H5N5) segment 3 (PA) 3557.8 0.000000e+00 2076/2151 (96%)
EPI493824 A/duck/Guangdong/wy19/2008 (A/H5N5) segment 3 (PA) 3552.2 0.000000e+00 2075/2151 (96%)
EPI442008 A/goose/Guangdong/k0103/2010 (A/H5N5) segment 3 (PA) 3535.6 0.000000e+00 2072/2151 (96%)
EPI399959 A/duck/Jiangsu/m234/2012 (A/H5N2) segment 3 (PA) 3513.4 0.000000e+00 2069/2152 (96%)
EPI544891 A/duck/Shandong/Q1/2013 (A/H5N8) segment 3 (PA) 3502.4 0.000000e+00 2066/2151 (96%)
EPI442000 A/goose/Shandong/k1204/2009 (A/H5N5) segment 3 (PA) 3502.4 0.000000e+00 2067/2152 (96%)
EPI442016 A/duck/Jiangsu/k1203/2010 (A/H5N8) segment 3 (PA) 3496.8 0.000000e+00 2045/2121 (96%)
EPI475578 A/wild duck/Shandong/628/2011 (A/H5N1) segment 3 (PA) 3485.7 0.000000e+00 2065/2153 (95%)
EPI127382 A/wild duck/Hunan/021/2005 (A/H5N1) segment 3 (PA) 3469.1 0.000000e+00 2060/2151 (95%)
EPI530983 A/duck/Zhejiang/W24/2013 (A/H5N8) segment 3 (PA) 3452.5 0.000000e+00 2059/2153 (95%)
EPI113022 A/crested myna/Hong Kong/540/2006 (A/H5N1) segment 3 (PA) 3452.5 0.000000e+00 2057/2151 (95%)
EPI337063 A/Anhui/2/2005 (A/H5N1) segment 3 (PA) 3441.4 0.000000e+00 2056/2152 (95%)
EPI337058 A/Anhui/1/2005 (A/H5N1) segment 3 (PA) 3441.4 0.000000e+00 2056/2152 (95%)
EPI275385 A/Anhui/2/2005 (A/H5N1) segment 3 (PA) 3441.4 0.000000e+00 2056/2152 (95%)
EPI227308 A/Mallard/Huadong/lk/2005 (A/H5N1) segment 3 (PA) 3441.4 0.000000e+00 2055/2151 (95%)
EPI164247 A/Anhui/2/2005 (A/H5N1) segment 3 (PA) 3441.4 0.000000e+00 2056/2152 (95%)
EPI164220 A/Anhui/1/2005 (A/H5N1) segment 3 (PA) 3441.4 0.000000e+00 2056/2152 (95%)
EPI113100 A/duck/Guiyang/497/2006 (A/H5N1) segment 3 (PA) 3441.4 0.000000e+00 2056/2152 (95%)
EPI507672 A/mallard duck/Shanghai/SH-9/2013 (A/H5N8) segment 3 (PA) 3435.9 0.000000e+00 2055/2152 (95%)
EPI399885 A/duck/HuBei/03/2010 (A/H5N5) segment 3 (PA) 3435.9 0.000000e+00 2055/2152 (95%)
EPI337094 A/Zhejiang/1/2006 (A/H5N1) segment 3 (PA) 3435.9 0.000000e+00 2055/2152 (95%)
EPI279945 A/Zhejiang/1/2006 (A/H5N1) segment 3 (PA) 3435.9 0.000000e+00 2055/2152 (95%)
EPI275981 A/duck/Hubei/49/2005 (A/H5N1) segment 3 (PA) 3435.9 0.000000e+00 2055/2152 (95%)
EPI113102 A/goose/Guiyang/538/2006 (A/H5N1) segment 3 (PA) 3435.9 0.000000e+00 2055/2152 (95%)
EPI275957 A/duck/Anhui/1/06 (A/H5N1) segment 3 (PA) 3432.2 0.000000e+00 2054/2152 (95%)
EPI337075 A/Sichuan/2/2006 (A/H5N1) segment 3 (PA) 3430.3 0.000000e+00 2054/2152 (95%)
EPI276045 A/goose/Hubei/65/2005 (A/H5N1) segment 3 (PA) 3430.3 0.000000e+00 2054/2152 (95%)
EPI225093 A/duck/Nam Dinh/218/2006 (A/H5) segment 3 (PA) 3430.3 0.000000e+00 2053/2151 (95%)
EPI175649 A/duck/Hubei/Hangmei01/2006 (A/H5N1) segment 3 (PA) 3430.3 0.000000e+00 2054/2152 (95%)
EPI170655 A/duck/Vietnam/210/2005 (A/H5N1) segment 3 (PA) 3430.3 0.000000e+00 2053/2151 (95%)
EPI170648 A/Muscovy duck/Vietnam/211/2005 (A/H5N1) segment 3 (PA) 3430.3 0.000000e+00 2053/2151 (95%)
EPI170634 A/Muscovy duck/Vietnam/213/2005 (A/H5N1) segment 3 (PA) 3430.3 0.000000e+00 2053/2151 (95%)
EPI170620 A/chicken/Vietnam/216/2005 (A/H5N1) segment 3 (PA) 3430.3 0.000000e+00 2053/2151 (95%)

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Fri Feb 20, 2015 7:34 pm 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
EPI561706 A/bean goose/Korea/H40/2014 (A/H5N8) segment 5 (NP) 2726.8 0.000000e+00 1490/1497 (99%)
EPI561675 A/bean goose/Korea/H328/2014 (A/H5N8) segment 5 (NP) 2726.8 0.000000e+00 1490/1497 (99%)
EPI561654 A/breeder chicken/Korea/H250/2014 (A/H5N8) segment 5 (NP) 2726.8 0.000000e+00 1490/1497 (99%)
EPI561647 A/breeder duck/Korea/H249/2014 (A/H5N8) segment 5 (NP) 2726.8 0.000000e+00 1490/1497 (99%)
EPI561606 A/broiler duck/Korea/H145/2014 (A/H5N8) segment 5 (NP) 2726.8 0.000000e+00 1490/1497 (99%)
EPI561578 A/breeder chicken/Korea/H122/2014 (A/H5N8) segment 5 (NP) 2726.8 0.000000e+00 1490/1497 (99%)
EPI561571 A/Baikal teal/Korea/H96/2014 (A/H5N8) segment 5 (NP) 2726.8 0.000000e+00 1490/1497 (99%)
EPI561564 A/Baikal teal/Korea/H84/2014 (A/H5N8) segment 5 (NP) 2726.8 0.000000e+00 1490/1497 (99%)
EPI561543 A/Baikal teal/Korea/H68/2014 (A/H5N8) segment 5 (NP) 2726.8 0.000000e+00 1490/1497 (99%)
EPI561530 A/Baikal teal/Korea/H66/2014 (A/H5N8) segment 5 (NP) 2726.8 0.000000e+00 1490/1497 (99%)
EPI561523 A/broiler duck/Korea/H65/2014 (A/H5N8) segment 5 (NP) 2726.8 0.000000e+00 1490/1497 (99%)
EPI561509 A/bean goose/Korea/H53/2014 (A/H5N8) segment 5 (NP) 2726.8 0.000000e+00 1490/1497 (99%)
EPI561361 A/broiler duck/Korea/H49/2014 (A/H5N8) segment 5 (NP) 2726.8 0.000000e+00 1490/1497 (99%)
EPI561354 A/broiler duck/Korea/H48/2014 (A/H5N8) segment 5 (NP) 2726.8 0.000000e+00 1490/1497 (99%)
EPI561342 A/Baikal teal/Korea/H41/2014 (A/H5N8) segment 5 (NP) 2726.8 0.000000e+00 1490/1497 (99%)
EPI553209 A/crane/Kagoshima/KU1/2014 (A/H5N8) segment 5 (NP) 2726.8 0.000000e+00 1490/1497 (99%)
EPI561668 A/mallard/Korea/H297/2014 (A/H5N8) segment 5 (NP) 2721.2 0.000000e+00 1489/1497 (99%)
EPI561634 A/white-fronted goose/Korea/H231/2014 (A/H5N8) segment 5 (NP) 2721.2 0.000000e+00 1489/1497 (99%)
EPI561613 A/breeder duck/Korea/H158/2014 (A/H5N8) segment 5 (NP) 2721.2 0.000000e+00 1489/1497 (99%)
EPI561592 A/breeder duck/Korea/H128/2014 (A/H5N8) segment 5 (NP) 2721.2 0.000000e+00 1489/1497 (99%)
EPI542629 A/mallard/Korea/W452/2014 (A/H5N8) segment 5 (NP) 2721.2 0.000000e+00 1489/1497 (99%)
EPI517162 A/Chicken/Kumamoto/1-7/2014 (A/H5N8) segment 5 (NP) 2721.2 0.000000e+00 1489/1497 (99%)
EPI561691 A/common teal/Korea/H455-30/2014 (A/H5N8) segment 5 (NP) 2715.7 0.000000e+00 1488/1497 (99%)
EPI561682 A/tundra swan/Korea/H411/2014 (A/H5N8) segment 5 (NP) 2715.7 0.000000e+00 1488/1497 (99%)
EPI561661 A/Korean native chicken/Korea/H257/2014 (A/H5N8) segment 5 (NP) 2715.7 0.000000e+00 1488/1497 (99%)
EPI561627 A/mallard/Korea/H207/2014 (A/H5N8) segment 5 (NP) 2715.7 0.000000e+00 1488/1497 (99%)
EPI561620 A/breeder duck/Korea/H200/2014 (A/H5N8) segment 5 (NP) 2715.7 0.000000e+00 1488/1497 (99%)
EPI561557 A/Coot/Korea/H81/2014 (A/H5N8) segment 5 (NP) 2715.7 0.000000e+00 1488/1497 (99%)
EPI561550 A/Baikal teal/Korea/H80/2014 (A/H5N8) segment 5 (NP) 2715.7 0.000000e+00 1488/1497 (99%)
EPI561349 A/broiler duck/Korea/H47/2014 (A/H5N8) segment 5 (NP) 2715.7 0.000000e+00 1488/1497 (99%)
EPI561206 A/broiler duck/Korea/H31/2014 (A/H5N8) segment 5 (NP) 2715.7 0.000000e+00 1488/1497 (99%)
EPI561197 A/broiler duck/Korea/H29/2014 (A/H5N8) segment 5 (NP) 2715.7 0.000000e+00 1488/1497 (99%)
EPI509713 A/baikal teal/Korea/Donglim3/2014 (A/H5N8) segment 5 (NP) 2715.7 0.000000e+00 1488/1497 (99%)
EPI561698 A/spot-billed duck/Korea/H455-42/2014 (A/H5N8) segment 5 (NP) 2710.2 0.000000e+00 1487/1497 (99%)
EPI561599 A/broiler duck/Korea/H133/2014 (A/H5N8) segment 5 (NP) 2710.2 0.000000e+00 1487/1497 (99%)
EPI561516 A/Baikal teal/Korea/H62/2014 (A/H5N8) segment 5 (NP) 2710.2 0.000000e+00 1487/1497 (99%)
EPI561188 A/waterfowl/Korea/S005/2014 (A/H5N8) segment 5 (NP) 2710.2 0.000000e+00 1487/1497 (99%)
EPI542625 A/duck/Beijing/FS01/2013 (A/H5N8) segment 5 (NP) 2710.2 0.000000e+00 1487/1497 (99%)
EPI509705 A/broiler duck/Korea/Buan2/2014 (A/H5N8) segment 5 (NP) 2710.2 0.000000e+00 1487/1497 (99%)
EPI548494 A/duck/Chiba/26-372-61/2014 (A/H5N8) segment 5 (NP) 2699.1 0.000000e+00 1485/1497 (99%)
EPI553182 A/turkey/Italy/14VIR7898-10/2014 (A/H5N8) segment 5 (NP) 2693.5 0.000000e+00 1484/1497 (99%)
EPI552747 A/turkey/Germany/R2474-L00899/2014 (A/H5N8) segment 5 (NP) 2693.5 0.000000e+00 1484/1497 (99%)
EPI548486 A/duck/Chiba/26-372-48/2014 (A/H5N8) segment 5 (NP) 2693.5 0.000000e+00 1484/1497 (99%)
EPI548427 A/turkey/Germany-MV/R2472/2014 (A/H5N8) segment 5 (NP) 2693.5 0.000000e+00 1484/1497 (99%)
EPI553363 A/environment/Kagoshima/KU-ngr-H/2014 (A/H5N8) segment 5 (NP) 2688.0 0.000000e+00 1483/1497 (99%)
EPI553344 A/chicken/Miyazaki/7/2014 (A/H5N8) segment 5 (NP) 2688.0 0.000000e+00 1483/1497 (99%)
EPI558011 A/duck/England/36038/14 (A/H5N8) segment 5 (NP) 2682.5 0.000000e+00 1482/1497 (98%)
EPI558004 A/duck/England/36226/14 (A/H5N8) segment 5 (NP) 2682.5 0.000000e+00 1482/1497 (98%)
EPI554602 A/turkey/Germany-NI/R3372/2014 (A/H5N8) segment 5 (NP) 2682.5 0.000000e+00 1482/1497 (98%)
EPI548624 A/chicken/Netherlands/14015531/2014 (A/H5N8) segment 5 (NP) 2682.5 0.000000e+00 1482/1497 (98%)
EPI547674 A/duck/England/36254/14 (A/H5N8) segment 5 (NP) 2682.5 0.000000e+00 1482/1497 (98%)
EPI547682 A/Chicken/Netherlands/14015526/2014 (A/H5N8) segment 5 (NP) 2676.9 0.000000e+00 1481/1497 (98%)
EPI552761 A/eurasian wigeon/Netherlands/emc-1/2014 (A/H5N8) segment 5 (NP) 2669.5 0.000000e+00 1473/1487 (99%)
EPI543003 A/duck/Beijing/FS01/2014 (A/H5N8) segment 5 (NP) 2660.3 0.000000e+00 1474/1492 (98%)
EPI552769 A/eurasian wigeon/Netherlands/emc-2/2014 (A/H5N8) segment 5 (NP) 2658.4 0.000000e+00 1469/1484 (98%)
EPI552777 A/chicken/Netherlands/emc-3/2014 (A/H5N8) segment 5 (NP) 2651.1 0.000000e+00 1463/1477 (99%)
EPI475564 A/wild duck/Shandong/1/2011 (A/H5N1) segment 5 (NP) 2649.2 0.000000e+00 1476/1497 (98%)
EPI399961 A/duck/Jiangsu/m234/2012 (A/H5N2) segment 5 (NP) 2643.7 0.000000e+00 1475/1497 (98%)
EPI475580 A/wild duck/Shandong/628/2011 (A/H5N1) segment 5 (NP) 2638.1 0.000000e+00 1474/1497 (98%)
EPI543011 A/duck/Beijing/CT01/2014 (A/H5N8) segment 5 (NP) 2616.0 0.000000e+00 1454/1472 (98%)
EPI431457 A/duck/Hebei/3/2011 (A/H5N2) segment 5 (NP) 2599.4 0.000000e+00 1467/1497 (97%)
EPI442018 A/duck/Jiangsu/k1203/2010 (A/H5N8) segment 5 (NP) 2588.3 0.000000e+00 1453/1479 (98%)
EPI561503 A/Baikal teal/Korea/H52/2014 (A/H5N8) segment 5 (NP) 2566.1 0.000000e+00 1462/1498 (97%)
EPI509699 A/breeder duck/Korea/Gochang1/2014 (A/H5N8) segment 5 (NP) 2566.1 0.000000e+00 1462/1498 (97%)
EPI530988 A/duck/Zhejiang/6D18/2013 (A/H5N8) segment 5 (NP) 2555.0 0.000000e+00 1460/1498 (97%)
EPI507674 A/mallard duck/Shanghai/SH-9/2013 (A/H5N8) segment 5 (NP) 2549.5 0.000000e+00 1459/1498 (97%)
EPI530987 A/duck/Zhejiang/W24/2013 (A/H5N8) segment 5 (NP) 2538.4 0.000000e+00 1457/1498 (97%)
EPI544893 A/duck/Shandong/Q1/2013 (A/H5N8) segment 5 (NP) 2532.9 0.000000e+00 1447/1485 (97%)
EPI493826 A/duck/Guangdong/wy19/2008 (A/H5N5) segment 5 (NP) 2422.1 0.000000e+00 1435/1497 (95%)
EPI493818 A/duck/Guangdong/wy11/2008 (A/H5N5) segment 5 (NP) 2422.1 0.000000e+00 1435/1497 (95%)
EPI328869 A/duck/Eastern China/008/2008 (A/H5N5) segment 5 (NP) 2418.4 0.000000e+00 1433/1495 (95%)
EPI328885 A/duck/Eastern China/108/2008 (A/H5N1) segment 5 (NP) 2416.5 0.000000e+00 1434/1497 (95%)
EPI398969 A/duck/Eastern China/1111/2011 (A/H5N2) segment 5 (NP) 2411.0 0.000000e+00 1433/1497 (95%)
EPI328877 A/duck/Eastern China/031/2009 (A/H5N5) segment 5 (NP) 2411.0 0.000000e+00 1433/1497 (95%)
EPI414239 A/duck/Jiangsu/1-15/2011 (A/H4N2) segment 5 (NP) 2405.5 0.000000e+00 1432/1497 (95%)
EPI493834 A/duck/Guangdong/wy24/2008 (A/H5N5) segment 5 (NP) 2399.9 0.000000e+00 1431/1497 (95%)
EPI398970 A/goose/Eastern China/1112/2011 (A/H5N2) segment 5 (NP) 2399.9 0.000000e+00 1432/1498 (95%)
EPI268748 A/duck/Shantou/494/2002 (A/H6N2) segment 5 (NP) 2399.9 0.000000e+00 1432/1498 (95%)
EPI442010 A/goose/Guangdong/k0103/2010 (A/H5N5) segment 5 (NP) 2394.4 0.000000e+00 1430/1497 (95%)
EPI431449 A/duck/Hebei/2/2011 (A/H5N2) segment 5 (NP) 2394.4 0.000000e+00 1430/1497 (95%)
EPI268780 A/duck/Shantou/728/2001 (A/H6N2) segment 5 (NP) 2394.4 0.000000e+00 1431/1498 (95%)
EPI268760 A/duck/Shantou/4534/2001 (A/H6N2) segment 5 (NP) 2377.8 0.000000e+00 1428/1498 (95%)
EPI180350 A/duck/Primorie/2621/01 (A/H5N2) segment 5 (NP) 2372.2 0.000000e+00 1428/1499 (95%)
EPI182405 A/duck/Primorie/2633/01 (A/H5N3) segment 5 (NP) 2355.6 0.000000e+00 1426/1500 (95%)
EPI345664 A/duck/Eastern China/50/2002 (A/H6N8) segment 5 (NP) 2344.5 0.000000e+00 1424/1500 (94%)
EPI268671 A/duck/Hunan/491/2005 (A/H6N2) segment 5 (NP) 2344.5 0.000000e+00 1422/1498 (94%)
EPI12513 A/aquatic bird/Hong Kong/399/99 (A/H3N8) segment 5 (NP) 2339.0 0.000000e+00 1421/1498 (94%)
EPI268715 A/duck/Shantou/1838/2003 (A/H6N2) segment 5 (NP) 2333.4 0.000000e+00 1420/1498 (94%)
EPI345660 A/duck/Eastern China/55/2003 (A/H6N2) segment 5 (NP) 2327.9 0.000000e+00 1420/1499 (94%)
EPI345658 A/duck/Eastern China/58/2003 (A/H6N2) segment 5 (NP) 2327.9 0.000000e+00 1420/1499 (94%)
EPI345657 A/duck/Eastern China/59/2003 (A/H6N2) segment 5 (NP) 2327.9 0.000000e+00 1420/1499 (94%)
EPI345656 A/duck/Eastern China/60/2003 (A/H6N2) segment 5 (NP) 2327.9 0.000000e+00 1420/1499 (94%)
EPI169689 A/duck/Mongolia/47/01 (A/H7N1) segment 5 (NP) 2327.9 0.000000e+00 1419/1498 (94%)
EPI140245 A/wild duck/Shantou/1737/2000 (A/H6N8) segment 5 (NP) 2326.1 0.000000e+00 1417/1496 (94%)
EPI470428 A/duck/Guangdong/707/2000 (A/H2N9) segment 5 (NP) 2322.4 0.000000e+00 1418/1498 (94%)
EPI442026 A/quail/Jiangsu/k0104/2010 (A/H5N5) segment 5 (NP) 2322.4 0.000000e+00 1418/1498 (94%)
EPI345674 A/duck/Eastern China/29/2004 (A/H6N2) segment 5 (NP) 2322.4 0.000000e+00 1419/1499 (94%)
EPI345659 A/duck/Eastern China/57/2003 (A/H6N2) segment 5 (NP) 2322.4 0.000000e+00 1419/1499 (94%)
EPI25895 A/duck/Korea/S17/03 (A/H6N1) segment 5 (NP) 2318.7 0.000000e+00 1417/1498 (94%)
EPI371009 A/wild duck/Shantou/992/2000 (A/H2N8) segment 5 (NP) 2316.8 0.000000e+00 1417/1498 (94%)

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Fri Feb 20, 2015 7:36 pm 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
EPI561713 A/broiler duck/Korea/H31/2014 (A/H5N8) segment 8 (NS) 1548.6 0.000000e+00 838/838 (100%)
EPI561701 A/spot-billed duck/Korea/H455-42/2014 (A/H5N8) segment 8 (NS) 1548.6 0.000000e+00 838/838 (100%)
EPI561694 A/common teal/Korea/H455-30/2014 (A/H5N8) segment 8 (NS) 1548.6 0.000000e+00 838/838 (100%)
EPI561685 A/tundra swan/Korea/H411/2014 (A/H5N8) segment 8 (NS) 1548.6 0.000000e+00 838/838 (100%)
EPI561678 A/bean goose/Korea/H328/2014 (A/H5N8) segment 8 (NS) 1548.6 0.000000e+00 838/838 (100%)
EPI561671 A/mallard/Korea/H297/2014 (A/H5N8) segment 8 (NS) 1548.6 0.000000e+00 838/838 (100%)
EPI561664 A/Korean native chicken/Korea/H257/2014 (A/H5N8) segment 8 (NS) 1548.6 0.000000e+00 838/838 (100%)
EPI561657 A/breeder chicken/Korea/H250/2014 (A/H5N8) segment 8 (NS) 1548.6 0.000000e+00 838/838 (100%)
EPI561630 A/mallard/Korea/H207/2014 (A/H5N8) segment 8 (NS) 1548.6 0.000000e+00 838/838 (100%)
EPI561623 A/breeder duck/Korea/H200/2014 (A/H5N8) segment 8 (NS) 1548.6 0.000000e+00 838/838 (100%)
EPI561574 A/Baikal teal/Korea/H96/2014 (A/H5N8) segment 8 (NS) 1548.6 0.000000e+00 838/838 (100%)
EPI561560 A/Coot/Korea/H81/2014 (A/H5N8) segment 8 (NS) 1548.6 0.000000e+00 838/838 (100%)
EPI561553 A/Baikal teal/Korea/H80/2014 (A/H5N8) segment 8 (NS) 1548.6 0.000000e+00 838/838 (100%)
EPI561533 A/Baikal teal/Korea/H66/2014 (A/H5N8) segment 8 (NS) 1548.6 0.000000e+00 838/838 (100%)
EPI561519 A/Baikal teal/Korea/H62/2014 (A/H5N8) segment 8 (NS) 1548.6 0.000000e+00 838/838 (100%)
EPI561345 A/Baikal teal/Korea/H41/2014 (A/H5N8) segment 8 (NS) 1548.6 0.000000e+00 838/838 (100%)
EPI561200 A/broiler duck/Korea/H29/2014 (A/H5N8) segment 8 (NS) 1548.6 0.000000e+00 838/838 (100%)
EPI542634 A/mallard/Korea/W452/2014 (A/H5N8) segment 8 (NS) 1548.6 0.000000e+00 838/838 (100%)
EPI509757 A/baikal teal/Korea/Donglim3/2014 (A/H5N8) segment 8 (NS) 1548.6 0.000000e+00 838/838 (100%)
EPI509712 A/broiler duck/Korea/Buan2/2014 (A/H5N8) segment 8 (NS) 1548.6 0.000000e+00 838/838 (100%)
EPI561650 A/breeder duck/Korea/H249/2014 (A/H5N8) segment 8 (NS) 1543.1 0.000000e+00 837/838 (99%)
EPI561609 A/broiler duck/Korea/H145/2014 (A/H5N8) segment 8 (NS) 1543.1 0.000000e+00 837/838 (99%)
EPI561602 A/broiler duck/Korea/H133/2014 (A/H5N8) segment 8 (NS) 1543.1 0.000000e+00 837/838 (99%)
EPI561595 A/breeder duck/Korea/H128/2014 (A/H5N8) segment 8 (NS) 1543.1 0.000000e+00 837/838 (99%)
EPI561581 A/breeder chicken/Korea/H122/2014 (A/H5N8) segment 8 (NS) 1543.1 0.000000e+00 837/838 (99%)
EPI561546 A/Baikal teal/Korea/H68/2014 (A/H5N8) segment 8 (NS) 1543.1 0.000000e+00 837/838 (99%)
EPI561364 A/bean goose/Korea/H40/2014 (A/H5N8) segment 8 (NS) 1543.1 0.000000e+00 837/838 (99%)
EPI561357 A/broiler duck/Korea/H48/2014 (A/H5N8) segment 8 (NS) 1543.1 0.000000e+00 837/838 (99%)
EPI561352 A/broiler duck/Korea/H47/2014 (A/H5N8) segment 8 (NS) 1543.1 0.000000e+00 837/838 (99%)
EPI561191 A/waterfowl/Korea/S005/2014 (A/H5N8) segment 8 (NS) 1543.1 0.000000e+00 837/838 (99%)
EPI554604 A/turkey/Germany-NI/R3372/2014 (A/H5N8) segment 8 (NS) 1543.1 0.000000e+00 837/838 (99%)
EPI553471 A/wigeon/Sakha/1/2014 (A/H5N8) segment 8 (NS) 1543.1 0.000000e+00 837/838 (99%)
EPI552750 A/turkey/Germany/R2474-L00899/2014 (A/H5N8) segment 8 (NS) 1543.1 0.000000e+00 837/838 (99%)
EPI548628 A/chicken/Netherlands/14015531/2014 (A/H5N8) segment 8 (NS) 1543.1 0.000000e+00 837/838 (99%)
EPI548428 A/turkey/Germany-MV/R2472/2014 (A/H5N8) segment 8 (NS) 1543.1 0.000000e+00 837/838 (99%)
EPI561637 A/white-fronted goose/Korea/H231/2014 (A/H5N8) segment 8 (NS) 1537.5 0.000000e+00 836/838 (99%)
EPI561616 A/breeder duck/Korea/H158/2014 (A/H5N8) segment 8 (NS) 1537.5 0.000000e+00 836/838 (99%)
EPI561567 A/Baikal teal/Korea/H84/2014 (A/H5N8) segment 8 (NS) 1537.5 0.000000e+00 836/838 (99%)
EPI561512 A/bean goose/Korea/H53/2014 (A/H5N8) segment 8 (NS) 1537.5 0.000000e+00 836/838 (99%)
EPI558013 A/duck/England/36038/14 (A/H5N8) segment 8 (NS) 1537.5 0.000000e+00 836/838 (99%)
EPI553212 A/crane/Kagoshima/KU1/2014 (A/H5N8) segment 8 (NS) 1537.5 0.000000e+00 836/838 (99%)
EPI547685 A/Chicken/Netherlands/14015526/2014 (A/H5N8) segment 8 (NS) 1537.5 0.000000e+00 836/838 (99%)
EPI547677 A/duck/England/36254/14 (A/H5N8) segment 8 (NS) 1537.5 0.000000e+00 836/838 (99%)
EPI517165 A/Chicken/Kumamoto/1-7/2014 (A/H5N8) segment 8 (NS) 1537.5 0.000000e+00 836/838 (99%)
EPI558006 A/duck/England/36226/14 (A/H5N8) segment 8 (NS) 1533.8 0.000000e+00 835/838 (99%)
EPI561526 A/broiler duck/Korea/H65/2014 (A/H5N8) segment 8 (NS) 1532.0 0.000000e+00 835/838 (99%)
EPI561369 A/broiler duck/Korea/H49/2014 (A/H5N8) segment 8 (NS) 1532.0 0.000000e+00 835/838 (99%)
EPI553366 A/environment/Kagoshima/KU-ngr-H/2014 (A/H5N8) segment 8 (NS) 1532.0 0.000000e+00 835/838 (99%)
EPI548497 A/duck/Chiba/26-372-61/2014 (A/H5N8) segment 8 (NS) 1532.0 0.000000e+00 835/838 (99%)
EPI548489 A/duck/Chiba/26-372-48/2014 (A/H5N8) segment 8 (NS) 1532.0 0.000000e+00 835/838 (99%)
EPI553347 A/chicken/Miyazaki/7/2014 (A/H5N8) segment 8 (NS) 1520.9 0.000000e+00 833/838 (99%)
EPI542998 A/duck/Beijing/FS01/2013 (A/H5N8) segment 8 (NS) 1520.9 0.000000e+00 831/835 (99%)
EPI543014 A/duck/Beijing/CT01/2014 (A/H5N8) segment 8 (NS) 1515.4 0.000000e+00 830/835 (99%)
EPI543006 A/duck/Beijing/FS01/2014 (A/H5N8) segment 8 (NS) 1509.8 0.000000e+00 829/835 (99%)
EPI553183 A/turkey/Italy/14VIR7898-10/2014 (A/H5N8) segment 8 (NS) 1493.2 0.000000e+00 813/816 (99%)
EPI552780 A/chicken/Netherlands/emc-3/2014 (A/H5N8) segment 8 (NS) 1493.2 0.000000e+00 812/814 (99%)
EPI431452 A/duck/Hebei/2/2011 (A/H5N2) segment 8 (NS) 1493.2 0.000000e+00 823/830 (99%)
EPI403396 A/duck/Eastern China/1111/2011 (A/H5N2) segment 8 (NS) 1493.2 0.000000e+00 828/838 (98%)
EPI414242 A/duck/Jiangsu/1-15/2011 (A/H4N2) segment 8 (NS) 1487.7 0.000000e+00 827/838 (98%)
EPI403397 A/goose/Eastern China/1112/2011 (A/H5N2) segment 8 (NS) 1482.1 0.000000e+00 827/839 (98%)
EPI552764 A/eurasian wigeon/Netherlands/emc-1/2014 (A/H5N8) segment 8 (NS) 1472.9 0.000000e+00 799/800 (99%)
EPI475583 A/wild duck/Shandong/628/2011 (A/H5N1) segment 8 (NS) 1448.9 0.000000e+00 820/838 (97%)
EPI431460 A/duck/Hebei/3/2011 (A/H5N2) segment 8 (NS) 1439.7 0.000000e+00 815/832 (97%)
EPI399964 A/duck/Jiangsu/m234/2012 (A/H5N2) segment 8 (NS) 1428.6 0.000000e+00 815/836 (97%)
EPI552772 A/eurasian wigeon/Netherlands/emc-2/2014 (A/H5N8) segment 8 (NS) 1404.6 0.000000e+00 768/772 (99%)
EPI296628 A/mallard/Sweden/95/2005 (A/H7N7) segment 8 (NS) 1371.3 0.000000e+00 806/838 (96%)
EPI130868 A/duck/Nanchang/1944/1993 (A/H7N4) segment 8 (NS) 1371.3 0.000000e+00 806/838 (96%)
EPI89129 A/duck/Nanchang/1904/1992 (A/H7N1) segment 8 (NS) 1371.3 0.000000e+00 806/838 (96%)
EPI485927 A/mallard/Sweden/17/2002 (A/H10N4) segment 8 (NS) 1365.8 0.000000e+00 805/838 (96%)
EPI485684 A/mallard/Sweden/64/2003 (A/H7N7) segment 8 (NS) 1365.8 0.000000e+00 805/838 (96%)
EPI377644 A/mallard/Netherlands/14/2001 (A/H2N3) segment 8 (NS) 1365.8 0.000000e+00 805/838 (96%)
EPI251862 A/whitefronted goose/Netherlands/2/1999 (A/H6N2) segment 8 (NS) 1365.8 0.000000e+00 805/838 (96%)
EPI251854 A/whitefronted goose/Netherlands/1/1999 (A/H6N1) segment 8 (NS) 1365.8 0.000000e+00 805/838 (96%)
EPI251704 A/mallard/Sweden/4/2002 (A/H10N2) segment 8 (NS) 1365.8 0.000000e+00 806/839 (96%)
EPI251621 A/greylag goose/Netherlands/4/1999 (A/H6N1) segment 8 (NS) 1365.8 0.000000e+00 805/838 (96%)
EPI182085 A/black-headed gull/Netherlands/1/2005 (A/H6N8) segment 8 (NS) 1365.8 0.000000e+00 805/838 (96%)
EPI105878 A/duck/Primorie/3691/02 (A/H12N2) segment 8 (NS) 1365.8 0.000000e+00 799/829 (96%)
EPI514909 A/mallard/Sweden/146/2002 (A/H4N6) segment 8 (NS) 1360.3 0.000000e+00 805/839 (95%)
EPI514749 A/mallard/Sweden/4514/2004 (A/H4N6) segment 8 (NS) 1360.3 0.000000e+00 804/838 (95%)
EPI514157 A/mallard/Sweden/58359/2006 (A/H0) segment 8 (NS) 1360.3 0.000000e+00 804/838 (95%)
EPI447398 A/mallard/Italy/3401/2005 (A/H5N1) segment 8 (NS) 1360.3 0.000000e+00 804/838 (95%)
EPI447396 A/mallard/Italy/3401/2005 (A/H5N1) segment 8 (NS) 1360.3 0.000000e+00 804/838 (95%)
EPI327321 A/mallard/Italy/3401/2005 (A/H5N1) segment 8 (NS) 1360.3 0.000000e+00 804/838 (95%)
EPI60376 A/mallard/Italy/3401/2005 (A/H5N1) segment 8 (NS) 1360.3 0.000000e+00 804/838 (95%)
EPI514916 A/mallard/Sweden/274/2002 (A/H4N2) segment 8 (NS) 1354.7 0.000000e+00 803/838 (95%)
EPI514892 A/mallard/Sweden/1616/2002 (A/H4N6) segment 8 (NS) 1354.7 0.000000e+00 803/838 (95%)
EPI514885 A/mallard/Sweden/1544/2002 (A/H4N6) segment 8 (NS) 1354.7 0.000000e+00 803/838 (95%)
EPI514833 A/mallard/Sweden/1705/2002 (A/H4N6) segment 8 (NS) 1354.7 0.000000e+00 803/838 (95%)
EPI514826 A/mallard/Sweden/1677/2002 (A/H4N6) segment 8 (NS) 1354.7 0.000000e+00 803/838 (95%)
EPI514819 A/mallard/Sweden/1665/2002 (A/H4N6) segment 8 (NS) 1354.7 0.000000e+00 803/838 (95%)
EPI514812 A/mallard/Sweden/1656/2002 (A/H4N6) segment 8 (NS) 1354.7 0.000000e+00 803/838 (95%)
EPI514222 A/mallard/Sweden/52484/2006 (A/H4N6) segment 8 (NS) 1354.7 0.000000e+00 803/838 (95%)
EPI485934 A/mallard/Sweden/39/2002 (A/H5N3) segment 8 (NS) 1354.7 0.000000e+00 804/839 (95%)
EPI372420 A/teal/Egypt/01207-NAMRU3/2007 (A/H10N7) segment 8 (NS) 1354.7 0.000000e+00 803/838 (95%)
EPI327035 A/duck/Korea/JS49/2004 (A/H3N2) segment 8 (NS) 1354.7 0.000000e+00 803/838 (95%)
EPI296525 A/mallard/Netherlands/02/2000 (A/H10N7) segment 8 (NS) 1354.7 0.000000e+00 803/838 (95%)
EPI272784 A/mallard/PT/35910-2/2006 (A/H4N6) segment 8 (NS) 1354.7 0.000000e+00 803/838 (95%)
EPI268644 A/wild duck/Shantou/311/2001 (A/H6N9) segment 8 (NS) 1354.7 0.000000e+00 803/838 (95%)
EPI268623 A/mallard/Jiangxi/8341/2004 (A/H6N5) segment 8 (NS) 1354.7 0.000000e+00 803/838 (95%)
EPI268610 A/duck/Shantou/1090/2001 (A/H6N2) segment 8 (NS) 1354.7 0.000000e+00 803/838 (95%)

_________________
www.twitter.com/hniman


Top
 Profile  
 
Display posts from previous:  Sort by  
Post new topic Reply to topic  [ 26 posts ]  Go to page 1, 2, 3  Next

All times are UTC - 5 hours [ DST ]


Who is online

Users browsing this forum: Yahoo [Bot] and 7 guests


You cannot post new topics in this forum
You cannot reply to topics in this forum
You cannot edit your posts in this forum
You cannot delete your posts in this forum
You cannot post attachments in this forum

Search for:
Jump to:  
cron
Powered by phpBB® Forum Software © phpBB Group