Rhiza Labs FluTracker Forum

The place to discuss the flu
It is currently Mon Oct 23, 2017 5:54 am

All times are UTC - 5 hours [ DST ]




Post new topic Reply to topic  [ 26 posts ]  Go to page 1, 2, 3  Next
Author Message
PostPosted: Wed Feb 11, 2015 1:02 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
Full H5N3 Sequences A/Goose/Taiwan/01042/2015 released.

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Wed Feb 11, 2015 1:03 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
3 1776 bp mRNA linear 29-JAN-2015

DEFINITION

ACCESSION VERSION KEYWORDS SOURCE

ORGANISM


REFERENCE AUTHORS

TITLE JOURNAL
REFERENCE AUTHORS

TITLE JOURNAL


COMMENT



FEATURES
source










gene CDS

Influenza A virus A/Goose/Taiwan/01042/2015 (HSN3)) hemagglutinin (HA) gene , complete eds.



Viruses; ssRNA negative-strand viruses ; Orthomyxoviridae ; Influenzavirus A.
Viruses; ssRNA negative-strand viruses; Orthomyxoviridae ; Influenzavirus A.
Unclassified .
1 (bases 1 to 1776)
Lee , M .S. , Chen , L.H. , Liu,Y.P. , Chen,Y. P. , Li ,W. C. , Lee, F. ,
Ting , L .J. and Lin,Y.L.
Avian influenza subtype HS in geese in Taiwan , 2015 Unpublished
2 (bases 1 to 1776)
Lee,M.S. , Chen,L.H. , Liu,Y.P. , Chen, Y.P. , Li,W.C. , Lee, F .,
Ting ,L.J. and Lin,Y.L. Direct Submission
Submitted (29-JAN-2015) Epidemiology Research Department, National Institute for Animal Health, Chung-Cheng Rd, Tansui, Taiwan 251, Taiwan
##Assembly-Data-START##
Assembly Method Lasergene DNASTAR v. Jan. 2015 Sequencing Technology : : Sanger dideoxy sequencing
##Assembly -Data-END##
Location/Qualifiers
1. . 1776
/organism= "Viruses; ssRNA negative-strand viruses ; Orthomyxoviridae ; Influenzavirus A ."
/mol type= "mRNA "
/strain= "A/GS/TW/01042/2015 "
/host= "goose"
/segment= "4"
/tissue type="organ"
/country= "Taiwan "
/collection date="2015/0l/12 "
/subtype="HSN3 "
1. .1776
/gene= "HA " 29 ..1732
/gene="HA"
/codon start=l
/product=" hemagglutinin"
/translation="MEKIVLLLAVISLVKSDQICIGYHANNSTKQVDTIMEK.NVTVTH AQDILEKTHNGKLCDLNGVKPLILKDCSVAGWLLGNPMCDEFIRVPEWSYIVERANPA NDLCYPGTLNDYEELKHLLSRINHFEKTLIIPRSSWPNHETSLGVSAACPYQGASSFF RNVVWLIKK.NDAYPTIKISYNNTNREDLLILWGIHHSNNAAEQTNLYK.NPDTYVSVGT STLNQRLVPKIATRSQVNGQSGRMDFFWTILKPNDAIHFESNGNFIAPEYAYKIVKKG

DSTIMKSEMEYGHCNTKCQTPIGAINSSMPFHNIHPLTIGECPKYVKSNKLVLATGLR NSPLRERRRKRGLFGAIAGFIEGGWQGMVDGWYGYHHSNEQGSGYAADKESTQKAIDG VTNKVNSIIDKMNTQFEAVGREFNNLERRIENLNKKMEDGFLDVWTYNAELLVLMENE RTLDFHDSNVKNLYDKVRLQLRDNAKE:LGNGCFEFYHKCDNECMESVRNGTYDYPKYS EEAILKREEISGVKLESIGTYQILSIYSTVASSLALAIIVAGLSLWMCSNGSLQCRIC III
BASE COUNT 617 a 330 c 403 g 426 t ORIGIN
1 agcaaaagca ggggtataat ctgtcaaaat ggagaaaata gtgcttcttc ttgcagtgat
61 tagccttgtt aaaagtgatc agatttgcat tggttaccat gcaaacaact caacaaagca
121 ggttgacacg ataatggaga aaaacgtcac tgttacacat gcccaagaca tactggaaaa
181 gacacacaac gggaagctct gcgatcttaa tggagtgaag cccctgattt taaaggattg
241 tagcgtagct gggtggctcc ttggaaatcc aatgtgcgac gagttcatca gggtgccgga
301 atggtcttac atcgtggaga gggctaaccc agccaacgac ctctgttacc cagggaccct
361 caatgactat gaggaactga aacacctatt gagcagaata aatcattttg agaaaactct
421 gatcatcccc aggagttctt ggcccaatca tgaaacatca ttaggggtga gcgcagcatg
481 tccataccag ggagcatcct catttttcag aaatgtggta tggctcatca aaaagaacga
541 tgcatacccg acaataaaga taagctacaa taataccaat cgggaagatc ttttgatact 601 gtgggggatt catcattcca acaatgcagc agagcagaca aatctctata aaaacccaga 661 cacttatgtt tccgtgggga catcaacatt aaaccagaga ttggtgccaa aaatagctac 721 tagatcccaa gtaaacgggc aaagtggaag aatggatttc ttctggacaa ttttaaaacc 781 gaatgatgca atccactttg agagtaatgg aaatttcatt gctccagaat atgcatacaa 841 aattgtcaag aaaggggact caacaattat gaaaagtgaa atggagtatg gccactgcaa 901 caccaaatgt caaactccaa taggggcgat aaactctagc atgccattcc acaatataca 961 ccctctcacc atcggggaat gccccaaata cgtgaagtca aacaaattag tccttgcgac 1021 tgggctcaga aatagtcctc taagagaaag aagaagaaaa agaggactat ttggagctat 1081 agcagggttt atagagggag gatggcaggg aatggtagac ggttggtatg ggtatcatca 1141 tagcaatgag caggggagtg ggtacgctgc agacaaagaa tccacccaaa aggcaataga 1201 tggagttacc aataaggtca actcaatcat tgacaaaatg aacactcaat ttgaggccgt 1261 tggaagggaa tttaataact tagaaaggag aatagagaat ttaaacaaga aaatggaaga 1321 cggattccta gatgtctgga cttataatgc tgaactttta gttctcatgg aaaatgagag 1381 aactctagat ttccatgact caaatgtcaa gaacctttac gacaaagtcc ggctacagct 1441 tagggataat gcaaaagagc tgggtaatgg ttgtttcgag ttctatcaca aatgtgataa 1501 cgaatgtatg gagagcgtaa gaaatgggac gtatgactac cctaagtatt cagaagaagc 1561 aatattaaaa agagaagaaa taagcggagt gaaattagaa tcaataggaa cttaccaaat 1621 actgtcaatt tattcaacag tggcgagttc cctagcactg gcaatcatag tggctggtct 1681 atctttatgg atgtgctcta atgggtcgtt acaatgcaga atttgcatct aaatttgtga
1741 gctcagattg tagttaaaaa cacccttgtt tctact

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Wed Feb 11, 2015 1:08 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
EPI553208 A/crane/Kagoshima/KU1/2014 (A/H5N8) segment 4 (HA) 3116.4 0.000000e+00 1697/1702 (99%)
EPI561570 A/Baikal teal/Korea/H96/2014 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%)
EPI561646 A/breeder duck/Korea/H249/2014 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%)
EPI561626 A/mallard/Korea/H207/2014 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%)
EPI561605 A/broiler duck/Korea/H145/2014 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%)
EPI561591 A/breeder duck/Korea/H128/2014 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%)
EPI561529 A/Baikal teal/Korea/H66/2014 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%)
EPI561508 A/bean goose/Korea/H53/2014 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%)
EPI561341 A/Baikal teal/Korea/H41/2014 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%)
EPI561674 A/bean goose/Korea/H328/2014 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%)
EPI561612 A/breeder duck/Korea/H158/2014 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%)
EPI561577 A/breeder chicken/Korea/H122/2014 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%)
EPI561563 A/Baikal teal/Korea/H84/2014 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%)
EPI561542 A/Baikal teal/Korea/H68/2014 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%)
EPI561522 A/broiler duck/Korea/H65/2014 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%)
EPI561705 A/bean goose/Korea/H40/2014 (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1689/1704 (99%)
EPI561667 A/mallard/Korea/H297/2014 (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1690/1705 (99%)
EPI561653 A/breeder chicken/Korea/H250/2014 (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1689/1704 (99%)
EPI561633 A/white-fronted goose/Korea/H231/2014 (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1689/1704 (99%)
EPI509704 A/broiler duck/Korea/Buan2/2014 (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1689/1704 (99%)
EPI561697 A/spot-billed duck/Korea/H455-42/2014 (A/H5N8) segment 4 (HA) 3059.2 0.000000e+00 1688/1704 (99%)
EPI561681 A/tundra swan/Korea/H411/2014 (A/H5N8) segment 4 (HA) 3059.2 0.000000e+00 1688/1704 (99%)
EPI561660 A/Korean native chicken/Korea/H257/2014 (A/H5N8) segment 4 (HA) 3059.2 0.000000e+00 1688/1704 (99%)
EPI561598 A/broiler duck/Korea/H133/2014 (A/H5N8) segment 4 (HA) 3059.2 0.000000e+00 1688/1704 (99%)
EPI561360 A/broiler duck/Korea/H49/2014 (A/H5N8) segment 4 (HA) 3059.2 0.000000e+00 1688/1704 (99%)
EPI561348 A/broiler duck/Korea/H47/2014 (A/H5N8) segment 4 (HA) 3059.2 0.000000e+00 1688/1704 (99%)
EPI561336 A/broiler duck/Korea/H48/2014 (A/H5N8) segment 4 (HA) 3059.2 0.000000e+00 1688/1704 (99%)
EPI561204 A/broiler duck/Korea/H31/2014 (A/H5N8) segment 4 (HA) 3059.2 0.000000e+00 1688/1704 (99%)
EPI561196 A/broiler duck/Korea/H29/2014 (A/H5N8) segment 4 (HA) 3059.2 0.000000e+00 1688/1704 (99%)
EPI561187 A/waterfowl/Korea/S005/2014 (A/H5N8) segment 4 (HA) 3059.2 0.000000e+00 1688/1704 (99%)
EPI517161 A/Chicken/Kumamoto/1-7/2014 (A/H5N8) segment 4 (HA) 3059.2 0.000000e+00 1688/1704 (99%)
EPI561690 A/common teal/Korea/H455-30/2014 (A/H5N8) segment 4 (HA) 3053.6 0.000000e+00 1687/1704 (99%)
EPI561556 A/Coot/Korea/H81/2014 (A/H5N8) segment 4 (HA) 3053.6 0.000000e+00 1687/1704 (99%)
EPI561549 A/Baikal teal/Korea/H80/2014 (A/H5N8) segment 4 (HA) 3053.6 0.000000e+00 1687/1704 (99%)
EPI561515 A/Baikal teal/Korea/H62/2014 (A/H5N8) segment 4 (HA) 3053.6 0.000000e+00 1687/1704 (99%)
EPI509709 A/baikal teal/Korea/Donglim3/2014 (A/H5N8) segment 4 (HA) 3053.6 0.000000e+00 1687/1704 (99%)
EPI561619 A/breeder duck/Korea/H200/2014 (A/H5N8) segment 4 (HA) 3042.6 0.000000e+00 1686/1705 (98%)
EPI542628 A/mallard/Korea/W452/2014 (A/H5N8) segment 4 (HA) 3037.0 0.000000e+00 1684/1704 (98%)
EPI553349 A/wigeon/Sakha/1/2014 (A/H5N8) segment 4 (HA) 3031.5 0.000000e+00 1683/1704 (98%)
EPI550849 A/duck/England/36226/14 (A/H5N8) segment 4 (HA) 3025.9 0.000000e+00 1682/1704 (98%)
EPI550848 A/duck/England/36038/14 (A/H5N8) segment 4 (HA) 3025.9 0.000000e+00 1682/1704 (98%)
EPI547673 A/duck/England/36254/14 (A/H5N8) segment 4 (HA) 3014.9 0.000000e+00 1680/1704 (98%)
EPI552746 A/turkey/Germany/R2474-L00899/2014 (A/H5N8) segment 4 (HA) 3003.8 0.000000e+00 1678/1704 (98%)
EPI548493 A/duck/Chiba/26-372-61/2014 (A/H5N8) segment 4 (HA) 3003.8 0.000000e+00 1678/1704 (98%)
EPI548485 A/duck/Chiba/26-372-48/2014 (A/H5N8) segment 4 (HA) 3003.8 0.000000e+00 1678/1704 (98%)
EPI547678 A/Chicken/Netherlands/14015526/2014 (A/H5N8) segment 4 (HA) 3003.8 0.000000e+00 1678/1704 (98%)
EPI548623 A/chicken/Netherlands/14015531/2014 (A/H5N8) segment 4 (HA) 2998.2 0.000000e+00 1677/1704 (98%)
EPI553362 A/environment/Kagoshima/KU-ngr-H/2014 (A/H5N8) segment 4 (HA) 2992.7 0.000000e+00 1676/1704 (98%)
EPI553343 A/chicken/Miyazaki/7/2014 (A/H5N8) segment 4 (HA) 2992.7 0.000000e+00 1677/1705 (98%)
EPI544756 A/turkey/Germany-MV/R2472/2014 (A/H5N8) segment 4 (HA) 2981.6 0.000000e+00 1666/1692 (98%)
EPI552776 A/chicken/Netherlands/emc-3/2014 (A/H5N8) segment 4 (HA) 2957.6 0.000000e+00 1656/1683 (98%)
EPI552768 A/eurasian wigeon/Netherlands/emc-2/2014 (A/H5N8) segment 4 (HA) 2957.6 0.000000e+00 1662/1692 (98%)
EPI552760 A/eurasian wigeon/Netherlands/emc-1/2014 (A/H5N8) segment 4 (HA) 2920.7 0.000000e+00 1627/1650 (98%)
EPI551149 A/eurasian wigeon/Netherlands/emc-2/2014 (A/H5N8) segment 4 (HA) 2911.4 0.000000e+00 1637/1667 (98%)
EPI543010 A/duck/Beijing/CT01/2014 (A/H5N8) segment 4 (HA) 2854.2 0.000000e+00 1587/1608 (98%)
EPI551143 A/eurasian wigeon/Netherlands/emc-1/2014 (A/H5N8) segment 4 (HA) 2848.7 0.000000e+00 1588/1611 (98%)
EPI442017 A/duck/Jiangsu/k1203/2010 (A/H5N8) segment 4 (HA) 2848.7 0.000000e+00 1653/1707 (96%)
EPI543002 A/duck/Beijing/FS01/2014 (A/H5N8) segment 4 (HA) 2843.1 0.000000e+00 1586/1609 (98%)
EPI475579 A/wild duck/Shandong/628/2011 (A/H5N1) segment 4 (HA) 2843.1 0.000000e+00 1653/1708 (96%)
EPI542617 A/duck/Beijing/FS01/2013 (A/H5N8) segment 4 (HA) 2837.6 0.000000e+00 1583/1608 (98%)
EPI399960 A/duck/Jiangsu/m234/2012 (A/H5N2) segment 4 (HA) 2804.3 0.000000e+00 1647/1709 (96%)
EPI398966 A/goose/Eastern China/1112/2011 (A/H5N2) segment 4 (HA) 2804.3 0.000000e+00 1646/1708 (96%)
EPI431456 A/duck/Hebei/3/2011 (A/H5N2) segment 4 (HA) 2793.3 0.000000e+00 1644/1708 (96%)
EPI398965 A/duck/Eastern China/1111/2011 (A/H5N2) segment 4 (HA) 2787.7 0.000000e+00 1643/1708 (96%)
EPI530054 A/duck/Jiangxi/95/2014 (A/H5N6) segment 4 (HA) 2776.6 0.000000e+00 1640/1707 (96%)
EPI544892 A/duck/Shandong/Q1/2013 (A/H5N8) segment 4 (HA) 2771.1 0.000000e+00 1642/1710 (96%)
EPI531456 A/duck/Guangdong/GD01/2014 (A/H5N6) segment 4 (HA) 2771.1 0.000000e+00 1639/1707 (96%)
EPI509698 A/breeder duck/Korea/Gochang1/2014 (A/H5N8) segment 4 (HA) 2771.1 0.000000e+00 1640/1708 (96%)
EPI561495 A/Baikal teal/Korea/H52/2014 (A/H5N8) segment 4 (HA) 2760.0 0.000000e+00 1638/1708 (95%)
EPI530985 A/duck/Zhejiang/W24/2013 (A/H5N8) segment 4 (HA) 2760.0 0.000000e+00 1636/1706 (95%)
EPI507673 A/mallard duck/Shanghai/SH-9/2013 (A/H5N8) segment 4 (HA) 2754.5 0.000000e+00 1636/1707 (95%)
EPI530063 A/environment/Shenzhen/25-24/2013 (A/H5N6) segment 4 (HA) 2748.9 0.000000e+00 1635/1707 (95%)
EPI530986 A/duck/Zhejiang/6D18/2013 (A/H5N8) segment 4 (HA) 2743.4 0.000000e+00 1635/1708 (95%)
EPI550768 A/duck/Laos/XBY004/2014 (A/H5N6) segment 4 (HA) 2737.9 0.000000e+00 1634/1708 (95%)
EPI550763 A/duck/Laos/XBY004/2014 (A/H5N6) segment 4 (HA) 2737.9 0.000000e+00 1634/1708 (95%)
EPI550759 A/chicken/Laos/XBY003/2014 (A/H5N6) segment 4 (HA) 2737.9 0.000000e+00 1634/1708 (95%)
EPI550757 A/duck/Laos/LPQ002/2014 (A/H5N6) segment 4 (HA) 2737.9 0.000000e+00 1634/1708 (95%)
EPI493825 A/duck/Guangdong/wy19/2008 (A/H5N5) segment 4 (HA) 2737.9 0.000000e+00 1635/1709 (95%)
EPI553144 A/turkey/Italy/14VIR7898-10/2014 (A/H5N8) segment 4 (HA) 2734.2 0.000000e+00 1523/1545 (98%)
EPI550752 A/chicken/Laos/LPQ001/2014 (A/H5N6) segment 4 (HA) 2732.3 0.000000e+00 1633/1708 (95%)
EPI499478 A/chicken/China/AH/2012 (A/H5N1) segment 4 (HA) 2726.8 0.000000e+00 1631/1707 (95%)
EPI431448 A/duck/Hebei/2/2011 (A/H5N2) segment 4 (HA) 2723.1 0.000000e+00 1632/1709 (95%)
EPI493817 A/duck/Guangdong/wy11/2008 (A/H5N5) segment 4 (HA) 2715.7 0.000000e+00 1632/1710 (95%)
EPI328878 A/duck/Eastern China/031/2009 (A/H5N5) segment 4 (HA) 2682.5 0.000000e+00 1624/1708 (95%)
EPI328870 A/duck/Eastern China/008/2008 (A/H5N5) segment 4 (HA) 2654.8 0.000000e+00 1620/1709 (94%)
EPI328886 A/duck/Eastern China/108/2008 (A/H5N1) segment 4 (HA) 2649.2 0.000000e+00 1619/1709 (94%)
EPI533583 A/Sichuan/26221/2014 (A/H5N6) segment 4 (HA) 2643.7 0.000000e+00 1619/1710 (94%)
EPI493833 A/duck/Guangdong/wy24/2008 (A/H5N5) segment 4 (HA) 2640.0 0.000000e+00 1620/1712 (94%)
EPI442025 A/quail/Jiangsu/k0104/2010 (A/H5N5) segment 4 (HA) 2640.0 0.000000e+00 1620/1712 (94%)
EPI547402 A/environment/Zhenjiang/C13/2013 (A/H5N6) segment 4 (HA) 2638.1 0.000000e+00 1619/1711 (94%)
EPI442001 A/goose/Shandong/k1204/2009 (A/H5N5) segment 4 (HA) 2593.8 0.000000e+00 1608/1708 (94%)
EPI442009 A/goose/Guangdong/k0103/2010 (A/H5N5) segment 4 (HA) 2584.6 0.000000e+00 1609/1711 (94%)
EPI127384 A/wild duck/Hunan/021/2005 (A/H5N1) segment 4 (HA) 2532.9 0.000000e+00 1598/1709 (93%)
EPI227309 A/Mallard/Huadong/lk/2005 (A/H5N1) segment 4 (HA) 2527.3 0.000000e+00 1596/1708 (93%)
EPI127406 A/wild duck/Hunan/211/2005 (A/H5N1) segment 4 (HA) 2527.3 0.000000e+00 1597/1709 (93%)
EPI439897 A/goose/Guangdong/08/2005 (A/H5N1) segment 4 (HA) 2525.5 0.000000e+00 1597/1709 (93%)
EPI399886 A/duck/HuBei/03/2010 (A/H5N5) segment 4 (HA) 2521.8 0.000000e+00 1597/1710 (93%)
EPI279949 A/Zhejiang/1/2006 (A/H5N1) segment 4 (HA) 2521.8 0.000000e+00 1596/1709 (93%)
EPI276046 A/goose/Hubei/65/2005 (A/H5N1) segment 4 (HA) 2521.8 0.000000e+00 1596/1709 (93%)
EPI181297 A/Zhejiang/1/2006 (A/H5N1) segment 4 (HA) 2521.8 0.000000e+00 1596/1709 (93%)

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Wed Feb 11, 2015 1:11 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
6 1454 bp mRNA linear 10-FEB-2015
DEFINITION Influenza A virus (A/Goose/Taiwan/01042/2015(H5N3)) neuraminidase (NA) gene, complete eds.

ACCESSION VERSION KEYWORDS SOURCE

ORGANISM


REFERENCE AUTHORS

TITLE JOURNAL
REFERENCE AUTHORS

TITLE JOURNAL
COMMENT FEATURES
source










gene CDS











BASE COUNT ORIGIN




Viruses ; ssRNA negative-strand viruses ; Orthomyxoviridae ; Influenzavirus A.
Viruses ; ssRNA negative-strand viruses; Orthomyxoviridae ; Influenzavirus A.
Unclassified.
1 (bases 1 to 1454)
Lee,M. S. , Chen , L.H. , Liu,Y.P. , Chen , Y.P. , Li,W .C. , Lee, F. ,
Ting,L .J. and Lin , Y.L.
Avian influenza subtype HS in geese in Taiwan, 2015 Unpublished
2 (bases 1 to 1454)
Lee,M .S. , Chen,L.H. , Liu,Y. P. , Chen, Y.P. , Li,W .C. , Lee, F. ,
Ting,L.J. and Lin , Y .L. Direct Submission
Submitted (10-FEB-2015) Epidemiology Research Department, National Institute for Animal Health, Chung- Cheng Rd, Tansui, Taiwan 251 , Taiwan
##Assembly-Data-START##
Sequencing Technology : : Sanger dideoxy sequencing
##Assembly-Data- END##
Location/Qualifiers 1 . .1454
/organism= "Viruses; ssRNA negative-strand viruses ; Orthomyxoviridae; Influenzavirus A. "
/mol type= "mRNA "
/strain= "A/Goose/Taiwan/01042/2015(H5N3) "
/host= "Goose "
/segment= " 6 "
/country= "Taiwan "
/collection_date= "2015-01-12 "
/identified by= "RT-PCR"
/subtype= "HSN3 " 1 . .1454
/gene= "NA " 21 ..1430
/gene= "NA"
/codon_start=l
/product="neuraminidase"
/translation= "MNPNQKIITIGVVNTTLSTIALLIGIGNLIFNTVIHEKIGDHQT VVYPTITAPVVPNCSDTTITYNNTVVHNITTTIITEAEKHFKSSLPLCPFRGFFPFHK DNAIRLGENKDVIVTREPYVSCDNDNCWSFALAQGALLGTKHSNGTIKDRTPYRSLIR FPIGTAPVLGNYKEICVAWSSSSCFDGKEWMHVCMTGNDNDASGQIIYAGKMTDSIKS WRKDILRTQESECQXIDGTCVVAVTDGPAANSADHRIYWIREGKVMKYENIPKTKIQH LEECSCYVDIDVYCICRDNWKGSNRPWMRINNETILETGYVCSKFHSDTPRPADPSTV SCDSPSNVNGGPGVKGFGFKTGDDVWLGRTVSTGGRSGFEIIKVTEGWINSPNHAKSV TQTLVSNNDWSGYSGSFIVENNGCFQPCFYIELIRGRPNKNDDVSWTSNSIVTFCGLD NEPGSGNWPDGSNIGFMPK "
475 a 293 c 336 g 349 t 1 others

1 agcaaaagca ggagtttaaa atgaatccaa atcagaagat aataacaatt ggtgtagtga
61 atactactct atcaacaata gcccttctta ttggaattgg gaatctgatc ttcaacactg





















I I
LOCUS

121
181
241
301
361
421
481
541
601
661
721
781
841
901
961
1021
1081
1141
1201
1261
1321
1381
1441

tcatacatga gaaaataggg gaccaccaaa ctgtggtata tccaacaata acagccccag
tggtaccaaa ctgcagtgac accacaatca catacaacaa cactgtggta cataacataa caacgacaat aataaccgaa gcggaaaagc atttcaaatc ctcactgccg ctatgcccct tccgaggttt cttccccttt cacaaggaca atgcaatacg attgggtgag aacaaagacg taatagtcac aagggagccc tatgtcagtt gtgacaatga taattgctgg tcttttgccc tcgctcaagg ggctctactg gggactaaac acagcaatgg aaccatcaag gacaggacgc catatagatc gctgatccgg ttcccaatag gaacagctcc agtactgggc aattacaaag agatatgtgt tgcctggtca agtagcagtt gcttcgatgg aaaggaatgg atgcatgttt gcatgactgg gaacgacaat gatgcgagtg gccaaataat atatgcaggg aaaatgacag actccattaa atcatggaga aaggatatac taagaactca agagtctgaa tgtcaaygca ttgacgggac ctgtgttgta gctgtaacag atggtcctgc ggctaatagt gcagaccacc ggatttactg gatacgagaa ggtaaggtaa tgaagtatga aaacattcct aaaacaaaga tacagcattt agaagaatgt tcttgttatg tggacatcga tgtgtactgc atatgtaggg acaattggaa aggttctaat aggccctgga tgaggatcaa caatgagacc atactagaaa cagggtacgt atgtagcaaa ttccactcag atacccccag gccagccgat ccttcgacag tatcgtgtga ttccccaagt aatgttaatg gaggacctgg agtcaaaggg tttggcttca aaactggtga tgatgtatgg ctgggaagga ctgtatcaac cggtggaagg tcaggctttg aaatcatcaa agtcacagag gggtggatca attcccccaa tcatgccaaa tcagttacac aaacattagt gtcaaacaat gattggtcag gttactcagg gagcttcatt gttgagaaca atggctgctt tcagccctgc ttctatattg aacttatacg gggaaggccc aataagaacg atgacgtttc ttggacaagc aacagtatag ttactttctg tggactagac aatgaacctg gatcgggaaa ttggcctgat ggttccaaca ttgggtttat gcccaagtaa cagaaaaaaa cccttgtatc tact

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Wed Feb 11, 2015 1:13 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
EPI406332 A/duck/Hokkaido/157/2012 (A/H11N3) segment 6 (NA) 2484.9 0.000000e+00 1388/1410 (98%)
EPI259431 A/duck/Hokkaido/327/2009 (A/H1N3) segment 6 (NA) 2440.5 0.000000e+00 1380/1410 (97%)
EPI545253 A/green winged teal/Japan/9KS0643/2009 (A/H12N3) segment 6 (NA) 2429.5 0.000000e+00 1378/1410 (97%)
EPI181914 A/duck/Niigata/514/2006 (A/H5N3) segment 6 (NA) 2407.3 0.000000e+00 1374/1410 (97%)
EPI276138 A/pintail/Aomori/1130/2008 (A/H1N3) segment 6 (NA) 2396.2 0.000000e+00 1372/1410 (97%)
EPI408361 A/duck/Korea/BC10/2007 (A/H7N3) segment 6 (NA) 2390.7 0.000000e+00 1371/1410 (97%)
EPI341944 A/duck/Nanjing/19/2010 (A/H1N3) segment 6 (NA) 2385.1 0.000000e+00 1371/1411 (97%)
EPI341937 A/duck/Nanjing/20/2010 (A/H1N3) segment 6 (NA) 2385.1 0.000000e+00 1371/1411 (97%)
EPI392622 A/wild bird/Korea/A4/11 (A/H7N3) segment 6 (NA) 2372.2 0.000000e+00 1351/1385 (97%)
EPI160656 A/duck/Hokkaido/167/2007 (A/H5N3) segment 6 (NA) 2368.5 0.000000e+00 1367/1410 (96%)
EPI485340 A/ruddy shelduck/Mongolia/894V/2009 (A/H4N3) segment 6 (NA) 2364.8 0.000000e+00 1341/1372 (97%)
EPI220656 A/northern pintail/Aomori/385/2008 (A/H5N3) segment 6 (NA) 2363.0 0.000000e+00 1366/1410 (96%)
EPI504025 A/wild duck/SH17-34/2008 (A/H2N3) segment 6 (NA) 2329.7 0.000000e+00 1360/1410 (96%)
EPI161531 A/duck/Mongolia/274/2007 (A/H4N3) segment 6 (NA) 2329.7 0.000000e+00 1361/1411 (96%)
EPI503992 A/wild duck/SH17-1/2008 (A/H2N3) segment 6 (NA) 2324.2 0.000000e+00 1359/1410 (96%)
EPI296210 A/wild duck/Korea/SH29/2006 (A/H1N3) segment 6 (NA) 2315.0 0.000000e+00 1320/1354 (97%)
EPI296212 A/wild duck/Korea/SH14/2006 (A/H1N3) segment 6 (NA) 2309.4 0.000000e+00 1319/1354 (97%)
EPI296211 A/wild duck/Korea/PJ25/2006 (A/H1N3) segment 6 (NA) 2303.9 0.000000e+00 1318/1354 (97%)
EPI377791 A/mallard/Sweden/57/2002 (A/H2N3) segment 6 (NA) 2302.0 0.000000e+00 1355/1410 (96%)
EPI377674 A/mallard/Sweden/99/2002 (A/H2N3) segment 6 (NA) 2302.0 0.000000e+00 1355/1410 (96%)
EPI508003 A/Northern shoveler/Korea/SD175/2008 (A/H7N3) segment 6 (NA) 2298.4 0.000000e+00 1325/1366 (96%)
EPI377847 A/mallard/Sweden/53/2003 (A/H2N3) segment 6 (NA) 2279.9 0.000000e+00 1351/1410 (95%)
EPI118090 A/mallard/Italy/208/2000 (A/H5N3) segment 6 (NA) 2268.8 0.000000e+00 1347/1407 (95%)
EPI21402 A/mallard/Italy/208/2000 (A/H5N3) segment 6 (NA) 2268.8 0.000000e+00 1347/1407 (95%)
EPI377658 A/mallard/Sweden/6/2002 (A/H2N3) segment 6 (NA) 2263.3 0.000000e+00 1348/1410 (95%)
EPI251771 A/mallard/Sweden/6/2002 (A/H2N3) segment 6 (NA) 2263.3 0.000000e+00 1348/1410 (95%)
EPI507993 A/bean goose/Korea/SH20-17/2008 (A/H7N3) segment 6 (NA) 2255.9 0.000000e+00 1320/1370 (96%)
EPI485315 A/mallard/Mongolia/651/2010 (A/H2N3) segment 6 (NA) 2252.2 0.000000e+00 1299/1339 (97%)
EPI262639 A/aquatic bird/Korea/w209/2007 (A/H5N3) segment 6 (NA) 2252.2 0.000000e+00 1349/1413 (95%)
EPI21400 A/mallard/Italy/36/1999 (A/H2N3) segment 6 (NA) 2252.2 0.000000e+00 1344/1407 (95%)
EPI296206 A/duck/Korea/U14/2007 (A/H1N3) segment 6 (NA) 2243.0 0.000000e+00 1308/1355 (96%)
EPI514845 A/mallard/Sweden/1883/2003 (A/H4N3) segment 6 (NA) 2235.6 0.000000e+00 1343/1410 (95%)
EPI182396 A/duck/Altai/1285/1991 (A/H5N3) segment 6 (NA) 2235.6 0.000000e+00 1344/1411 (95%)
EPI372449 A/shoveler/Egypt/00017-NAMRU3/2007 (A/H7N3) segment 6 (NA) 2226.3 0.000000e+00 1342/1411 (95%)
EPI68166 A/duck/Italy/775/2004 (A/H5N3) segment 6 (NA) 2224.5 0.000000e+00 1341/1410 (95%)
EPI21398 A/mallard/Italy/35/1999 (A/H2N3) segment 6 (NA) 2224.5 0.000000e+00 1340/1408 (95%)
EPI377896 A/mallard/Sweden/73/2005 (A/H2N3) segment 6 (NA) 2213.4 0.000000e+00 1339/1410 (94%)
EPI272791 A/mallard/PT/4228/2007 (A/H5N3) segment 6 (NA) 2213.4 0.000000e+00 1339/1410 (94%)
EPI227121 A/duck/France/05054a/2005 (A/H5N3) segment 6 (NA) 2207.9 0.000000e+00 1338/1410 (94%)
EPI174874 A/mallard/Denmark/77-64849-G2/2005 (A/H1N3) segment 6 (NA) 2200.5 0.000000e+00 1326/1394 (95%)
EPI262638 A/aquatic bird/Korea/w16/2005 (A/H5N3) segment 6 (NA) 2196.8 0.000000e+00 1337/1411 (94%)
EPI89973 A/mallard/Netherlands/12/00 (A/H7N3) segment 6 (NA) 2193.1 0.000000e+00 1336/1411 (94%)
EPI238139 A/mallard/Netherlands/12/2000 (A/H7N3) segment 6 (NA) 2191.2 0.000000e+00 1336/1411 (94%)
EPI378004 A/mallard/Netherlands/29/2010 (A/H2N3) segment 6 (NA) 2185.7 0.000000e+00 1334/1410 (94%)
EPI377799 A/mallard/Sweden/70/2002 (A/H2N3) segment 6 (NA) 2185.7 0.000000e+00 1335/1411 (94%)
EPI182059 A/mallard/Sweden/65/2005 (A/H4N3) segment 6 (NA) 2185.7 0.000000e+00 1334/1410 (94%)
EPI141374 A/Perdix perdix/Germany/R44/06 (A/H8N3) segment 6 (NA) 2185.7 0.000000e+00 1334/1410 (94%)
EPI13873 A/teal/France/2546/2001 (A/H1N3) segment 6 (NA) 2185.7 0.000000e+00 1335/1411 (94%)
EPI485556 A/mallard/Sweden/46/2002 (A/H4N3) segment 6 (NA) 2180.2 0.000000e+00 1335/1412 (94%)
EPI398730 A/mallard/Portugal/99013/2009 (A/H11) segment 6 (NA) 2180.2 0.000000e+00 1331/1410 (94%)
EPI251690 A/mallard/Sweden/25/2002 (A/H11N3) segment 6 (NA) 2180.2 0.000000e+00 1334/1411 (94%)
EPI513365 A/mallard/Sweden/101900/2009 (A/H4N3) segment 6 (NA) 2174.6 0.000000e+00 1332/1410 (94%)
EPI378012 A/mallard/Netherlands/12/2008 (A/H2N3) segment 6 (NA) 2174.6 0.000000e+00 1332/1410 (94%)
EPI21406 A/mallard/Italy/43/2001 (A/H7N3) segment 6 (NA) 2174.6 0.000000e+00 1330/1407 (94%)
EPI21404 A/mallard/Italy/33/01 (A/H7N3) segment 6 (NA) 2174.6 0.000000e+00 1330/1407 (94%)
EPI462883 A/environment/Guangdong/2/2009 (A/H2N3) segment 6 (NA) 2172.8 0.000000e+00 1285/1340 (95%)
EPI378020 A/mallard/Netherlands/1/2010 (A/H2N3) segment 6 (NA) 2169.1 0.000000e+00 1332/1411 (94%)
EPI377996 A/common teal/Netherlands/2/2008 (A/H2N3) segment 6 (NA) 2169.1 0.000000e+00 1331/1410 (94%)
EPI377980 A/mallard/Netherlands/37/2008 (A/H2N3) segment 6 (NA) 2169.1 0.000000e+00 1331/1410 (94%)
EPI230041 A/whooper swan/Mongolia/232/2005 (A/H12N3) segment 6 (NA) 2169.1 0.000000e+00 1332/1411 (94%)
EPI230031 A/ruddy shelduck/Mongolia/P52/2005 (A/H12N3) segment 6 (NA) 2169.1 0.000000e+00 1332/1411 (94%)
EPI229929 A/bar headed goose/Mongolia/143/2005 (A/H12N3) segment 6 (NA) 2169.1 0.000000e+00 1332/1411 (94%)
EPI181641 A/duck/Tsukuba/394/2005 (A/H5N3) segment 6 (NA) 2169.1 0.000000e+00 1332/1411 (94%)
EPI63244 A/teal/Italy/3812/2005 (A/H5N3) segment 6 (NA) 2169.1 0.000000e+00 1331/1410 (94%)
EPI13871 A/mallard/France/2518/2001 (A/H9N3) segment 6 (NA) 2169.1 0.000000e+00 1331/1410 (94%)
EPI507987 A/wild bird feces/Korea/SH21/2006 (A/H7N3) segment 6 (NA) 2167.2 0.000000e+00 1313/1383 (94%)
EPI377936 A/mallard/Sweden/5/2005 (A/H2N3) segment 6 (NA) 2163.5 0.000000e+00 1331/1411 (94%)
EPI230023 A/ruddy shelduck/Mongolia/37/2005 (A/H12N3) segment 6 (NA) 2163.5 0.000000e+00 1331/1411 (94%)
EPI182404 A/duck/Primorie/2633/01 (A/H5N3) segment 6 (NA) 2163.5 0.000000e+00 1330/1410 (94%)
EPI377807 A/northern pintail/Sweden/1/2003 (A/H2N3) segment 6 (NA) 2158.0 0.000000e+00 1330/1411 (94%)
EPI377554 A/mallard/Sweden/6/2003 (A/H2N3) segment 6 (NA) 2158.0 0.000000e+00 1330/1411 (94%)
EPI251838 A/northern pintail/Sweden/1/2003 (A/H2N3) segment 6 (NA) 2158.0 0.000000e+00 1330/1411 (94%)
EPI251613 A/common teal/Sweden/1/2003 (A/H3N3) segment 6 (NA) 2158.0 0.000000e+00 1311/1383 (94%)
EPI229975 A/duck/France/06436/2006 (A/H5N3) segment 6 (NA) 2158.0 0.000000e+00 1330/1411 (94%)
EPI169304 A/duck/France/06436/2006 (A/H5N3) segment 6 (NA) 2158.0 0.000000e+00 1330/1411 (94%)
EPI125299 A/mallard/Italy/199/01 (A/H7N3) segment 6 (NA) 2156.2 0.000000e+00 1322/1400 (94%)
EPI377988 A/mallard/Netherlands/58/2008 (A/H2N3) segment 6 (NA) 2152.5 0.000000e+00 1328/1410 (94%)
EPI377823 A/mallard/Sweden/81/2003 (A/H2N3) segment 6 (NA) 2152.5 0.000000e+00 1329/1411 (94%)
EPI377815 A/mallard/Sweden/12/2003 (A/H2N3) segment 6 (NA) 2152.5 0.000000e+00 1329/1411 (94%)
EPI3245 A/duck/Hokkaido/84/2002 (A/H5N3) segment 6 (NA) 2152.5 0.000000e+00 1329/1411 (94%)
EPI3239 A/duck/Hokkaido/17/2001 (A/H2N3) segment 6 (NA) 2152.5 0.000000e+00 1329/1411 (94%)
EPI272802 A/tufted duck/PT/13771/2006 (A/H7N3) segment 6 (NA) 2150.6 0.000000e+00 1328/1410 (94%)
EPI377830 A/mallard/Sweden/84/2003 (A/H2N3) segment 6 (NA) 2146.9 0.000000e+00 1328/1411 (94%)
EPI89006 A/Bantam/Nanchang/9-366/2000 (A/H3N3) segment 6 (NA) 2146.9 0.000000e+00 1329/1412 (94%)
EPI16382 A/Pigeon/Nanchang/9-058/2000 (A/H3N3) segment 6 (NA) 2146.9 0.000000e+00 1329/1412 (94%)
EPI16380 A/Bantam/Nanchang/9-366/2000 (A/H3N3) segment 6 (NA) 2141.4 0.000000e+00 1328/1412 (94%)
EPI181653 A/duck/Shimane/83/2006 (A/H7N3) segment 6 (NA) 2135.8 0.000000e+00 1326/1411 (93%)
EPI181642 A/duck/Shizuoka/40/2002 (A/H5N3) segment 6 (NA) 2135.8 0.000000e+00 1325/1410 (93%)
EPI174827 A/duck/Denmark/74-68425/2002 (A/H1N3) segment 6 (NA) 2135.8 0.000000e+00 1325/1410 (93%)
EPI485333 A/ruddy shelduck/Mongolia/686C2/2008 (A/H2N3) segment 6 (NA) 2132.2 0.000000e+00 1283/1348 (95%)
EPI377569 A/mallard/Sweden/88/2005 (A/H0) segment 6 (NA) 2130.3 0.000000e+00 1324/1410 (93%)
EPI377560 A/mallard/Sweden/58/2005 (A/H0) segment 6 (NA) 2130.3 0.000000e+00 1324/1410 (93%)
EPI235863 A/duck/France/02166/2002 (A/H0) segment 6 (NA) 2130.3 0.000000e+00 1325/1411 (93%)
EPI229999 A/mallard/France/061054/2006 (A/H5N3) segment 6 (NA) 2130.3 0.000000e+00 1324/1410 (93%)
EPI182035 A/mallard/Sweden/45/2005 (A/H2N3) segment 6 (NA) 2130.3 0.000000e+00 1324/1410 (93%)
EPI169276 A/duck/France/061054/2006 (A/H5N3) segment 6 (NA) 2130.3 0.000000e+00 1324/1410 (93%)
EPI377928 A/mallard/Sweden/107/2005 (A/H2N3) segment 6 (NA) 2124.8 0.000000e+00 1323/1410 (93%)
EPI377912 A/mallard/Sweden/93/2005 (A/H2N3) segment 6 (NA) 2124.8 0.000000e+00 1323/1410 (93%)
EPI377879 A/mallard/Sweden/60/2005 (A/H0) segment 6 (NA) 2124.8 0.000000e+00 1323/1410 (93%)
EPI377871 A/mallard/Sweden/51/2005 (A/H2N3) segment 6 (NA) 2124.8 0.000000e+00 1323/1410 (93%)

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Wed Feb 11, 2015 1:15 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
7 1027 bp mRNA linear 10-FEB-2015

DEFINITION

ACCESSION VERSION KEYWORDS SOURCE

ORGANISM


REFERENCE

Influenza A virus (A/Goose/Taiwan/01042/2015(H5N3)) matrix protein
2 (M2) and mat rix protein 1 (Ml) genes , complete eds.



Viruses; ssRNA negative-strand viruses; Orthomyxovir idae; Influenzavirus A.
Viruses ; ssRNA negative-strand viruses ; Orthomyxoviridae ; Influenzavirus A.
Unclassified.
1 (bases 1 to 1027)

AUTHORS Lee,M.S. , Chen,L.H. , Liu, Y .P. , Chen,Y .P. , Li,W .C., Lee, F. ,
Ting,L .J . and Lin , Y .L.
TITLE Avian influenza subtype HS in geese in Taiwan , 2015 JOURNAL Unpublished
REFERENCE 2 (bases 1 to 1027)
AUTHORS Lee,M. S., Chen,L.H . , Liu , Y.P. , Chen , Y .P. , Li,W.C. , Lee, F .,
Ting , L.J. and Lin , Y.L. TITLE Direct Submission
JOURNAL Subm itted (10-FEB-2015) Epidemiology Research Department, National Institute for Animal Health , Chung-Cheng Rd , Tansui, Taiwan 251, Taiwan
COMMENT ##Assembly-Data-START##
Sequencing Technology : : Sanger dideoxy sequencing
##Assembly-Data- END##
FEATURES Location/Qualifiers source 1 ..1027
/organism= "Viruses; ssRNA negative-strand viruses ; Orthomyxoviridae; Influenzavirus A. "
/mol type= "mRNA "
/strain= "A/Goose/Taiwan/01042/2015(H5N3) "
/host= "Goose "
/segment="7 "
/country= "Taiwan"
/collection_date= " 2015-01-12 "
/identified_by="RT-PCR "
/subtype= "H5N3"

gene CDS




gene CDS

26 . .1007
/gene= "M2 "
join(26 ..51,740 . .1007)
/gene= "M2"
/codon_start=l
/product= "matrix protein 2 "
/translation= "MSLLTEVETPTRTEWECRCSDSSDPLVVAANIIGILHLILWILD RLFFKCIYRRLKYGLKIGPSTEGVPESMREEYRQEQQSAVDVDDGHFVNIELE"
26 . .784
/gene= "Ml" 26 . .784
/gene="Ml"








BASE COUNT ORIGIN

/codon_start=l
/product= "matrix protein 1"
/translation = "MSLLTEVETYVLSIIPSGPLKAEIAQRLEDVFAGKNTDLEALME WLKTRPILSPLTKGILGFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDKAVKLYKK LKREITFHGAKEVALSYSTGALASCMGLIYNRMGTVTTEVAFGLVCATCEQIADSQHR SHRQMATITNPLIRHENRMVLASTTAKAMEQMAGSSEQASEAMEVANQARQMVQAMRT IGTHPNSSAGLRDNLLENLQAYQNRMGVQMQRFK"
292 a 221 c 271 g 243 t

1
61
121
181
241
301
361
421
481
541

agcaaaagca ggtagatgtt gaaagatgag tcttctaacc gaggtcgaaa cgtacgttct ctctatcatc ccgtcaggcc ccctcaaagc cgagatcgcg cagagacttg aagatgtctt tgcagggaaa aacaccgatc tcgaggctct catggagtgg ctaaagacaa gaccaatcct gtcacctctg actaaaggga ttttgggatt tgtgttcacg ctcaccgtgc ccagtgagcg aggactgcag cgtagacgct tcgtccagaa tgccctaaat ggaaatgggg atccaaataa tatggataag gcagttaagc tatataagaa gctgaaaaga gagataacgt tccatggggc taaggaggtc gcacttagct actcaaccgg tgcacttgcc agctgcatgg gtctcatata caacaggatg ggaacggtga ctacagaagt ggcttttggc ctagtgtgtg ccacttgtga gcagattgca gattcacagc atcggtccca cagacagatg gcaaccatca ccaacccatt aatcagacat gagaacagaa tggtgctggc cagcactaca gctaaggcca tggagcagat

601 ggcaggatca agcgagcagg catcagaagc catggaggtt gctaatcagg ccaggcagat 661 ggtacaggca atgaggacaa ttgggactca tcctaattct agtgctggtc tgagagataa






I I
LOCUS

721
781
841
901
961
1021

tcttcttgaa aatttgcagg cctaccagaa ccgaatggga gtgcagatgc agcgattcaa gtgatcctct tgttgttgcc gcaaatatca ttgggatcct gcacttgata ttgtggatcc ttgatcgtct tttcttcaaa tgcatttatc gtcgccttaa atacggtttg aaaatagggc cttctacgga aggggtacct gagtctatga gggaagagta ccggcaggaa cagcagagtg ctgtggatgt tgacgatggt cattttgtca acatagaatt ggagtaaaaa actaccttgt ttctact

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Wed Feb 11, 2015 1:17 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
EPI561700 A/spot-billed duck/Korea/H455-42/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI561693 A/common teal/Korea/H455-30/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI561684 A/tundra swan/Korea/H411/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI561677 A/bean goose/Korea/H328/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI561670 A/mallard/Korea/H297/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI561656 A/breeder chicken/Korea/H250/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI561649 A/breeder duck/Korea/H249/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI561636 A/white-fronted goose/Korea/H231/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI561629 A/mallard/Korea/H207/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI561622 A/breeder duck/Korea/H200/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI561601 A/broiler duck/Korea/H133/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI561594 A/breeder duck/Korea/H128/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI561580 A/breeder chicken/Korea/H122/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI561573 A/Baikal teal/Korea/H96/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI561566 A/Baikal teal/Korea/H84/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI561559 A/Coot/Korea/H81/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI561552 A/Baikal teal/Korea/H80/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI561532 A/Baikal teal/Korea/H66/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI561525 A/broiler duck/Korea/H65/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI561511 A/bean goose/Korea/H53/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI561351 A/broiler duck/Korea/H47/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI561344 A/Baikal teal/Korea/H41/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI561211 A/broiler duck/Korea/H31/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI561199 A/broiler duck/Korea/H29/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI561190 A/waterfowl/Korea/S005/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI553211 A/crane/Kagoshima/KU1/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI542633 A/mallard/Korea/W452/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI517164 A/Chicken/Kumamoto/1-7/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI509756 A/baikal teal/Korea/Donglim3/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI509711 A/broiler duck/Korea/Buan2/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI561708 A/bean goose/Korea/H40/2014 (A/H5N8) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI561663 A/Korean native chicken/Korea/H257/2014 (A/H5N8) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI561615 A/breeder duck/Korea/H158/2014 (A/H5N8) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI561608 A/broiler duck/Korea/H145/2014 (A/H5N8) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI561545 A/Baikal teal/Korea/H68/2014 (A/H5N8) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI561518 A/Baikal teal/Korea/H62/2014 (A/H5N8) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI561363 A/broiler duck/Korea/H49/2014 (A/H5N8) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI561356 A/broiler duck/Korea/H48/2014 (A/H5N8) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI554603 A/turkey/Germany-NI/R3372/2014 (A/H5N8) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI553346 A/chicken/Miyazaki/7/2014 (A/H5N8) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI552749 A/turkey/Germany/R2474-L00899/2014 (A/H5N8) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI548627 A/chicken/Netherlands/14015531/2014 (A/H5N8) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI547684 A/Chicken/Netherlands/14015526/2014 (A/H5N8) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI558012 A/duck/England/36038/14 (A/H5N8) segment 7 (MP) 1792.4 0.000000e+00 978/982 (99%)
EPI558005 A/duck/England/36226/14 (A/H5N8) segment 7 (MP) 1792.4 0.000000e+00 978/982 (99%)
EPI553365 A/environment/Kagoshima/KU-ngr-H/2014 (A/H5N8) segment 7 (MP) 1792.4 0.000000e+00 978/982 (99%)
EPI548496 A/duck/Chiba/26-372-61/2014 (A/H5N8) segment 7 (MP) 1792.4 0.000000e+00 978/982 (99%)
EPI548488 A/duck/Chiba/26-372-48/2014 (A/H5N8) segment 7 (MP) 1792.4 0.000000e+00 978/982 (99%)
EPI547676 A/duck/England/36254/14 (A/H5N8) segment 7 (MP) 1792.4 0.000000e+00 978/982 (99%)
EPI555124 A/domestic duck/Germany-NI/R3468/2014 (A/H5N8) segment 7 (MP) 1790.5 0.000000e+00 975/978 (99%)
EPI553181 A/turkey/Italy/14VIR7898-10/2014 (A/H5N8) segment 7 (MP) 1790.5 0.000000e+00 975/978 (99%)
EPI548426 A/turkey/Germany-MV/R2472/2014 (A/H5N8) segment 7 (MP) 1790.5 0.000000e+00 975/978 (99%)
EPI542997 A/duck/Beijing/FS01/2013 (A/H5N8) segment 7 (MP) 1786.8 0.000000e+00 975/979 (99%)
EPI543005 A/duck/Beijing/FS01/2014 (A/H5N8) segment 7 (MP) 1781.3 0.000000e+00 974/979 (99%)
EPI431451 A/duck/Hebei/2/2011 (A/H5N2) segment 7 (MP) 1759.1 0.000000e+00 972/982 (98%)
EPI414241 A/duck/Jiangsu/1-15/2011 (A/H4N2) segment 7 (MP) 1753.6 0.000000e+00 971/982 (98%)
EPI398977 A/duck/Eastern China/1111/2011 (A/H5N2) segment 7 (MP) 1753.6 0.000000e+00 971/982 (98%)
EPI552763 A/eurasian wigeon/Netherlands/emc-1/2014 (A/H5N8) segment 7 (MP) 1711.1 0.000000e+00 946/955 (99%)
EPI475582 A/wild duck/Shandong/628/2011 (A/H5N1) segment 7 (MP) 1709.3 0.000000e+00 963/982 (98%)
EPI399963 A/duck/Jiangsu/m234/2012 (A/H5N2) segment 7 (MP) 1703.7 0.000000e+00 962/982 (97%)
EPI328891 A/duck/Eastern China/909/2009 (A/H5N1) segment 7 (MP) 1703.7 0.000000e+00 962/982 (97%)
EPI328875 A/duck/Eastern China/031/2009 (A/H5N5) segment 7 (MP) 1703.7 0.000000e+00 962/982 (97%)
EPI328867 A/duck/Eastern China/008/2008 (A/H5N5) segment 7 (MP) 1703.7 0.000000e+00 962/982 (97%)
EPI328883 A/duck/Eastern China/108/2008 (A/H5N1) segment 7 (MP) 1698.2 0.000000e+00 961/982 (97%)
EPI442028 A/quail/Jiangsu/k0104/2010 (A/H5N5) segment 7 (MP) 1692.7 0.000000e+00 960/982 (97%)
EPI398978 A/goose/Eastern China/1112/2011 (A/H5N2) segment 7 (MP) 1692.7 0.000000e+00 960/982 (97%)
EPI442004 A/goose/Shandong/k1204/2009 (A/H5N5) segment 7 (MP) 1681.6 0.000000e+00 959/983 (97%)
EPI431459 A/duck/Hebei/3/2011 (A/H5N2) segment 7 (MP) 1676.0 0.000000e+00 957/982 (97%)
EPI552779 A/chicken/Netherlands/emc-3/2014 (A/H5N8) segment 7 (MP) 1672.3 0.000000e+00 911/914 (99%)
EPI442020 A/duck/Jiangsu/k1203/2010 (A/H5N8) segment 7 (MP) 1670.5 0.000000e+00 956/982 (97%)
EPI493836 A/duck/Guangdong/wy24/2008 (A/H5N5) segment 7 (MP) 1665.0 0.000000e+00 955/982 (97%)
EPI493820 A/duck/Guangdong/wy11/2008 (A/H5N5) segment 7 (MP) 1665.0 0.000000e+00 955/982 (97%)
EPI442012 A/goose/Guangdong/k0103/2010 (A/H5N5) segment 7 (MP) 1665.0 0.000000e+00 957/984 (97%)
EPI280107 A/Shanghai/1/2006 (A/H5N1) segment 7 (MP) 1665.0 0.000000e+00 955/982 (97%)
EPI280099 A/Guangdong/1/2006 (A/H5N1) segment 7 (MP) 1665.0 0.000000e+00 955/982 (97%)
EPI227312 A/Mallard/Huadong/lk/2005 (A/H5N1) segment 7 (MP) 1665.0 0.000000e+00 955/982 (97%)
EPI164233 A/Sichuan/2/2006 (A/H5N1) segment 7 (MP) 1665.0 0.000000e+00 955/982 (97%)
EPI164225 A/Sichuan/1/2006 (A/H5N1) segment 7 (MP) 1665.0 0.000000e+00 955/982 (97%)
EPI111857 A/chicken/Guiyang/3923/2005 (A/H5N1) segment 7 (MP) 1665.0 0.000000e+00 955/982 (97%)
EPI106032 A/China/GD01/2006 (A/H5N1) segment 7 (MP) 1665.0 0.000000e+00 955/982 (97%)
EPI552771 A/eurasian wigeon/Netherlands/emc-2/2014 (A/H5N8) segment 7 (MP) 1661.3 0.000000e+00 907/911 (99%)
EPI493828 A/duck/Guangdong/wy19/2008 (A/H5N5) segment 7 (MP) 1659.4 0.000000e+00 955/983 (97%)
EPI399889 A/duck/HuBei/03/2010 (A/H5N5) segment 7 (MP) 1659.4 0.000000e+00 954/982 (97%)
EPI276073 A/shrike/Tibet/13/2006 (A/H5N1) segment 7 (MP) 1659.4 0.000000e+00 954/982 (97%)
EPI275985 A/duck/Hubei/49/2005 (A/H5N1) segment 7 (MP) 1659.4 0.000000e+00 954/982 (97%)
EPI275389 A/Anhui/2/2005 (A/H5N1) segment 7 (MP) 1659.4 0.000000e+00 954/982 (97%)
EPI251445 A/Anhui/1/2006 (A/H5N1) segment 7 (MP) 1659.4 0.000000e+00 954/982 (97%)
EPI251423 A/Sichuan/3/2006 (A/H5N1) segment 7 (MP) 1659.4 0.000000e+00 954/982 (97%)
EPI251419 A/Zhejiang/1/2006 (A/H5N1) segment 7 (MP) 1659.4 0.000000e+00 954/982 (97%)
EPI224780 A/Shanghai/1/2006 (A/H5N1) segment 7 (MP) 1659.4 0.000000e+00 954/982 (97%)
EPI167956 A/long-tailed shrike/Hong Kong/2762/2007 (A/H5N1) segment 7 (MP) 1659.4 0.000000e+00 954/982 (97%)
EPI164241 A/Anhui/2/2005 (A/H5N1) segment 7 (MP) 1659.4 0.000000e+00 954/982 (97%)
EPI164217 A/Anhui/1/2005 (A/H5N1) segment 7 (MP) 1659.4 0.000000e+00 954/982 (97%)
EPI127390 A/wild duck/Hunan/021/2005 (A/H5N1) segment 7 (MP) 1659.4 0.000000e+00 954/982 (97%)
EPI111872 A/duck/Guiyang/1558/2006 (A/H5N1) segment 7 (MP) 1659.4 0.000000e+00 954/982 (97%)
EPI111860 A/goose/Guiyang/4030/2005 (A/H5N1) segment 7 (MP) 1659.4 0.000000e+00 954/982 (97%)
EPI111674 A/duck/Hunan/5472/2005 (A/H5N1) segment 7 (MP) 1659.4 0.000000e+00 954/982 (97%)
EPI111656 A/goose/Shantou/3265/2006 (A/H5N1) segment 7 (MP) 1659.4 0.000000e+00 954/982 (97%)
EPI111644 A/goose/Guiyang/538/2006 (A/H5N1) segment 7 (MP) 1659.4 0.000000e+00 954/982 (97%)
EPI111632 A/chicken/Guiyang/4059/2005 (A/H5N1) segment 7 (MP) 1659.4 0.000000e+00 954/982 (97%)

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Wed Feb 11, 2015 1:19 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
2341 bp mRNA linear 10-FEB-2015
DEFINITION Influenza A virus (A/Goose/Taiwan/01042/2015(H5N3)) polymerase PB2 (PB2) gene, complete eds .

ACCESSION VERSION KEYWORDS SOURCE

ORGANISM


REFERENCE AUTHORS

TITLE JOURNAL
REFERENCE AUTHORS

TITLE JOURNAL
COMMENT FEATURES
source










gene CDS




Viruses; ssRNA negative-strand viruses; Orthomyxoviridae ; Influenzavirus A.
Viruses ; ssRNA negative-strand viruses; Orthomyxoviridae; Influenzavirus A.
Unclassified.
1 (bases 1 to 2341)
Lee,M .S. , Chen,L .H. , Liu,Y.P . , Chen,Y.P. , Li,W. C. , Lee, F. ,
Ting,L.J. and Lin,Y.L .
Avian influenza subtype HS in geese in Taiwan, 2015 Unpublished
2 (bases 1 to 2341)
Lee,M.S. , Chen , L.H . , Liu,Y .P. , Chen,Y .P . , Li,W.C. , Lee, F .,
Ting,L .J. and Lin,Y .L . Direct Submission
Submitted (10-FEB-2015) Epidemiology Research Department, National Institute for Animal Health, Chung- Cheng Rd, Tansui, Taiwan 251, Taiwan
##Assembly-Data-START##
Sequencing Technology : : Sanger dideoxy sequencing
##Assembly-Data-END##
Location/Qualifiers
1. .2341
/organism= "Viruses; ssRNA negative-strand viruses; Orthomyxoviridae ; Influenzavirus A ."
/mol type= "mRNA "
/strain= "A/Goose/Taiwan/01042/2015(H5N3) "
/host="Goose"
/segment= " l"
/country= "Taiwan "
/collection date= " 2015- 01-12 "
/identified::::by= "RT- PCR"
/subtype= "H5N3 " 1 . .2341
/gene= "PB2 " 28 ..2307
/gene= "PB2 "
/codon_start=l
/product= "polymerase PB2 "
/translation= "MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPA LRMKWMMAMKYPITADKRIMEMIPERNEQGQTLWSKTNDAGSDRVMVSPLAVTWWNRN GPTTSTVHYPKVYKTYFEKVERLKHGTFGPVHFRNQVKIRRRVDINPGHADLSAKEAQ DVIMEVVFPNEVGARILTSESQLTITKEKKEELQDCKIAPLMVAYMLERELVRKTRFL PVAGGTSSVYIEVLHLTQGTCWEQMYTPGGEVRNDDVDQSLIIAARNIVRRATVSADP LASLLEMCHSTQIGGTRMVDILRQNPTEEQAVDICKAAMGLRISSSFSFGGFTFKRTS GSSVKREEEVLTGNLQTLKIRVHEGYEEFTMVGRRATAILRKATRRLIQLIVSGRDEQ SIAEAIIVAMVFSQEDCMIKAVRGDLNFVNRANQRLNPMHQLLRHFQKDAKVLFQNWG IEPIDNVMGMIGILPDMTPSTEMSLRGVRVSKMGVDEYSSTERVVVSIDRFLRVRDQR GNVLLSPEEVSETQGTEKLTITYSSSMMWEINGPESVLVNTYQWIIRNWETVKIQWSQ DPTMLYNKMEFEPFQSLVPKAARGQYSGFVRTLFQQMRDVLGTFDTVQIIKLLSFAAA PPEQSRMQFSSLTVNVRGSGMRILVRGNSPVFNYNKATKRLTVLGKDAGALTEDPDEG TAGVESAVLRGLLILGKEDKRYGPALSINELSNLAKGEKANVLIGQGDVVLVMKRKRD SSILTDSQTATKRIRMAIN "

BASE COUNT 762 a 434 c 625 g 520 t ORIGIN
1 agcgaaagca ggtcaattat attcaatatg gagagaataa aagaactaag agatttgatg
61 tcgcagtctc gcactcgcga gatactgaca aagaccactg tggaccatat ggccataatc
121 aagaaatata cgtcaggaag acaggagaag aatcctgcac ttaggatgaa atggatgatg
181 gcgatgaaat atccgattac agcagacaaa aggataatgg aaatgattcc cgaaagaaac
241 gagcaaggtc agactctttg gagcaaaaca aatgatgctg gatcagacag agtgatggtg
301 tcacctctgg ctgtgacatg gtggaataga aatggaccga caacaagtac agtccattat
361 ccaaaggtct ataaaaccta ctttgaaaaa gttgaaaggt taaagcatgg aaccttcggc
421 cctgtccatt ttcgaaatca ggttaagata cgccgcaggg ttgacataaa cccaggccat
481 gcagatctca gtgctaaaga agcacaagac gtcatcatgg aggtcgtttt cccaaacgaa
541 gtcggagcca_ ggatattgac atcggagtca cagttaacta taacaaaaga aaagaaggaa 601 gagcttcagg actgtaagat tgccccttta atggtggcat acatgttgga aagagaactg 661 gttcgcaaa ccagattcct gccagtagct ggcgggacaa gcagcgtgta tatcgaggtg 721 ttgca tga•cccaagggac ctgctgggaa caaatgtaca cgccaggagg agaagtgaga 781 aatgatgacg ttgatcagag tttgattatt gctgctagga atatcgttag gagagcaaca 841 gtatcacag _ atccattggc ttcgctcctg gagatgtgcc atagtacaca aattggcggg 901 acaagaatgg tagacatcct tagacaaaac ccaacagaag agcaagccgt ggatatatgt

961 aaagcagcaa tgggtctaag aatcagttca tccttcagct ttggaggttt cactttcaaa 1021 aggacaagtg ggtcatctgt caaaagagaa gaggaagtgc ttaccggcaa cctccaaaca 1081 ttgaaaataa gggtgcatga agggtatgag gaattcacaa tggttgggcg aagagcaaca 1141 gccattctaa ggaaagcaac cagaagattg atccaattga tagtgagtgg aagagacgag 1201 cagtcaatcg ccgaagcgat catagtggca atggtgttct cccaagagga ttgcatgata 1261 aaagcagtac ggggtgattt gaatttcgtc aatagagcga atcagcggct caatcctatg 1321 catcaactct tgaggcattt ccagaaggat gcaaaggtac tgttccaaaa ctggggaatt 1381 gaacccattg acaatgtcat ggggatgata ggaatattgc ctgacatgac acccagcaca 1441 gagatgtcac taagaggagt gagagtcagt aaaatgggag tggatgaata ttccagtact 1501 gagagggtgg tcgtgagcat tgatcgtttc ttgagggtcc gagaccagag agggaacgtg 1561 ctcctgtctc ctgaagaggt tagtgaaaca cagggaacag agaagctgac gataacatat 1621 tcatcatcta tgatgtggga aattaatggc ccggaatcag tgttagttaa cacataccaa 1681 tggatcatta gaaactggga aactgtgaag attcagtggt cccaagatcc tacaatgcta 1741 tacaacaaga tggagtttga gccctttcag tccttggtgc ctaaggctgc cagaggccag 1801 tatagtggat ttgtgaggac actatttcag cagatgcgtg atgtgctggg gacctttgac 1861 acagtccaga taataaagct attgtcattt gcagcagccc caccggagca aagtaggatg 1921 cagttctctt ctctaactgt gaacgtaaga ggttcaggaa tgagaatact tgtgagaggc 1981 aattcccctg tgttcaacta taacaaggca accaagaggc ttacagtcct tggaaaggat 2041 gcaggtgcat tgacagaaga cccagatgag gggacggcag gagtggagtc tgcggtatta 2101 agagggctcc taattctggg caaagaagac aaaagatatg ggccagcatt gagcatcaat 2161 gaattgagca atcttgcgaa gggggagaag gctaatgtgt tgatagggca aggagacgtg 2221 gtgttggtga tgaaacggaa acgggactct agcatactta ctgacagcca gacagcgacc 2281 aaaagaattc ggatggccat caattagtgt cgaattgttt aaaaacgacc ttgtttctac 2341 t

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Wed Feb 11, 2015 1:21 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
EPI324555 A/quail/Lebanon/273/2010 (A/H9N2) segment 1 (PB2) 3831.1 0.000000e+00 2215/2283 (97%)
EPI463584 A/tundra swan/Shimane/3211A001/2011 (A/H5N2) segment 1 (PB2) 3770.1 0.000000e+00 2203/2282 (96%)
EPI372391 A/Egyptian goose/Egypt/05588-NAMRU3/2006 (A/H7N7) segment 1 (PB2) 3759.1 0.000000e+00 2202/2283 (96%)
EPI401796 A/canvasback/Xianghai/428/2011 (A/H5N2) segment 1 (PB2) 3753.5 0.000000e+00 2199/2281 (96%)
EPI469129 A/wild waterfowl/Hong Kong/MPM3375/2011 (A/H7N6) segment 1 (PB2) 3736.9 0.000000e+00 2197/2282 (96%)
EPI461612 A/duck/Hunan/S11893/2012 (A/H4N6) segment 1 (PB2) 3725.8 0.000000e+00 2194/2281 (96%)
EPI387906 A/mallard/Korea/1041/2010 (A/H10N8) segment 1 (PB2) 3720.3 0.000000e+00 2194/2282 (96%)
EPI361736 A/lesser whistling-duck/Thailand/CU-W3946/2010 (A/H12N1) segment 1 (PB2) 3709.2 0.000000e+00 2174/2255 (96%)
EPI262712 A/aquatic bird/Korea/w347/2008 (A/H5N2) segment 1 (PB2) 3709.2 0.000000e+00 2193/2283 (96%)
EPI395159 A/duck/Vietnam/LBM1/2011 (A/H4N6) segment 1 (PB2) 3703.7 0.000000e+00 2192/2283 (96%)
EPI372493 A/pied avocet/Ukraine/05848-NAMRU3/2006 (A/H10N4) segment 1 (PB2) 3692.6 0.000000e+00 2190/2283 (95%)
EPI508037 A/wild duck/Korea/CSM42-34/2011 (A/H7N9) segment 1 (PB2) 3687.0 0.000000e+00 2188/2282 (95%)
EPI508036 A/wild duck/Korea/CSM42-1/2011 (A/H7N9) segment 1 (PB2) 3687.0 0.000000e+00 2188/2282 (95%)
EPI361726 A/lesser whistling-duck/Thailand/CU-W3941/2010 (A/H12N1) segment 1 (PB2) 3677.8 0.000000e+00 2166/2251 (96%)
EPI372509 A/garganey/Ukraine/05835-NAMRU3/2006 (A/H8N4) segment 1 (PB2) 3659.3 0.000000e+00 2184/2283 (95%)
EPI372280 A/shoveler/Egypt/00597-NAMRU3/2004 (A/H7N1) segment 1 (PB2) 3659.3 0.000000e+00 2184/2283 (95%)
EPI361746 A/lesser whistling-duck/Thailand/CU-W3947/2010 (A/H12N1) segment 1 (PB2) 3655.6 0.000000e+00 2155/2241 (96%)
EPI270059 A/aquatic bird/India/NIV-17095/2007 (A/H11N1) segment 1 (PB2) 3653.8 0.000000e+00 2184/2284 (95%)
EPI395168 A/muscovy duck/Vietnam/LBM14/2011 (H3N2) (A/H3N2) segment 1 (PB2) 3648.3 0.000000e+00 2182/2283 (95%)
EPI372383 A/teal/Egypt/13203-NAMRU3/2006 (A/H6N2) segment 1 (PB2) 3648.3 0.000000e+00 2182/2283 (95%)
EPI372368 A/shoveler/Egypt/13251-NAMRU3/2006 (A/H6N2) segment 1 (PB2) 3642.7 0.000000e+00 2181/2283 (95%)
EPI363564 A/wild duck/Jiangxi/8462/2006 (A/H6N1) segment 1 (PB2) 3642.7 0.000000e+00 2180/2282 (95%)
EPI296631 A/mallard/Sweden/95/2005 (A/H7N7) segment 1 (PB2) 3642.7 0.000000e+00 2180/2282 (95%)
EPI361718 A/watercock/Thailand/CU-W3699/2009 (A/H12N1) segment 1 (PB2) 3639.0 0.000000e+00 2166/2261 (95%)
EPI372296 A/teal/Egypt/00688-NAMRU3/2004 (A/H11N9) segment 1 (PB2) 3637.2 0.000000e+00 2181/2284 (95%)
EPI372288 A/shoveler/Egypt/00600-NAMRU3/2004 (A/H10N7) segment 1 (PB2) 3637.2 0.000000e+00 2180/2283 (95%)
EPI513753 A/mallard/Sweden/79978/2008 (A/H4N6) segment 1 (PB2) 3631.6 0.000000e+00 2179/2283 (95%)
EPI372304 A/teal/Egypt/00835-NAMRU3/2004 (A/H7N7) segment 1 (PB2) 3631.6 0.000000e+00 2179/2283 (95%)
EPI310338 A/duck/Zambia/04/2008 (A/H3N8) segment 1 (PB2) 3609.5 0.000000e+00 2175/2283 (95%)
EPI372320 A/shoveler/Egypt/09864-NAMRU3/2004 (A/H7N7) segment 1 (PB2) 3603.9 0.000000e+00 2176/2285 (95%)
EPI514604 A/mallard/Sweden/50108/2006 (A/H4N6) segment 1 (PB2) 3587.3 0.000000e+00 2171/2283 (95%)
EPI248498 A/mallard/Germany-RP/R193/09 (A/H1N1) segment 1 (PB2) 3581.8 0.000000e+00 2170/2283 (95%)
EPI178535 A/Duck/Italy/62330/2006 (A/H10N7) segment 1 (PB2) 3581.8 0.000000e+00 2171/2284 (95%)
EPI118473 A/duck/Jiang Xi/3345/2005 (A/H5N2) segment 1 (PB2) 3581.8 0.000000e+00 2172/2285 (95%)
EPI316548 A/spot-billed duck/Korea/KNU SYG06/2006 (A/H5N3) segment 1 (PB2) 3576.2 0.000000e+00 2169/2283 (95%)
EPI118427 A/duck/Jiang Xi/1286/2005 (A/H5N2) segment 1 (PB2) 3576.2 0.000000e+00 2172/2286 (95%)
EPI514034 A/mallard/Sweden/68575/2007 (A/H4N6) segment 1 (PB2) 3570.7 0.000000e+00 2168/2283 (94%)
EPI314705 A/mallard/Czech Republic/15902-18K/2009 (A/H11N9) segment 1 (PB2) 3565.2 0.000000e+00 2168/2284 (94%)
EPI513819 A/mallard/Sweden/79445/2008 (A/H4N6) segment 1 (PB2) 3559.6 0.000000e+00 2166/2283 (94%)
EPI513589 A/mallard/Sweden/80415/2008 (A/H0) segment 1 (PB2) 3559.6 0.000000e+00 2166/2283 (94%)
EPI469171 A/wild duck/Guangdong/520/2001 (A/H1N9) segment 1 (PB2) 3554.1 0.000000e+00 2165/2283 (94%)
EPI182409 A/duck/Primorie/2633/01 (A/H5N3) segment 1 (PB2) 3554.1 0.000000e+00 2166/2284 (94%)
EPI324547 A/quail/Lebanon/272/2010 (A/H9N2) segment 1 (PB2) 3548.5 0.000000e+00 2163/2282 (94%)
EPI229940 A/black headed gull/Mongolia/1766/2006 (A/H13N6) segment 1 (PB2) 3548.5 0.000000e+00 2165/2284 (94%)
EPI307295 A/aquatic bird/Korea/w44/2005 (A/H7N3) segment 1 (PB2) 3543.0 0.000000e+00 2164/2284 (94%)
EPI215492 A/goose/Czech Republic/1848/2009 (A/H7N9) segment 1 (PB2) 3543.0 0.000000e+00 2164/2284 (94%)
EPI534805 A/duck/Zhejiang/D18/2013 (A/H3N3) segment 1 (PB2) 3537.5 0.000000e+00 2161/2282 (94%)
EPI534804 A/duck/Zhejiang/D17/2013 (A/H3N3) segment 1 (PB2) 3537.5 0.000000e+00 2161/2282 (94%)
EPI534803 A/duck/Zhejiang/D16/2013 (A/H3N3) segment 1 (PB2) 3537.5 0.000000e+00 2161/2282 (94%)
EPI534800 A/duck/Zhejiang/D13/2013 (A/H3N2) segment 1 (PB2) 3537.5 0.000000e+00 2161/2282 (94%)
EPI534799 A/duck/Zhejiang/D11/2013 (A/H3N2) segment 1 (PB2) 3537.5 0.000000e+00 2161/2282 (94%)
EPI377663 A/mallard/Sweden/6/2002 (A/H2N3) segment 1 (PB2) 3537.5 0.000000e+00 2162/2283 (94%)
EPI284346 A/goose/Czech Republic/1848-T14/2009 (A/H7N9) segment 1 (PB2) 3537.5 0.000000e+00 2163/2284 (94%)
EPI68178 A/duck/Italy/775/2004 (A/H5N3) segment 1 (PB2) 3537.5 0.000000e+00 2162/2283 (94%)
EPI251766 A/mallard/Sweden/6/2002 (A/H2N3) segment 1 (PB2) 3533.8 0.000000e+00 2161/2283 (94%)
EPI401812 A/green-winged teal/Xianghai/430/2011 (A/H5N2) segment 1 (PB2) 3531.9 0.000000e+00 2160/2282 (94%)
EPI401365 A/wild bird/Korea/YS109/2007 (A/H4N6) segment 1 (PB2) 3531.9 0.000000e+00 2161/2283 (94%)
EPI377773 A/mallard/Sweden/30/2002 (A/H2N5) segment 1 (PB2) 3531.9 0.000000e+00 2161/2283 (94%)
EPI469163 A/common teal/Hong Kong/MPD322/2007 (A/H11N9) segment 1 (PB2) 3526.4 0.000000e+00 2161/2284 (94%)
EPI469155 A/duck/Guangdong/707/2000 (A/H2N9) segment 1 (PB2) 3526.4 0.000000e+00 2160/2283 (94%)
EPI307299 A/aquatic bird/Korea/MA44/2007 (A/H7N3) segment 1 (PB2) 3526.4 0.000000e+00 2161/2284 (94%)
EPI269319 A/duck/Hunan/1469/2002 (A/H6N8) segment 1 (PB2) 3526.4 0.000000e+00 2161/2284 (94%)
EPI99874 A/duck/Denmark/65047/04 (A/H5N2) segment 1 (PB2) 3526.4 0.000000e+00 2160/2283 (94%)
EPI387373 A/whooper swan/Mongolia/1-21/2007 (A/H3N1) segment 1 (PB2) 3524.5 0.000000e+00 2158/2281 (94%)
EPI514751 A/mallard/Sweden/4514/2004 (A/H4N6) segment 1 (PB2) 3520.8 0.000000e+00 2161/2285 (94%)
EPI469164 A/northern pintail/Hong Kong/MPC2085/2007 (A/H11N9) segment 1 (PB2) 3520.8 0.000000e+00 2160/2284 (94%)
EPI469162 A/wild waterfowl/Hong Kong/MPC729/2006 (A/H11N9) segment 1 (PB2) 3520.8 0.000000e+00 2161/2285 (94%)
EPI377788 A/mallard/Sweden/33/2002 (A/H2N3) segment 1 (PB2) 3520.8 0.000000e+00 2159/2283 (94%)
EPI377780 A/mallard/Sweden/32/2002 (A/H2N3) segment 1 (PB2) 3520.8 0.000000e+00 2159/2283 (94%)
EPI229932 A/black headed gull/Mongolia/1756/2006 (A/H16N3) segment 1 (PB2) 3520.8 0.000000e+00 2161/2285 (94%)
EPI174818 A/mallard/Denmark/77-64650-G10/2005 (A/H1N1) segment 1 (PB2) 3519.0 0.000000e+00 2157/2281 (94%)
EPI514880 A/mallard/Sweden/1195/2002 (A/H4N2) segment 1 (PB2) 3515.3 0.000000e+00 2158/2283 (94%)
EPI514859 A/mallard/Sweden/814/2002 (A/H4N9) segment 1 (PB2) 3515.3 0.000000e+00 2158/2283 (94%)
EPI485923 A/mallard/Sweden/39/2002 (A/H5N3) segment 1 (PB2) 3515.3 0.000000e+00 2158/2283 (94%)
EPI485710 A/mallard/Sweden/49/2002 (A/H5N9) segment 1 (PB2) 3515.3 0.000000e+00 2158/2283 (94%)
EPI485633 A/mallard/Sweden/7/2002 (A/H5N2) segment 1 (PB2) 3515.3 0.000000e+00 2158/2283 (94%)
EPI469161 A/northern shoveler/Hong Kong/MPC657/2006 (A/H10N9) segment 1 (PB2) 3515.3 0.000000e+00 2159/2284 (94%)
EPI469152 A/duck/Jiangxi/1717/2003 (A/H7N7) segment 1 (PB2) 3515.3 0.000000e+00 2159/2284 (94%)
EPI371013 A/wild duck/Shantou/992/2000 (A/H2N8) segment 1 (PB2) 3515.3 0.000000e+00 2158/2283 (94%)
EPI290280 A/chicken/Netherlands/03006724/03(H7N7) (A/H7N7) segment 1 (PB2) 3515.3 0.000000e+00 2159/2284 (94%)
EPI290193 A/chicken/Netherlands/03003096/03(H7N7) (A/H7N7) segment 1 (PB2) 3515.3 0.000000e+00 2159/2284 (94%)
EPI251798 A/mallard/Sweden/8/2003 (A/H8N4) segment 1 (PB2) 3515.3 0.000000e+00 2158/2283 (94%)
EPI237756 A/chicken/Netherlands/03009274/03 (A/H7N7) segment 1 (PB2) 3515.3 0.000000e+00 2159/2284 (94%)
EPI237747 A/chicken/Netherlands/03008060/03 (A/H7N7) segment 1 (PB2) 3515.3 0.000000e+00 2159/2284 (94%)
EPI63237 A/teal/Italy/3931-38/2005 (A/H5N2) segment 1 (PB2) 3515.3 0.000000e+00 2159/2284 (94%)
EPI469154 A/duck/Jiangxi/1775/2003 (A/H7N7) segment 1 (PB2) 3509.8 0.000000e+00 2158/2284 (94%)
EPI377744 A/mallard/Sweden/111/2002 (A/H2N7) segment 1 (PB2) 3509.8 0.000000e+00 2157/2283 (94%)
EPI296591 A/mute swan/Netherlands/1/2006 (A/H10N7) segment 1 (PB2) 3509.8 0.000000e+00 2158/2284 (94%)
EPI295046 A/chicken/Netherlands/03013833/03(H7N7) (A/H7N7) segment 1 (PB2) 3509.8 0.000000e+00 2157/2283 (94%)
EPI294971 A/chicken/Netherlands/03008200/03(H7N7) (A/H7N7) segment 1 (PB2) 3509.8 0.000000e+00 2157/2283 (94%)
EPI294968 A/chicken/Netherlands/03008489/03(H7N7) (A/H7N7) segment 1 (PB2) 3509.8 0.000000e+00 2158/2284 (94%)
EPI294962 A/chicken/Netherlands/03006730/03(H7N7) (A/H7N7) segment 1 (PB2) 3509.8 0.000000e+00 2158/2284 (94%)
EPI294959 A/chicken/Netherlands/03008110/03(H7N7) (A/H7N7) segment 1 (PB2) 3509.8 0.000000e+00 2158/2284 (94%)
EPI294956 A/chicken/Netherlands/03008374/03(H7N7) (A/H7N7) segment 1 (PB2) 3509.8 0.000000e+00 2157/2283 (94%)
EPI294953 A/chicken/Netherlands/03008379/03(H7N7) (A/H7N7) segment 1 (PB2) 3509.8 0.000000e+00 2158/2284 (94%)
EPI294938 A/chicken/Netherlands/03008233/03(H7N7) (A/H7N7) segment 1 (PB2) 3509.8 0.000000e+00 2158/2284 (94%)
EPI294923 A/chicken/Netherlands/621629/03(H7N7) (A/H7N7) segment 1 (PB2) 3509.8 0.000000e+00 2158/2284 (94%)
EPI294917 A/chicken/Netherlands/621572/03(H7N7) (A/H7N7) segment 1 (PB2) 3509.8 0.000000e+00 2159/2285 (94%)
EPI294914 A/chicken/Netherlands/03003214/03(H7N7)/strain2 (A/H7N7) segment 1 (PB2) 3509.8 0.000000e+00 2158/2284 (94%)
EPI294911 A/chicken/Netherlands/03003214/03(H7N7)/strain1 (A/H7N7) segment 1 (PB2) 3509.8 0.000000e+00 2158/2284 (94%)

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Wed Feb 11, 2015 1:23 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
LOCUS 2 2340 bp mRNA linear 10-FEB-2015
DEFINITION Influenza A virus (A/Goose/Taiwan/01042/2015 (H5N3)) polymerase PBl (PBl) gene, complete eds.

ACCESSION VERSION KEYWORDS SOURCE

ORGANISM


REFERENCE AUTHORS

TITLE JOURNAL
REFERENCE AUTHOR S

TITLE JOURNAL
COMMENT FEATURES
source










gene CDS




Viruses; ssRNA negative -strand viruses ; Or thomyxoviridae ; Influenzavirus A.
Viruses ; ssRNA negative -strand viruses ; Orthomyxoviridae ; Influenzaviru s A.
Unclassified.
1 (bases 1 to 2340)
Lee,M .S., Chen,L .H. , Liu,Y.P. , Chen,Y.P. , Li,W .C., Lee, F . ,
Ting,L.J . and Lin,Y.L.
Avian influenza subtype HS in geese in Taiwan, 2015 Unpublish ed
2 (bases 1 to 2340)
Lee,M .S . , Chen,L.H. , Liu,Y. P ., Chen, Y.P. , Li,W. C. , Lee, F. ,
Ting , L.J. and Lin , Y.L . Direct Submission
Submitted (10- FEB- 2015) Epidemiology Research Department , National Institute for Animal Health, Chung- Cheng Rd , Tansui , Taiwan 251 , Taiwan
##Assembly - Data-START##
Sequencing Technology :: Sanger dideoxy sequencing
##Assembly-Data - END##
Location/Qualifiers
1. . 2340
/organism= "Viruses ; ssRNA negative-strand viruses ; Orthomyxoviridae ; Influenzavirus A. "
/mol type= "mRNA "
/strain= "A/Goose/Taiwan/01042/2015(H5N3)"
/host= "Goose "
/segment= " 2 "
/countryc= "Taiwan "
/collection_date= "2015- 01-12"
/identified by= "RT- PCR"
/subtype= "H5N3"
1. . 2340
/gene= "PBl" 24 . .2297
/gene= "PBl"
/codon_start=l
/product = "polymerase PBl "
/translation = "MDVNPTLLFLKVPAQNAISTTFPYTGDPPYSHGTGTGYTMDTVN RTHQYSEKGKWTTNTETGAPQLNPID GPLPEDNEPSGYAQTDCVLEAMAFLEESHPGI FENSCLETMEIVQQTRVDKLTQGRQTYDWTLNRNQPAATALANTIEVFRSNGLTANES GRLIDFLKDVMESMDKEEMEITTHFQRKRRVRDNMTKKMVTQRTIGKKKQRLNKRSYL IRALTLNTMTKDAERGKLKRRAI ATPGMQIRGFVYFVETL ARSICEKLEQSGLPVGGN EKKAKLANVVRKMMTNSQDTELSFTITGDNTKWNENQNPRMFLAMITYITRNQPEWFR NVLSIAPIMFSNKMARLGKGYMFESKSMKLRTQIPAEMLVNIDLKYFNESTRKKIEKI








gene CDS




BASE COUNT ORIGIN

RPLLIDGTASLSPGMMMGMFNMLSTVLGVSILNLGQKRYTKTTYWWDGLQ SSDDFALI VNAPNHEGIQAGVDRFYRTCKLVGINMSK KKSYINQTGTFEFTSFFYRYGFVANFSME LPSFGVSGINESADMSIGVTVIKNNMINNDLGPATAQMALQLFIKDYRYTYRCHRGDT QIQTRRSFELKKLWEQTRSKAGLLVSDGGPNLYNIRNLHIPEVCLKWELMDEDYQGRL CNPLNPFVSHKEIESVNNAVVMPAHGPAKSMEYDAVATTHSWIPKRNRSILNTSQRGI LEDEQMYQKCCSLFEKFFPSSSYRRPVGI SSMVEAMVSRARIDARIDFESGRIKKEEF AEIMKICSTIEELRRQK "
118 . .390
lgene= "PB1 - F2 " 118 . .390
lgene= "PB1- F2 " lcodon_start= l
lproduct= " PB1-F2 protein"
ltranslation=" MEQEQDTPWTRSTEHINTQRKESGQQTQRPGHPNSTQLMDHYQR TTSQADMHKRIACWKQWLSLKNPTQGSLKTLVLKRWKSFSKQEWTN "
802 a 458 c 556 g 524 t

1 agcaaaagca ggcaaccatt tgaatggatg tcaatccgac tttacttttc ttaaaagtgc
61 cagcgcaaaa tgctataagt actacattcc cttacactgg agatcctcca tacagccatg
121 gaacaggaac aggatacacc atggacacgg tcaacagaac acatcaatac tcagagaaag
181 gaaagtggac aacaaacaca gagaccgggg caccccaact caacccaatt gatggaccat
241 taccagagga caacgagcca agcggatatg cacaaacgga ttgcgtgttg gaagcaatgg
301 ctttccttga agaatcccac ccagggatct ttgaaaactc ttgtcttgaa acgatggaaa
361 tcgttcagca aacaagagtg gacaaattaa cccaaggtcg ccagacttat gattggacat
421 tgaatagaaa ccaaccagct gcgactgctt tggccaatac tatagaggtc ttcagatcga
481 acggtctaac agccaatgaa tcggggagac taatagattt cctcaaggat gtgatggaat
541 caatggataa agaagaaatg gaaataacaa cacattttca gagaaagaga agagtaaggg 601 acaatatgac caagaagatg gtcacacaaa gaacaatagg aaagaagaag caaaggctga 661 acaaaaggag ctacttgata agagcactga cattgaacac gatgaccaaa gatgcagaaa 721 gaggcaagtt gaaaaggcgg gcaattgcaa cacccgggat gcagattaga ggattcgtgt 781 actttgtcga aacactagcg aggagcatct gtgagaaact tgagcaatct ggactccccg 841 ttggagggaa tgagaagaag gctaaattgg caaatgttgt gagaaaaatg atgactaact 901 cacaagatac agagctctcc tttacaatta ctggagacaa caccaaatgg aatgaaaatc 961 aaaatcctcg gatgtttttg gcaatgataa catacatcac aagaaaccaa ccagaatggt 1021 ttagaaatgt cttgagcatt gcccctataa tgttctcaaa taaaatggcg agattgggga 1081 aaggatacat gtttgaaagt aagagcatga agctaaggac acaaataccg gcagaaatgc 1141 ttgtaaacat tgatttgaaa tacttcaacg aatcaacgag aaagaaaatc gagaaaataa 1201 gacctctgct gattgacggc acagcctcat tgagtcctgg aatgatgatg ggcatgttca 1261 atatgctgag cacagtatta ggggtctcaa tcctgaatct tggacaaaag aggtacacta 1321 aaaccacata ctggtgggat ggactccaat cctctgatga tttcgctctc atagtgaatg 1381 caccgaatca cgaggggata caagcagggg tggataggtt ctataggacc tgcaaattgg 1441 ttgggatcaa catgagcaaa aagaagtctt acataaacca aacaggaaca tttgaattca 1501 caagcttttt ctaccgctat ggatttgtag cgaactttag tatggagtta cccagctttg 1561 gagtgtctgg aatcaatgaa tcggctgaca tgagtattgg agttacagtg ataaagaaca 1621 atatgataaa caatgatctt ggaccagcaa cagctcaaat ggctcttcag ctattcatca 1681 aggactatag gtacacgtac cgatgccaca ggggtgacac acaaattcaa acgaggagat 1741 catttgagct gaagaagctg tgggagcaga cccgttcaaa ggcagggctg ttggtatcag 1801 atggaggacc gaatctatac aacattcgga atctccacat cccagaggtc tgcttgaagt 1861 gggaactaat ggatgaagac taccagggca ggctgtgtaa tcctctaaac ccgtttgtca 1921 gtcataagga aattgagtcc gtaaacaatg ctgtggtaat gccagctcat ggcccagcca 1981 agagcatgga atatgatgct gttgcgacta cacactcatg gattcctaag aggaaccgtt 2041 ctattctcaa taccagccaa aggggaattc ttgaggatga gcagatgtac cagaagtgct 2101 gtagtctatt cgagaaattc ttccccagta gttcatacag gaggccagtt ggaatctcca 2161 gcatggtgga ggccatggtg tctagggccc gaattgatgc acgcattgat ttcgaatctg 2221 gaaggattaa gaaagaggag tttgctgaga tcatgaagat ctgttccacc attgaagagc 2281 tcagacggca aaaatagtga atttagcttg tccttcatga gaaaatgcct tgtttctact
I I

_________________
www.twitter.com/hniman


Top
 Profile  
 
Display posts from previous:  Sort by  
Post new topic Reply to topic  [ 26 posts ]  Go to page 1, 2, 3  Next

All times are UTC - 5 hours [ DST ]


Who is online

Users browsing this forum: Majestic-12 [Bot], Yahoo [Bot] and 60 guests


You cannot post new topics in this forum
You cannot reply to topics in this forum
You cannot edit your posts in this forum
You cannot delete your posts in this forum
You cannot post attachments in this forum

Search for:
Jump to:  
cron
Powered by phpBB® Forum Software © phpBB Group