Rhiza Labs FluTracker Forum

The place to discuss the flu
It is currently Tue Oct 17, 2017 12:53 pm

All times are UTC - 5 hours [ DST ]




Post new topic Reply to topic  [ 26 posts ]  Go to page 1, 2, 3  Next
Author Message
PostPosted: Tue Feb 10, 2015 11:21 pm 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
National Institute for Animal Health has released a full set of H5N8 sequences for A/Goose/Taiwan/0103/ 2015.

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Tue Feb 10, 2015 11:22 pm 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
LOCUS 1 1776 bp mRNA linear 29-JAN-2015
DEFINITION Influenza A virus A/Goose/Ta iwan/0103/ 2015 (H5N8)) hemagglutinin (HA) gene, complete eds.

ACCESSION VERSION KEYWORDS SOURCE

ORGANISM


REFERENCE AUTHORS

TITLE JOURNAL
REFERENCE AUTHORS

TITLE JOURNAL


COMMENT



FEATURES
source










gene CDS




Viruses; ssRNA negative-strand viruses ; Orthomyxoviridae ; Influenzavirus A.
Viruses ; ssRNA negative-strand viruses ; Orthomyxoviridae ; Influenzavirus A.
Unclassified .
1 (bases 1 to 1776)
Lee,M .S., Chen , L.H. , Liu,Y .P. , Chen,Y.P. , Li,W.C. , Lee,F. ,
Ting , L.J. and Lin,Y.L .
Avian influenza subtype HS in geese in Taiwan , 2015 Unpublished
2 (bases 1 to 1776)
Lee , M .S. , Chen,L.H. , Liu,Y.P. , Chen , Y .P. , Li , W.C . , Lee , F . ,
Ting,L .J . and Lin , Y .L . Direct Submission
Submitted (29-JAN-2015) Epidemiology Research Department , National Institute for Animal Health , Chung-Cheng Rd, Tansui, Taiwan 251, Taiwan
##Assembly- Data-START##
Assembly Method Lasergene DNASTAR v. Jan. 2015 Sequencing Technology :: Sanger dideoxy sequencing
##Assembly-Data- END##
Location/Qualifiers 1 ..1776
/organism= "Viruses; ssRNA negative-strand viruses ; Orthomyxoviridae; Influenzavirus A ."
/mol type= 11 mRNA 11
/strain= 11 A/GS/TW/0103/201s 11
I isolation source= 11 organ 11
/host= 11 goose 11
I segment= 11 411
/country= 11 Taiwan 11
/collection date= 11 2015/0l/09 11
/subtype= 11 HSN8 11
1 ..1776
/gene= 11 HA 11
29 ..1732
/gene= 11 HA 11
/codon_start=l
/product= 11 hemagglutinin 11
/translation= 11 MEKIVLLLAVISLVKSDQICIGYHANNSTKQVDTIMEKNVTVT H AQDILEKTHNGKLCDLNGVKPLILKDCSVAGWLLGNPMCDEFIRVPEWSYIVERANPA NDLCYPGTLNDYEELKHLLSRINHFEKTLIIPRSSWPNHETSLGVSAACPYQGASSFF RNVVWLIKKDDAYPTIKISYNNTNREDLLILWGIHHSNNAAEQTNLYKNPDTYVSVGT STLNQRLVPKIATRSQVNGQSGRMDFFWTILKPNDAIHFESNGNFIAPEYAYKIVKKG DSTIMKSEMEYGHCNTKCQTPIGAINSSMPFHNIHPLTIGECPKYVKSNKLVLATGLR NSPLRERRRKRGLFGAIAGFIEGGWQGMVDGWYGYHHSNEQGSGYAADKESTQKAIDG VTNKVNSIIDKMNTQFEAVGREFNNLERRIENLNKKMEDGFLDVWTYNAELLVLMENE RTLDFHDSNVKNLYDKVRLQLRDNAKELGNGCFEFYHKCDNECMESVRNGTYDYPKYS EEAILKREEISGVKLESIGTYQILSIYSTVASSLALAIIVAGLSLWMCSNGSLQCRIC III

BASE COUNT 617 a 332 c 401 g 426 t ORIGIN
1 agcaaaagca ggggtataat ctgtcaaaat ggagaaaata gtgcttcttc ttgcagtgat
61 tagccttgtt aaaagtgatc agatttgcat tggttaccac gcaaacaact caacaaagca
121 ggttgacacg ataatggaga aaaacgtcac tgttacacat gcccaagaca tactagaaaa
181 gacacacaac gggaagctct gcgatcttaa tggagtgaag cccctgattc taaaggattg
241 tagcgtagct gggtggctcc ttggaaatcc aatgtgcgac gagttcatca gggtgccgga
301 atggtcttac atcgtggaga gggctaaccc agccaacgac ctctgttacc cagggaccct
361 caatgactat gaggaactga aacacctatt gagccgaata aatcattttg aaaaaactct
421 gatcatcccc aggagttctt ggcccaatca tgaaacatca ttaggggtga gcgcagcatg
481 tccataccag ggagcatcct catttttcag aaatgtggta tggctcatca aaaaggacga
541 tgcatacccg acaataaaga taagctacaa taataccaat cgggaagatc ttttgatact 601 gtgggggatt catcattcca acaatgcagc agagcagaca aatctctata aaaacccaga 661 cacttatgtt tccgtgggga catcaacatt aaaccagaga ttggtgccaa aaatagctac 721 tagatcccaa gtaaacgggc aaagtggaag aatggatttc ttctggacaa ttttaaaacc 781 gaatgatgca atccac tttg agagtaatgg aaatttcatt gctccagaat atgcatacaa 841 aattgtcaag aaaggggact caacaattat gaaaagtgaa atggagtatg gccactgcaa 901 caccaaatgt caaactccaa taggggcgat aaactctagc atgccattcc acaatataca 961 ccctctcacc atcggggaat gccctaaata cgtgaagtca aacaaattag tccttgcgac 1021 tgggctcaga aatagtcctc taagagaaag aagaagaaaa agaggacttt ttggagctat












I I
LOCUS

1081
1141
1201
1261
1321
1381
1441
1501
1561
1621
1681
1741

agcagggttt atagagggag gatggcaggg aatggtagac ggttggtatg ggtatcatca tagcaatgag caggggagtg ggtacgctgc agacaaagaa tccacccaaa aggcaataga tggagttacc aataaggtca actcaatcat tgacaaaatg aacactcaat ttgaggccgt tggaagggaa tttaataact tagaaaggag aatagagaat ttaaacaaga aaatggaaga cggattccta gatgtctgga cttataatgc tgaactttta gttctcatgg aaaatgagag aactctagat ttccatgact caaatgtcaa gaacctttac gacaaagtcc ggctacagct tagggataat gcaaaagagc tgggtaatgg ttgtttcgag ttctatcaca aatgtgataa cgaatgtatg gagagcgtaa gaaatgggac gtatgactac cctaagtatt cagaagaagc aatattaaaa agagaagaaa taagcggagt gaaattagaa tcaataggaa cttaccaaat actgtcaatt tattcaacag tggcgagttc cctagcactg gcaatcatag tggctggtct atctttatgg atgtgctcta atggatcgtt acaatgcaga atttgcatct aaatttgtga gctcagattg tagttaaaaa cacccttgtt tctact

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Tue Feb 10, 2015 11:28 pm 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
EPI553208 A/crane/Kagoshima/KU1/2014 (A/H5N8) segment 4 (HA) 3077.6 0.000000e+00 1690/1702 (99%)
EPI561570 A/Baikal teal/Korea/H96/2014 (A/H5N8) segment 4 (HA) 3042.6 0.000000e+00 1685/1704 (98%)
EPI561646 A/breeder duck/Korea/H249/2014 (A/H5N8) segment 4 (HA) 3037.0 0.000000e+00 1684/1704 (98%)
EPI561626 A/mallard/Korea/H207/2014 (A/H5N8) segment 4 (HA) 3037.0 0.000000e+00 1684/1704 (98%)
EPI561605 A/broiler duck/Korea/H145/2014 (A/H5N8) segment 4 (HA) 3037.0 0.000000e+00 1684/1704 (98%)
EPI561591 A/breeder duck/Korea/H128/2014 (A/H5N8) segment 4 (HA) 3037.0 0.000000e+00 1684/1704 (98%)
EPI561529 A/Baikal teal/Korea/H66/2014 (A/H5N8) segment 4 (HA) 3037.0 0.000000e+00 1684/1704 (98%)
EPI561508 A/bean goose/Korea/H53/2014 (A/H5N8) segment 4 (HA) 3037.0 0.000000e+00 1684/1704 (98%)
EPI561341 A/Baikal teal/Korea/H41/2014 (A/H5N8) segment 4 (HA) 3037.0 0.000000e+00 1684/1704 (98%)
EPI561674 A/bean goose/Korea/H328/2014 (A/H5N8) segment 4 (HA) 3031.5 0.000000e+00 1683/1704 (98%)
EPI561612 A/breeder duck/Korea/H158/2014 (A/H5N8) segment 4 (HA) 3031.5 0.000000e+00 1683/1704 (98%)
EPI561577 A/breeder chicken/Korea/H122/2014 (A/H5N8) segment 4 (HA) 3031.5 0.000000e+00 1683/1704 (98%)
EPI561563 A/Baikal teal/Korea/H84/2014 (A/H5N8) segment 4 (HA) 3031.5 0.000000e+00 1683/1704 (98%)
EPI561542 A/Baikal teal/Korea/H68/2014 (A/H5N8) segment 4 (HA) 3031.5 0.000000e+00 1683/1704 (98%)
EPI561522 A/broiler duck/Korea/H65/2014 (A/H5N8) segment 4 (HA) 3031.5 0.000000e+00 1683/1704 (98%)
EPI561705 A/bean goose/Korea/H40/2014 (A/H5N8) segment 4 (HA) 3025.9 0.000000e+00 1682/1704 (98%)
EPI561667 A/mallard/Korea/H297/2014 (A/H5N8) segment 4 (HA) 3025.9 0.000000e+00 1683/1705 (98%)
EPI561653 A/breeder chicken/Korea/H250/2014 (A/H5N8) segment 4 (HA) 3025.9 0.000000e+00 1682/1704 (98%)
EPI561633 A/white-fronted goose/Korea/H231/2014 (A/H5N8) segment 4 (HA) 3025.9 0.000000e+00 1682/1704 (98%)
EPI509704 A/broiler duck/Korea/Buan2/2014 (A/H5N8) segment 4 (HA) 3025.9 0.000000e+00 1682/1704 (98%)
EPI561697 A/spot-billed duck/Korea/H455-42/2014 (A/H5N8) segment 4 (HA) 3020.4 0.000000e+00 1681/1704 (98%)
EPI561681 A/tundra swan/Korea/H411/2014 (A/H5N8) segment 4 (HA) 3020.4 0.000000e+00 1681/1704 (98%)
EPI561660 A/Korean native chicken/Korea/H257/2014 (A/H5N8) segment 4 (HA) 3020.4 0.000000e+00 1681/1704 (98%)
EPI561598 A/broiler duck/Korea/H133/2014 (A/H5N8) segment 4 (HA) 3020.4 0.000000e+00 1681/1704 (98%)
EPI561360 A/broiler duck/Korea/H49/2014 (A/H5N8) segment 4 (HA) 3020.4 0.000000e+00 1681/1704 (98%)
EPI561348 A/broiler duck/Korea/H47/2014 (A/H5N8) segment 4 (HA) 3020.4 0.000000e+00 1681/1704 (98%)
EPI561336 A/broiler duck/Korea/H48/2014 (A/H5N8) segment 4 (HA) 3020.4 0.000000e+00 1681/1704 (98%)
EPI561204 A/broiler duck/Korea/H31/2014 (A/H5N8) segment 4 (HA) 3020.4 0.000000e+00 1681/1704 (98%)
EPI561196 A/broiler duck/Korea/H29/2014 (A/H5N8) segment 4 (HA) 3020.4 0.000000e+00 1681/1704 (98%)
EPI561187 A/waterfowl/Korea/S005/2014 (A/H5N8) segment 4 (HA) 3020.4 0.000000e+00 1681/1704 (98%)
EPI517161 A/Chicken/Kumamoto/1-7/2014 (A/H5N8) segment 4 (HA) 3020.4 0.000000e+00 1681/1704 (98%)
EPI561690 A/common teal/Korea/H455-30/2014 (A/H5N8) segment 4 (HA) 3014.9 0.000000e+00 1680/1704 (98%)
EPI561556 A/Coot/Korea/H81/2014 (A/H5N8) segment 4 (HA) 3014.9 0.000000e+00 1680/1704 (98%)
EPI561549 A/Baikal teal/Korea/H80/2014 (A/H5N8) segment 4 (HA) 3014.9 0.000000e+00 1680/1704 (98%)
EPI561515 A/Baikal teal/Korea/H62/2014 (A/H5N8) segment 4 (HA) 3014.9 0.000000e+00 1680/1704 (98%)
EPI509709 A/baikal teal/Korea/Donglim3/2014 (A/H5N8) segment 4 (HA) 3014.9 0.000000e+00 1680/1704 (98%)
EPI561619 A/breeder duck/Korea/H200/2014 (A/H5N8) segment 4 (HA) 3003.8 0.000000e+00 1679/1705 (98%)
EPI542628 A/mallard/Korea/W452/2014 (A/H5N8) segment 4 (HA) 2998.2 0.000000e+00 1677/1704 (98%)
EPI553349 A/wigeon/Sakha/1/2014 (A/H5N8) segment 4 (HA) 2992.7 0.000000e+00 1676/1704 (98%)
EPI550849 A/duck/England/36226/14 (A/H5N8) segment 4 (HA) 2987.2 0.000000e+00 1675/1704 (98%)
EPI550848 A/duck/England/36038/14 (A/H5N8) segment 4 (HA) 2987.2 0.000000e+00 1675/1704 (98%)
EPI547673 A/duck/England/36254/14 (A/H5N8) segment 4 (HA) 2976.1 0.000000e+00 1673/1704 (98%)
EPI552746 A/turkey/Germany/R2474-L00899/2014 (A/H5N8) segment 4 (HA) 2965.0 0.000000e+00 1671/1704 (98%)
EPI548493 A/duck/Chiba/26-372-61/2014 (A/H5N8) segment 4 (HA) 2965.0 0.000000e+00 1671/1704 (98%)
EPI548485 A/duck/Chiba/26-372-48/2014 (A/H5N8) segment 4 (HA) 2965.0 0.000000e+00 1671/1704 (98%)
EPI547678 A/Chicken/Netherlands/14015526/2014 (A/H5N8) segment 4 (HA) 2965.0 0.000000e+00 1671/1704 (98%)
EPI548623 A/chicken/Netherlands/14015531/2014 (A/H5N8) segment 4 (HA) 2959.5 0.000000e+00 1670/1704 (98%)
EPI553362 A/environment/Kagoshima/KU-ngr-H/2014 (A/H5N8) segment 4 (HA) 2953.9 0.000000e+00 1669/1704 (97%)
EPI553343 A/chicken/Miyazaki/7/2014 (A/H5N8) segment 4 (HA) 2953.9 0.000000e+00 1670/1705 (97%)
EPI544756 A/turkey/Germany-MV/R2472/2014 (A/H5N8) segment 4 (HA) 2942.8 0.000000e+00 1659/1692 (98%)
EPI552776 A/chicken/Netherlands/emc-3/2014 (A/H5N8) segment 4 (HA) 2918.8 0.000000e+00 1649/1683 (97%)
EPI552768 A/eurasian wigeon/Netherlands/emc-2/2014 (A/H5N8) segment 4 (HA) 2918.8 0.000000e+00 1655/1692 (97%)
EPI552760 A/eurasian wigeon/Netherlands/emc-1/2014 (A/H5N8) segment 4 (HA) 2881.9 0.000000e+00 1620/1650 (98%)
EPI551149 A/eurasian wigeon/Netherlands/emc-2/2014 (A/H5N8) segment 4 (HA) 2872.7 0.000000e+00 1630/1667 (97%)
EPI543010 A/duck/Beijing/CT01/2014 (A/H5N8) segment 4 (HA) 2821.0 0.000000e+00 1581/1608 (98%)
EPI551143 A/eurasian wigeon/Netherlands/emc-1/2014 (A/H5N8) segment 4 (HA) 2815.4 0.000000e+00 1582/1611 (98%)
EPI543002 A/duck/Beijing/FS01/2014 (A/H5N8) segment 4 (HA) 2809.9 0.000000e+00 1580/1609 (98%)
EPI542617 A/duck/Beijing/FS01/2013 (A/H5N8) segment 4 (HA) 2804.3 0.000000e+00 1577/1608 (98%)
EPI475579 A/wild duck/Shandong/628/2011 (A/H5N1) segment 4 (HA) 2798.8 0.000000e+00 1645/1708 (96%)
EPI442017 A/duck/Jiangsu/k1203/2010 (A/H5N8) segment 4 (HA) 2798.8 0.000000e+00 1644/1707 (96%)
EPI399960 A/duck/Jiangsu/m234/2012 (A/H5N2) segment 4 (HA) 2760.0 0.000000e+00 1639/1709 (95%)
EPI398966 A/goose/Eastern China/1112/2011 (A/H5N2) segment 4 (HA) 2754.5 0.000000e+00 1637/1708 (95%)
EPI398965 A/duck/Eastern China/1111/2011 (A/H5N2) segment 4 (HA) 2748.9 0.000000e+00 1636/1708 (95%)
EPI431456 A/duck/Hebei/3/2011 (A/H5N2) segment 4 (HA) 2743.4 0.000000e+00 1635/1708 (95%)
EPI530054 A/duck/Jiangxi/95/2014 (A/H5N6) segment 4 (HA) 2726.8 0.000000e+00 1631/1707 (95%)
EPI509698 A/breeder duck/Korea/Gochang1/2014 (A/H5N8) segment 4 (HA) 2726.8 0.000000e+00 1632/1708 (95%)
EPI544892 A/duck/Shandong/Q1/2013 (A/H5N8) segment 4 (HA) 2721.2 0.000000e+00 1634/1711 (95%)
EPI531456 A/duck/Guangdong/GD01/2014 (A/H5N6) segment 4 (HA) 2721.2 0.000000e+00 1630/1707 (95%)
EPI561495 A/Baikal teal/Korea/H52/2014 (A/H5N8) segment 4 (HA) 2715.7 0.000000e+00 1630/1708 (95%)
EPI530985 A/duck/Zhejiang/W24/2013 (A/H5N8) segment 4 (HA) 2715.7 0.000000e+00 1628/1706 (95%)
EPI507673 A/mallard duck/Shanghai/SH-9/2013 (A/H5N8) segment 4 (HA) 2710.2 0.000000e+00 1628/1707 (95%)
EPI553144 A/turkey/Italy/14VIR7898-10/2014 (A/H5N8) segment 4 (HA) 2706.5 0.000000e+00 1518/1545 (98%)
EPI530986 A/duck/Zhejiang/6D18/2013 (A/H5N8) segment 4 (HA) 2699.1 0.000000e+00 1627/1708 (95%)
EPI530063 A/environment/Shenzhen/25-24/2013 (A/H5N6) segment 4 (HA) 2699.1 0.000000e+00 1626/1707 (95%)
EPI550768 A/duck/Laos/XBY004/2014 (A/H5N6) segment 4 (HA) 2688.0 0.000000e+00 1625/1708 (95%)
EPI550763 A/duck/Laos/XBY004/2014 (A/H5N6) segment 4 (HA) 2688.0 0.000000e+00 1625/1708 (95%)
EPI550759 A/chicken/Laos/XBY003/2014 (A/H5N6) segment 4 (HA) 2688.0 0.000000e+00 1625/1708 (95%)
EPI550757 A/duck/Laos/LPQ002/2014 (A/H5N6) segment 4 (HA) 2688.0 0.000000e+00 1625/1708 (95%)
EPI493825 A/duck/Guangdong/wy19/2008 (A/H5N5) segment 4 (HA) 2688.0 0.000000e+00 1626/1709 (95%)
EPI550752 A/chicken/Laos/LPQ001/2014 (A/H5N6) segment 4 (HA) 2682.5 0.000000e+00 1624/1708 (95%)
EPI499478 A/chicken/China/AH/2012 (A/H5N1) segment 4 (HA) 2676.9 0.000000e+00 1622/1707 (95%)
EPI431448 A/duck/Hebei/2/2011 (A/H5N2) segment 4 (HA) 2673.2 0.000000e+00 1623/1709 (94%)
EPI493817 A/duck/Guangdong/wy11/2008 (A/H5N5) segment 4 (HA) 2665.8 0.000000e+00 1623/1710 (94%)
EPI328878 A/duck/Eastern China/031/2009 (A/H5N5) segment 4 (HA) 2632.6 0.000000e+00 1615/1708 (94%)
EPI328870 A/duck/Eastern China/008/2008 (A/H5N5) segment 4 (HA) 2604.9 0.000000e+00 1612/1710 (94%)
EPI328886 A/duck/Eastern China/108/2008 (A/H5N1) segment 4 (HA) 2599.4 0.000000e+00 1611/1710 (94%)
EPI533583 A/Sichuan/26221/2014 (A/H5N6) segment 4 (HA) 2593.8 0.000000e+00 1610/1710 (94%)
EPI493833 A/duck/Guangdong/wy24/2008 (A/H5N5) segment 4 (HA) 2590.1 0.000000e+00 1611/1712 (94%)
EPI442025 A/quail/Jiangsu/k0104/2010 (A/H5N5) segment 4 (HA) 2590.1 0.000000e+00 1612/1713 (94%)
EPI547402 A/environment/Zhenjiang/C13/2013 (A/H5N6) segment 4 (HA) 2588.3 0.000000e+00 1610/1711 (94%)
EPI442001 A/goose/Shandong/k1204/2009 (A/H5N5) segment 4 (HA) 2544.0 0.000000e+00 1600/1709 (93%)
EPI442009 A/goose/Guangdong/k0103/2010 (A/H5N5) segment 4 (HA) 2534.7 0.000000e+00 1601/1712 (93%)
EPI127384 A/wild duck/Hunan/021/2005 (A/H5N1) segment 4 (HA) 2483.0 0.000000e+00 1589/1709 (92%)
EPI227309 A/Mallard/Huadong/lk/2005 (A/H5N1) segment 4 (HA) 2477.5 0.000000e+00 1587/1708 (92%)
EPI127406 A/wild duck/Hunan/211/2005 (A/H5N1) segment 4 (HA) 2477.5 0.000000e+00 1588/1709 (92%)
EPI439897 A/goose/Guangdong/08/2005 (A/H5N1) segment 4 (HA) 2475.6 0.000000e+00 1588/1709 (92%)
EPI399886 A/duck/HuBei/03/2010 (A/H5N5) segment 4 (HA) 2471.9 0.000000e+00 1588/1710 (92%)
EPI279949 A/Zhejiang/1/2006 (A/H5N1) segment 4 (HA) 2471.9 0.000000e+00 1587/1709 (92%)
EPI276046 A/goose/Hubei/65/2005 (A/H5N1) segment 4 (HA) 2471.9 0.000000e+00 1587/1709 (92%)
EPI224777 A/Shanghai/1/2006 (A/H5N1) segment 4 (HA) 2471.9 0.000000e+00 1587/1709 (92%)

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Tue Feb 10, 2015 11:39 pm 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
6 1460 bp mRNA linear 10- FEB- 2015

DEFINITION

ACCESSION VERSION KEYWORDS SOURCE

ORGANISM


REFERENCE AUTHORS

TITLE JOURNAL
REFERENCE AUTHORS

TITLE JOURNAL
COMMENT FEATURES
source











gene CDS

Influenza A virus (A/Goose/Taiwan/0103/2015(HSN8)) neuraminida se (NA) gene, complete eds).



Viruses; ssRNA negative-strand viruses ; Orthomyxoviridae; Influenzavirus A.
Viruses ; ssRNA negative -strand viruses ; Orthomyxoviridae; Influenzavirus A.
Unclassified.
1 (bases 1 to 1460)
Lee,M. S ., Chen , L .H., Liu,Y.P . , Chen,Y.P. , Li,W.C. , Lee, F . ,
Ting,L.J. and Lin,Y.L.
Avian influenza subtype HS in geese in Taiwan , 2015 Unpubli shed
2 (bases 1 to 1460)
Lee,M.S ., Chen , L.H. , Liu , Y.P. , Chen,Y. P. , Li , W.C. , Lee , F. ,
Ting, L.J. and Lin ,Y.L. Direct Submission
Submitted (10- FEB- 2015) Epidemiology Research Department , National Institute for Animal Health, Chung- Cheng Rd , Tansui , Taiwan 251 , Taiwan
##Metadata-START##
Sequencing Technology :: Sanger dideoxy sequencing
##Metadata-END##
Location/Qualifiers 1 ..1460
/organism= "Viruses ; ssRNA negative-strand viruses ; Orthomyxoviridae ; Influenzavirus A ."
/mol type= "mRNA"
/strain= "A/Goose/Taiwan/010 3/2015 "
/isolation source= "organ "
/host="goose"
/segment= "6"
/country= "Taiwan "
/collection date="2015 - 01-09"
/identified=by= "RT-PCR"
/subtype= "HSN8" 1. .1460
/gene= "NA " 21. .1433
/gene="NA "
/codon start=l
/product= "neuraminidase "
/translation= "MNPNQKIVTIGSISLGLVVFNVLLHAVSIILTVLALGKSENNGI CNGTVVREHNETVRIEKVTQWYNTSVVEYVPHWNEGTYINNTEPICDVKGFAPFSKDN GVRVGSRGHIFVIREPFV SCSPVGCRTFFLTQGSLLNDKHSNGTVKDRSPFRT LMSVE VGQSPNVYQARFEAVAWSATACHDGKKWMAIGVTGPDSKAVAVVHYGGVPTDVVNSWA GDILRTQESSCTCIQGNCYWVMTDGPANRQAQYR IYKANQGKIIGRKDVSFSGGHIEE CSCYPNDGKVECVCRDNWTGTNRPVLIISPDLSYRVGYLCAGLPSDTPRGEDTQFVGS CTSPMGNQGYGVKGFGFRQGTDVWVGRTISRTSRSGFE IIRIKNGWTQTSKEQIRRQV VVDNSNWSGYSGSFTLPAELTGRECLVPCFWVEMIRGRPEERTIWTS SSSI'VMCGVDY


BASE COUNT ORIGIN

EIADWSWHDGAILPFDIDKM "
439 a 254 c 385 g 382 t

1 agcaaaagca ggagtttaaa atgaatccaa atcagaaaat agtaaccatt ggctccattt

61
121
181
241
301
361
421
481
541
601
661
721
781
841

cattagggtt ggttgtattc aatgttctac tgcatgccgt gagcatcata ttaacagtgt tagccctggg gaagagtgaa aacaatggaa tctgcaatgg aactgtagtg agggaacaca atgaaacagt tagaatagag aaagtgactc aatggtacaa tactagcgta gtcgaatatg taccgcattg gaatgaggga acttatataa acaacaccga accaatatgt gatgtcaagg gctttgcacc tttttccaag gacaacgggg tgagagttgg ctccaggggg catatttttg tcataagaga gcctttcgtc tcttgttcac cagtagggtg caggactttc ttcctcactc agggatctct actcaatgac aaacactcaa atggaacagt gaaggataga agcccattca gaactctcat gagtgtcgaa gtgggccaat cacccaatgt atatcaagcc aggtttgaag ctgtggcatg gtcagcaaca gcctgtcatg atggtaagaa gtggatggca attggtgtaa cagggccaga ttctaaagca gtagcagtag ttcattacgg aggggtgcct actgacgttg ttaactcctg ggcaggagat atattaagaa ctcaggagtc atcttgtact tgcattcaag gtaattgtta ttgggtaatg actgacggtc ctgccaatag acaggcgcag tatagaatat acaaagcaaa ccaaggcaaa ataattggcc gaaaagatgt tagctttagt ggaggacata ttgaggaatg ttcttgttat ccaaatgatg gtaaagtgga atgcgtgtgt agagacaact

901 ggacgggaac taacagacct gtgctaatta tttcgcctga tctctcttac agagttgggt









I I
LOCUS

961
1021
1081
1141
1201
1261
1321
1381
1441

atttatgtgc agggttgccc agtgacactc caagagggga ggatactcaa tttgtcggtt catgcactag tcccatggga aatcaggggt atggcgtaaa agggttcggg tttcgacagg gaactgatgt gtgggtgggg cggacaatta gtcgaacctc cagatcagga tttgaaataa taaggataaa gaatggttgg acgcaaacaa gcaaagaaca gattagaaga caggtggttg ttgataactc gaattggtcg ggatacagtg ggtctttcac tttaccagca gaattgactg ggagggaatg tttggttccc tgtttttggg tcgaaatgat cagaggtagg ccagaagaga gaacaatctg gacctctagt agctccattg taatgtgtgg agttgattat gaaattgccg actggtcatg gcacgatgga gctattcttc cctttgacat cgataagatg taatttacga aaaagcccct tgtttctact

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Tue Feb 10, 2015 11:41 pm 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
EPI553210 A/crane/Kagoshima/KU1/2014 (A/H5N8) segment 6 (NA) 2538.4 0.000000e+00 1398/1410 (99%)
EPI561669 A/mallard/Korea/H297/2014 (A/H5N8) segment 6 (NA) 2516.3 0.000000e+00 1396/1413 (98%)
EPI561544 A/Baikal teal/Korea/H68/2014 (A/H5N8) segment 6 (NA) 2516.3 0.000000e+00 1396/1413 (98%)
EPI561676 A/bean goose/Korea/H328/2014 (A/H5N8) segment 6 (NA) 2510.7 0.000000e+00 1395/1413 (98%)
EPI561662 A/Korean native chicken/Korea/H257/2014 (A/H5N8) segment 6 (NA) 2510.7 0.000000e+00 1395/1413 (98%)
EPI561655 A/breeder chicken/Korea/H250/2014 (A/H5N8) segment 6 (NA) 2510.7 0.000000e+00 1395/1413 (98%)
EPI561648 A/breeder duck/Korea/H249/2014 (A/H5N8) segment 6 (NA) 2510.7 0.000000e+00 1395/1413 (98%)
EPI561635 A/white-fronted goose/Korea/H231/2014 (A/H5N8) segment 6 (NA) 2510.7 0.000000e+00 1395/1413 (98%)
EPI561628 A/mallard/Korea/H207/2014 (A/H5N8) segment 6 (NA) 2510.7 0.000000e+00 1395/1413 (98%)
EPI561621 A/breeder duck/Korea/H200/2014 (A/H5N8) segment 6 (NA) 2510.7 0.000000e+00 1395/1413 (98%)
EPI561614 A/breeder duck/Korea/H158/2014 (A/H5N8) segment 6 (NA) 2510.7 0.000000e+00 1395/1413 (98%)
EPI561579 A/breeder chicken/Korea/H122/2014 (A/H5N8) segment 6 (NA) 2510.7 0.000000e+00 1395/1413 (98%)
EPI561510 A/bean goose/Korea/H53/2014 (A/H5N8) segment 6 (NA) 2510.7 0.000000e+00 1395/1413 (98%)
EPI561362 A/broiler duck/Korea/H49/2014 (A/H5N8) segment 6 (NA) 2510.7 0.000000e+00 1395/1413 (98%)
EPI561355 A/broiler duck/Korea/H48/2014 (A/H5N8) segment 6 (NA) 2510.7 0.000000e+00 1395/1413 (98%)
EPI561350 A/broiler duck/Korea/H47/2014 (A/H5N8) segment 6 (NA) 2510.7 0.000000e+00 1395/1413 (98%)
EPI561343 A/Baikal teal/Korea/H41/2014 (A/H5N8) segment 6 (NA) 2510.7 0.000000e+00 1395/1413 (98%)
EPI561209 A/broiler duck/Korea/H31/2014 (A/H5N8) segment 6 (NA) 2510.7 0.000000e+00 1395/1413 (98%)
EPI561198 A/broiler duck/Korea/H29/2014 (A/H5N8) segment 6 (NA) 2510.7 0.000000e+00 1395/1413 (98%)
EPI509714 A/baikal teal/Korea/Donglim3/2014 (A/H5N8) segment 6 (NA) 2510.7 0.000000e+00 1395/1413 (98%)
EPI509706 A/broiler duck/Korea/Buan2/2014 (A/H5N8) segment 6 (NA) 2510.7 0.000000e+00 1395/1413 (98%)
EPI561707 A/bean goose/Korea/H40/2014 (A/H5N8) segment 6 (NA) 2505.2 0.000000e+00 1394/1413 (98%)
EPI561699 A/spot-billed duck/Korea/H455-42/2014 (A/H5N8) segment 6 (NA) 2505.2 0.000000e+00 1394/1413 (98%)
EPI561683 A/tundra swan/Korea/H411/2014 (A/H5N8) segment 6 (NA) 2505.2 0.000000e+00 1394/1413 (98%)
EPI561607 A/broiler duck/Korea/H145/2014 (A/H5N8) segment 6 (NA) 2505.2 0.000000e+00 1394/1413 (98%)
EPI561600 A/broiler duck/Korea/H133/2014 (A/H5N8) segment 6 (NA) 2505.2 0.000000e+00 1395/1414 (98%)
EPI561593 A/breeder duck/Korea/H128/2014 (A/H5N8) segment 6 (NA) 2505.2 0.000000e+00 1394/1413 (98%)
EPI561572 A/Baikal teal/Korea/H96/2014 (A/H5N8) segment 6 (NA) 2505.2 0.000000e+00 1394/1413 (98%)
EPI561565 A/Baikal teal/Korea/H84/2014 (A/H5N8) segment 6 (NA) 2505.2 0.000000e+00 1394/1413 (98%)
EPI561558 A/Coot/Korea/H81/2014 (A/H5N8) segment 6 (NA) 2505.2 0.000000e+00 1394/1413 (98%)
EPI561551 A/Baikal teal/Korea/H80/2014 (A/H5N8) segment 6 (NA) 2505.2 0.000000e+00 1394/1413 (98%)
EPI561531 A/Baikal teal/Korea/H66/2014 (A/H5N8) segment 6 (NA) 2505.2 0.000000e+00 1394/1413 (98%)
EPI561524 A/broiler duck/Korea/H65/2014 (A/H5N8) segment 6 (NA) 2505.2 0.000000e+00 1394/1413 (98%)
EPI561517 A/Baikal teal/Korea/H62/2014 (A/H5N8) segment 6 (NA) 2505.2 0.000000e+00 1394/1413 (98%)
EPI553345 A/chicken/Miyazaki/7/2014 (A/H5N8) segment 6 (NA) 2505.2 0.000000e+00 1394/1413 (98%)
EPI561692 A/common teal/Korea/H455-30/2014 (A/H5N8) segment 6 (NA) 2499.6 0.000000e+00 1393/1413 (98%)
EPI561189 A/waterfowl/Korea/S005/2014 (A/H5N8) segment 6 (NA) 2499.6 0.000000e+00 1393/1413 (98%)
EPI542632 A/mallard/Korea/W452/2014 (A/H5N8) segment 6 (NA) 2499.6 0.000000e+00 1393/1413 (98%)
EPI517163 A/Chicken/Kumamoto/1-7/2014 (A/H5N8) segment 6 (NA) 2494.1 0.000000e+00 1392/1413 (98%)
EPI552748 A/turkey/Germany/R2474-L00899/2014 (A/H5N8) segment 6 (NA) 2488.6 0.000000e+00 1391/1413 (98%)
EPI544759 A/turkey/Germany-MV/R2472/2014 (A/H5N8) segment 6 (NA) 2488.6 0.000000e+00 1391/1413 (98%)
EPI543012 A/duck/Beijing/CT01/2014 (A/H5N8) segment 6 (NA) 2488.6 0.000000e+00 1389/1410 (98%)
EPI558000 A/duck/England/36226/14 (A/H5N8) segment 6 (NA) 2483.0 0.000000e+00 1390/1413 (98%)
EPI543004 A/duck/Beijing/FS01/2014 (A/H5N8) segment 6 (NA) 2483.0 0.000000e+00 1388/1410 (98%)
EPI558007 A/duck/England/36038/14 (A/H5N8) segment 6 (NA) 2477.5 0.000000e+00 1389/1413 (98%)
EPI553350 A/wigeon/Sakha/1/2014 (A/H5N8) segment 6 (NA) 2477.5 0.000000e+00 1389/1413 (98%)
EPI548495 A/duck/Chiba/26-372-61/2014 (A/H5N8) segment 6 (NA) 2477.5 0.000000e+00 1389/1413 (98%)
EPI548487 A/duck/Chiba/26-372-48/2014 (A/H5N8) segment 6 (NA) 2477.5 0.000000e+00 1389/1413 (98%)
EPI547683 A/Chicken/Netherlands/14015526/2014 (A/H5N8) segment 6 (NA) 2477.5 0.000000e+00 1389/1413 (98%)
EPI548626 A/chicken/Netherlands/14015531/2014 (A/H5N8) segment 6 (NA) 2471.9 0.000000e+00 1388/1413 (98%)
EPI553152 A/turkey/Germany-NI/R3372/2014 (A/H5N8) segment 6 (NA) 2466.4 0.000000e+00 1388/1414 (98%)
EPI547675 A/duck/England/36254/14 (A/H5N8) segment 6 (NA) 2466.4 0.000000e+00 1387/1413 (98%)
EPI555122 A/mallard/Germany-ST/R23/2015 (A/H5N8) segment 6 (NA) 2460.9 0.000000e+00 1386/1413 (98%)
EPI554606 A/domestic duck/Germany-NI/R3468/2014 (A/H5N8) segment 6 (NA) 2460.9 0.000000e+00 1387/1414 (98%)
EPI555068 A/turkey/Italy/14VIR7898-10/2014 (A/H5N8) segment 6 (NA) 2446.1 0.000000e+00 1382/1412 (97%)
EPI551150 A/eurasian wigeon/Netherlands/emc-2/2014 (A/H5N8) segment 6 (NA) 2431.3 0.000000e+00 1362/1385 (98%)
EPI552778 A/chicken/Netherlands/emc-3/2014 (A/H5N8) segment 6 (NA) 2423.9 0.000000e+00 1358/1381 (98%)
EPI552770 A/eurasian wigeon/Netherlands/emc-2/2014 (A/H5N8) segment 6 (NA) 2422.1 0.000000e+00 1357/1380 (98%)
EPI552762 A/eurasian wigeon/Netherlands/emc-1/2014 (A/H5N8) segment 6 (NA) 2416.5 0.000000e+00 1354/1377 (98%)
EPI551144 A/eurasian wigeon/Netherlands/emc-1/2014 (A/H5N8) segment 6 (NA) 2416.5 0.000000e+00 1354/1377 (98%)
EPI553364 A/environment/Kagoshima/KU-ngr-H/2014 (A/H5N8) segment 6 (NA) 2412.8 0.000000e+00 1379/1415 (97%)
EPI542627 A/duck/Beijing/FS01/2013 (A/H5N8) segment 6 (NA) 2405.5 0.000000e+00 1356/1385 (97%)
EPI530990 A/duck/Zhejiang/6D18/2013 (A/H5N8) segment 6 (NA) 2361.1 0.000000e+00 1369/1414 (96%)
EPI530989 A/duck/Zhejiang/W24/2013 (A/H5N8) segment 6 (NA) 2355.6 0.000000e+00 1368/1414 (96%)
EPI561493 A/Baikal teal/Korea/H52/2014 (A/H5N8) segment 6 (NA) 2350.1 0.000000e+00 1367/1414 (96%)
EPI544894 A/duck/Shandong/Q1/2013 (A/H5N8) segment 6 (NA) 2350.1 0.000000e+00 1367/1414 (96%)
EPI509700 A/breeder duck/Korea/Gochang1/2014 (A/H5N8) segment 6 (NA) 2350.1 0.000000e+00 1367/1414 (96%)
EPI507675 A/mallard duck/Shanghai/SH-9/2013 (A/H5N8) segment 6 (NA) 2350.1 0.000000e+00 1367/1414 (96%)
EPI442019 A/duck/Jiangsu/k1203/2010 (A/H5N8) segment 6 (NA) 2331.6 0.000000e+00 1351/1395 (96%)
EPI485330 A/common shelduck/Mongolia/2185/2011 (A/H3N8) segment 6 (NA) 2089.7 0.000000e+00 1321/1415 (93%)
EPI132266 A/duck/Eastern China/90/2004 (A/H3N8) segment 6 (NA) 2078.6 0.000000e+00 1319/1415 (93%)
EPI132262 A/duck/Eastern China/19/2004 (A/H3N8) segment 6 (NA) 2067.5 0.000000e+00 1317/1415 (93%)
EPI326921 A/environment/Korea/SH12-6/2008 (A/H3N8) segment 6 (NA) 2056.4 0.000000e+00 1315/1415 (92%)
EPI416940 A/duck/Vietnam/OIE-2577/2011 (A/H3N8) segment 6 (NA) 2023.2 0.000000e+00 1309/1415 (92%)
EPI438257 A/duck/Vietnam/G18-1/2011 (A/H3N8) segment 6 (NA) 2006.6 0.000000e+00 1306/1415 (92%)
EPI387415 A/ruddy shelduck/Mongolia/1-26/2007 (A/H3N8) segment 6 (NA) 1993.7 0.000000e+00 1272/1367 (93%)
EPI387510 A/ruddy shelduck/Mongolia/2-79/2007 (A/H3N8) segment 6 (NA) 1971.5 0.000000e+00 1269/1368 (92%)
EPI363489 A/duck/Guangxi/2736/2006 (A/H6N8) segment 6 (NA) 1967.8 0.000000e+00 1299/1415 (91%)
EPI387494 A/pintail/Mongolia/2-65/2007 (A/H3N8) segment 6 (NA) 1966.0 0.000000e+00 1268/1368 (92%)
EPI326920 A/environment/Korea/SH12-8/2008 (A/H3N8) segment 6 (NA) 1964.1 0.000000e+00 1265/1365 (92%)
EPI485320 A/ruddy shelduck/Mongolia/1787/2011 (A/H3N8) segment 6 (NA) 1905.0 0.000000e+00 1278/1398 (91%)
EPI485328 A/common shelduck/Mongolia/2076/2011 (A/H3N8) segment 6 (NA) 1807.1 0.000000e+00 1252/1386 (90%)
EPI407886 A/duck/Ukraine/1963 (A/H3N8) segment 6 (NA) 1696.3 0.000000e+00 1256/1421 (88%)
EPI128912 A/duck/Ukraine/1/1963 (A/H3N8) segment 6 (NA) 1696.3 0.000000e+00 1255/1420 (88%)
EPI42182 A/duck/Ukraine/1/1963 (A/H3N8) segment 6 (NA) 1696.3 0.000000e+00 1256/1421 (88%)
EPI3107 A/duck/Ukraine/1/1963 (A/H3N8) segment 6 (NA) 1690.8 0.000000e+00 1255/1421 (88%)
EPI132460 A/duck/Ukraine/1/1963 (A/H3N8) segment 6 (NA) 1685.3 0.000000e+00 1254/1421 (88%)
EPI251642 A/mallard/Netherlands/10/1999 (A/H1N8) segment 6 (NA) 1652.0 0.000000e+00 1200/1351 (88%)
EPI2999 A/duck/Hong Kong/438/1977 (A/H4N8) segment 6 (NA) 1629.9 0.000000e+00 1246/1423 (87%)
EPI128904 A/duck/Burjatia/652/1988 (A/H3N8) segment 6 (NA) 1618.8 0.000000e+00 1247/1426 (87%)
EPI251715 A/mallard/Sweden/45/2002 (A/H11N8) segment 6 (NA) 1615.1 0.000000e+00 1240/1419 (87%)
EPI182043 A/common eider/Netherlands/1/2006 (A/H3N8) segment 6 (NA) 1613.2 0.000000e+00 1242/1422 (87%)
EPI336006 A/teal/Chany/444/2009 (A/H8N8) segment 6 (NA) 1609.6 0.000000e+00 1239/1419 (87%)
EPI316502 A/duck/Hubei/126/1985 (A/H7N8) segment 6 (NA) 1607.7 0.000000e+00 1244/1425 (87%)
EPI314410 A/mallard/Czech Republic/14516/2007 (A/H3N8) segment 6 (NA) 1607.7 0.000000e+00 1238/1419 (87%)
EPI182051 A/turnstone/Netherlands/1/2007 (A/H3N8) segment 6 (NA) 1607.7 0.000000e+00 1241/1422 (87%)
EPI310343 A/duck/Zambia/04/2008 (A/H3N8) segment 6 (NA) 1604.0 0.000000e+00 1237/1418 (87%)
EPI339172 A/mallard/Germany-BE/R663/08 (A/H3N8) segment 6 (NA) 1602.2 0.000000e+00 1238/1420 (87%)
EPI268303 A/duck/Hunan/3748/2004 (A/H6N8) segment 6 (NA) 1602.2 0.000000e+00 1239/1421 (87%)
EPI2277 A/Duck/Hokkaido/8/80 (A/H3N8) segment 6 (NA) 1602.2 0.000000e+00 1240/1422 (87%)

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Tue Feb 10, 2015 11:43 pm 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
7 1027 bp mRNA linear 10-FEB-2015

DEFINITION

ACCESSION VERSION KEYWORDS SOURCE

ORGANISM


REFERENCE AUTHORS

TITLE JOURNAL
REFERENCE AUTHORS

TITLE JOURNAL
COMMENT FEATURES
source











gene CDS

Influenza A virus (A/Goose/Taiwan/0103/2015(H5N8)) matrix protein 2 (M2) and matrix protein 1 (Ml) genes , complete eds].



Viruses ; ssRNA negative-strand viruses; Orthomyxoviridae ; Influenzavirus A.
Viruses ; ssRNA negative-strand viruses; Orthomyxoviridae ; Influenzavirus A.
Unclassified.
1 (bases 1 to 1027)
Lee,M.S. , Chen , L.H ., Liu,Y .P., Chen,Y. P . , Li,W.C. , Lee, F. ,
Ting , L.J. and Lin,Y.L.
Avian influenza subtype HS in geese in Taiwan , 2015 Unpublished
2 (bases 1 to 1027)
Lee,M.S. , Chen,L.H . , Liu ,Y.P. , Chen ,Y.P. , Li , W.C . , Lee, F. ,
Ting,L.J . and Lin , Y.L. Direct Submission
Subm itted (10-FEB- 2015 ) Epidemiology Research Department, National Institute for Animal Health , Chung-Cheng Rd , Tansui, Taiwan 251, Taiwan
##Metadata-START##
Sequencing Technology :: Sanger dideoxy sequencing
##Metadata- END##
Location/Qualifiers 1 . .1027
/organism= "Viruses ; ssRNA negative-strand viruses ; Orthomyxoviridae ; Influenzavirus A. "
/mol type= "mRNA "
/strain= "A/Goose/Taiwan/0103/2015"
/isolation source= "organ"
/host= "goose "
/segment= "?"
/country= "Taiwan "
/collection_date= "2015-01-09 "
/identified_by= "RT-PCR "
/subtype= "H5N8 " 26 ..1007
/gene= "M2 "
join(26 . .51,740 . .1007)
/gene= "M2 "
/codon_start=l
/product= "matrix protein 2 "
/translation= "MSLLTEVETPTRTEWECRCSDSSDPLVVAANIIGILHLILWILD RLFFKCIYRRLKYGLKIGPSTEGVPESMREEYRQEQQSAVDVDDGHFVNIELE "

gene CDS







BASE COUNT ORIGIN

26 . .784
/gene= "Ml" 26 . .784
/gene= "Ml"
/codon_start= l
/product= "matrix protein l"
/translation= "MSLLTEVETYVLSIIPSGPLKAEIAQRLEDVFAGKNTDLEALME WLKTRPILSPLTKGILGFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDKAVKLYKK LKREITFHGAKEVALSYSTGALASCMGLIYNRMGTVTTEVAFGLVCATCEQIADSQHR SHRQMATITNPLIRHENRMVLASTTAKAMEQMAGSSEQASEAMEVANQARQMVQAMRT IGTHPNSSAGLRDNLLENLQAYQNRMGVQMQRFK"
294 a 221 c 269 g 243 t

1 agcaaaagca ggtagatatt gaaagatgag tcttctaacc gaggtcgaaa cgtacgttct
61 ctctatcatc ccgtcaggcc ccctcaaagc cgagatcgcg cagagacttg aagatgtctt
121 tgcagggaaa aacaccgatc tcgaggctct catggagtgg ctaaagacaa gaccaatcct
181 gtcacctctg actaaaggga ttttgggatt tgtgttcacg ctcaccgtgc ccagtgagcg
241 aggactgcag cgtagacgct tcgtccagaa tgccctaaat ggaaatgggg atccaaataa
301 tatggataag gcagttaagc tatataagaa gctgaaaaga gagataacat tccatggggc
361 taaggaggtc gcacttagct actcaaccgg tgcacttgcc agctgcatgg gtctcatata
421 caacaggatg ggaacggtga ctacagaagt ggcttttggc ctagtgtgtg ccacttgtga
481 gcagattgca gattcacagc atcggtccca cagacagatg gcaaccatca ccaacccatt
541 aatcagacat gagaacagaa tggtgctggc cagcactaca gctaaggcca tggagcagat 601 ggcaggatca agcgagcagg catcagaagc catggaggtt gctaatcagg ccaggcagat 661 ggtacaggca atgaggacaa ttgggactca tcctaattct agtgctggtc tgagagataa 721 tcttcttgaa aatttgcagg cctaccagaa ccgaatggga gtgcagatgc agcgattcaa 781 gtgatcctct tgttgttgcc gcaaatatca ttgggatcct gcacttgata ttgtggatcc 841 ttgatcgtct tttcttcaaa tgcatttatc gtcgccttaa atacggtttg aaaatagggc 901 cttctacgga aggggtacct gagtctatga gggaagagta ccggcaggaa cagcagagtg 961 ctgtggatgt tgacgatggt cattttgtca acatagaatt ggagtaaaaa actaccttgt
1021 ttctact

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Tue Feb 10, 2015 11:45 pm 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
EPI561700 A/spot-billed duck/Korea/H455-42/2014 (A/H5N8) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI561693 A/common teal/Korea/H455-30/2014 (A/H5N8) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI561684 A/tundra swan/Korea/H411/2014 (A/H5N8) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI561677 A/bean goose/Korea/H328/2014 (A/H5N8) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI561670 A/mallard/Korea/H297/2014 (A/H5N8) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI561656 A/breeder chicken/Korea/H250/2014 (A/H5N8) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI561649 A/breeder duck/Korea/H249/2014 (A/H5N8) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI561636 A/white-fronted goose/Korea/H231/2014 (A/H5N8) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI561629 A/mallard/Korea/H207/2014 (A/H5N8) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI561622 A/breeder duck/Korea/H200/2014 (A/H5N8) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI561601 A/broiler duck/Korea/H133/2014 (A/H5N8) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI561594 A/breeder duck/Korea/H128/2014 (A/H5N8) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI561580 A/breeder chicken/Korea/H122/2014 (A/H5N8) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI561573 A/Baikal teal/Korea/H96/2014 (A/H5N8) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI561566 A/Baikal teal/Korea/H84/2014 (A/H5N8) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI561559 A/Coot/Korea/H81/2014 (A/H5N8) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI561552 A/Baikal teal/Korea/H80/2014 (A/H5N8) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI561532 A/Baikal teal/Korea/H66/2014 (A/H5N8) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI561525 A/broiler duck/Korea/H65/2014 (A/H5N8) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI561511 A/bean goose/Korea/H53/2014 (A/H5N8) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI561351 A/broiler duck/Korea/H47/2014 (A/H5N8) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI561344 A/Baikal teal/Korea/H41/2014 (A/H5N8) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI561211 A/broiler duck/Korea/H31/2014 (A/H5N8) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI561199 A/broiler duck/Korea/H29/2014 (A/H5N8) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI561190 A/waterfowl/Korea/S005/2014 (A/H5N8) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI553211 A/crane/Kagoshima/KU1/2014 (A/H5N8) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI542633 A/mallard/Korea/W452/2014 (A/H5N8) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI517164 A/Chicken/Kumamoto/1-7/2014 (A/H5N8) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI509756 A/baikal teal/Korea/Donglim3/2014 (A/H5N8) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI509711 A/broiler duck/Korea/Buan2/2014 (A/H5N8) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI561708 A/bean goose/Korea/H40/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI561663 A/Korean native chicken/Korea/H257/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI561615 A/breeder duck/Korea/H158/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI561608 A/broiler duck/Korea/H145/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI561545 A/Baikal teal/Korea/H68/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI561518 A/Baikal teal/Korea/H62/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI561363 A/broiler duck/Korea/H49/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI561356 A/broiler duck/Korea/H48/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI554603 A/turkey/Germany-NI/R3372/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI553346 A/chicken/Miyazaki/7/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI552749 A/turkey/Germany/R2474-L00899/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI548627 A/chicken/Netherlands/14015531/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI547684 A/Chicken/Netherlands/14015526/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI558012 A/duck/England/36038/14 (A/H5N8) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI558005 A/duck/England/36226/14 (A/H5N8) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI553365 A/environment/Kagoshima/KU-ngr-H/2014 (A/H5N8) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI548496 A/duck/Chiba/26-372-61/2014 (A/H5N8) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI548488 A/duck/Chiba/26-372-48/2014 (A/H5N8) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI547676 A/duck/England/36254/14 (A/H5N8) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI555124 A/domestic duck/Germany-NI/R3468/2014 (A/H5N8) segment 7 (MP) 1796.1 0.000000e+00 976/978 (99%)
EPI553181 A/turkey/Italy/14VIR7898-10/2014 (A/H5N8) segment 7 (MP) 1796.1 0.000000e+00 976/978 (99%)
EPI548426 A/turkey/Germany-MV/R2472/2014 (A/H5N8) segment 7 (MP) 1796.1 0.000000e+00 976/978 (99%)
EPI542997 A/duck/Beijing/FS01/2013 (A/H5N8) segment 7 (MP) 1792.4 0.000000e+00 976/979 (99%)
EPI543005 A/duck/Beijing/FS01/2014 (A/H5N8) segment 7 (MP) 1786.8 0.000000e+00 975/979 (99%)
EPI431451 A/duck/Hebei/2/2011 (A/H5N2) segment 7 (MP) 1764.7 0.000000e+00 973/982 (99%)
EPI414241 A/duck/Jiangsu/1-15/2011 (A/H4N2) segment 7 (MP) 1759.1 0.000000e+00 972/982 (98%)
EPI398977 A/duck/Eastern China/1111/2011 (A/H5N2) segment 7 (MP) 1759.1 0.000000e+00 972/982 (98%)
EPI552763 A/eurasian wigeon/Netherlands/emc-1/2014 (A/H5N8) segment 7 (MP) 1716.7 0.000000e+00 947/955 (99%)
EPI475582 A/wild duck/Shandong/628/2011 (A/H5N1) segment 7 (MP) 1714.8 0.000000e+00 964/982 (98%)
EPI399963 A/duck/Jiangsu/m234/2012 (A/H5N2) segment 7 (MP) 1709.3 0.000000e+00 963/982 (98%)
EPI328891 A/duck/Eastern China/909/2009 (A/H5N1) segment 7 (MP) 1709.3 0.000000e+00 963/982 (98%)
EPI328875 A/duck/Eastern China/031/2009 (A/H5N5) segment 7 (MP) 1709.3 0.000000e+00 963/982 (98%)
EPI328867 A/duck/Eastern China/008/2008 (A/H5N5) segment 7 (MP) 1709.3 0.000000e+00 963/982 (98%)
EPI328883 A/duck/Eastern China/108/2008 (A/H5N1) segment 7 (MP) 1703.7 0.000000e+00 962/982 (97%)
EPI442028 A/quail/Jiangsu/k0104/2010 (A/H5N5) segment 7 (MP) 1698.2 0.000000e+00 961/982 (97%)
EPI398978 A/goose/Eastern China/1112/2011 (A/H5N2) segment 7 (MP) 1698.2 0.000000e+00 961/982 (97%)
EPI442004 A/goose/Shandong/k1204/2009 (A/H5N5) segment 7 (MP) 1687.1 0.000000e+00 960/983 (97%)
EPI431459 A/duck/Hebei/3/2011 (A/H5N2) segment 7 (MP) 1681.6 0.000000e+00 958/982 (97%)
EPI552779 A/chicken/Netherlands/emc-3/2014 (A/H5N8) segment 7 (MP) 1677.9 0.000000e+00 912/914 (99%)
EPI442020 A/duck/Jiangsu/k1203/2010 (A/H5N8) segment 7 (MP) 1676.0 0.000000e+00 957/982 (97%)
EPI493836 A/duck/Guangdong/wy24/2008 (A/H5N5) segment 7 (MP) 1670.5 0.000000e+00 956/982 (97%)
EPI493820 A/duck/Guangdong/wy11/2008 (A/H5N5) segment 7 (MP) 1670.5 0.000000e+00 956/982 (97%)
EPI442012 A/goose/Guangdong/k0103/2010 (A/H5N5) segment 7 (MP) 1670.5 0.000000e+00 958/984 (97%)
EPI280107 A/Shanghai/1/2006 (A/H5N1) segment 7 (MP) 1670.5 0.000000e+00 956/982 (97%)
EPI280099 A/Guangdong/1/2006 (A/H5N1) segment 7 (MP) 1670.5 0.000000e+00 956/982 (97%)
EPI227312 A/Mallard/Huadong/lk/2005 (A/H5N1) segment 7 (MP) 1670.5 0.000000e+00 956/982 (97%)
EPI164233 A/Sichuan/2/2006 (A/H5N1) segment 7 (MP) 1670.5 0.000000e+00 956/982 (97%)
EPI164225 A/Sichuan/1/2006 (A/H5N1) segment 7 (MP) 1670.5 0.000000e+00 956/982 (97%)
EPI111857 A/chicken/Guiyang/3923/2005 (A/H5N1) segment 7 (MP) 1670.5 0.000000e+00 956/982 (97%)
EPI106032 A/China/GD01/2006 (A/H5N1) segment 7 (MP) 1670.5 0.000000e+00 956/982 (97%)
EPI552771 A/eurasian wigeon/Netherlands/emc-2/2014 (A/H5N8) segment 7 (MP) 1666.8 0.000000e+00 908/911 (99%)
EPI493828 A/duck/Guangdong/wy19/2008 (A/H5N5) segment 7 (MP) 1665.0 0.000000e+00 956/983 (97%)
EPI399889 A/duck/HuBei/03/2010 (A/H5N5) segment 7 (MP) 1665.0 0.000000e+00 955/982 (97%)
EPI276073 A/shrike/Tibet/13/2006 (A/H5N1) segment 7 (MP) 1665.0 0.000000e+00 955/982 (97%)
EPI275985 A/duck/Hubei/49/2005 (A/H5N1) segment 7 (MP) 1665.0 0.000000e+00 955/982 (97%)
EPI275389 A/Anhui/2/2005 (A/H5N1) segment 7 (MP) 1665.0 0.000000e+00 955/982 (97%)
EPI251445 A/Anhui/1/2006 (A/H5N1) segment 7 (MP) 1665.0 0.000000e+00 955/982 (97%)
EPI251423 A/Sichuan/3/2006 (A/H5N1) segment 7 (MP) 1665.0 0.000000e+00 955/982 (97%)
EPI251419 A/Zhejiang/1/2006 (A/H5N1) segment 7 (MP) 1665.0 0.000000e+00 955/982 (97%)
EPI224780 A/Shanghai/1/2006 (A/H5N1) segment 7 (MP) 1665.0 0.000000e+00 955/982 (97%)
EPI167956 A/long-tailed shrike/Hong Kong/2762/2007 (A/H5N1) segment 7 (MP) 1665.0 0.000000e+00 955/982 (97%)
EPI164241 A/Anhui/2/2005 (A/H5N1) segment 7 (MP) 1665.0 0.000000e+00 955/982 (97%)
EPI164217 A/Anhui/1/2005 (A/H5N1) segment 7 (MP) 1665.0 0.000000e+00 955/982 (97%)
EPI127390 A/wild duck/Hunan/021/2005 (A/H5N1) segment 7 (MP) 1665.0 0.000000e+00 955/982 (97%)
EPI111872 A/duck/Guiyang/1558/2006 (A/H5N1) segment 7 (MP) 1665.0 0.000000e+00 955/982 (97%)
EPI111860 A/goose/Guiyang/4030/2005 (A/H5N1) segment 7 (MP) 1665.0 0.000000e+00 955/982 (97%)
EPI111674 A/duck/Hunan/5472/2005 (A/H5N1) segment 7 (MP) 1665.0 0.000000e+00 955/982 (97%)
EPI111656 A/goose/Shantou/3265/2006 (A/H5N1) segment 7 (MP) 1665.0 0.000000e+00 955/982 (97%)
EPI111644 A/goose/Guiyang/538/2006 (A/H5N1) segment 7 (MP) 1665.0 0.000000e+00 955/982 (97%)
EPI111632 A/chicken/Guiyang/4059/2005 (A/H5N1) segment 7 (MP) 1665.0 0.000000e+00 955/982 (97%)

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Tue Feb 10, 2015 11:47 pm 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
1 2341 bp mRNA linear 10- FEB- 2015
DEFINITION Influenza A virus (A/Goose/Taiwan/0103/2015(HSN8)) polymerase PB2 (PB2) gene, complete eds).

ACCESSION VERSION KEYWORDS SOURCE

ORGANI SM


REFERENCE AUTHORS

TITLE JOURNAL
REFERENCE AUTHORS

TITLE JOURNAL
COMMENT FEATURES
source











gene




Viruses; ssRNA negat ive-strand viruses; Orthomyxovir idae ; Influenzavirus A .
Viruses; ssRNA negative-strand viru ses; Orthomyxoviridae; Influenzavirus A.
Unclassified.
1 (bases 1 to 2341)
Lee,M.S. , Chen , L.H. , Liu,Y.P. , Chen, Y. P. , Li , W. C. , Lee, F. ,
Ting,L.J. and Lin, Y .L.
Avian influenza subtype HS in geese in Taiwan, 2015 Unpublished
2 (bases 1 to 2341)
Lee,M. S . , Chen , L .H . , Liu,Y.P. , Chen,Y.P. , Li,W. C. , Lee, F. ,
Ting , L .J. and Lin,Y.L . Direct Submission
Submitted (10- FEB-2015) Epidemiology Research Department , National
Institute for Animal Health, Chung- Cheng Rd, Tansui , Taiwan 251, Taiwan
##Metadata-START##
Sequencing Technology : : Sanger dideoxy sequencing
##Metadata-END##
Location/Qualifiers 1 . .2341
/organism= "Viruses; ssRNA negative -strand viruses; Orthomyxoviridae; Influenzavirus A. "
/mol type= "mRNA "
/strain= "A/Goose/Taiwan/0103/2015"
/isolation_source= "organ "
/host= "goose "
/segment= " l"
/country= "Taiwan "
/collection_date= "2015- 01-09 "
/identified by= "RT-PCR"
/subtype= "HSN8" 1 . .2341
/gene= " PB2 "

CDS 28 . .2307
/gene= " PB2 "
/codon start=l
/product="polyrnerase PB2 "
/translation= "MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPA LRMKWMMAMKYPITADKRIMEMIPERNEQGQTLWSKTNDAGSDRVMVSPLAVTWWNRN GPTASTVHYPKVYKTYFEKVERLKHGTFGPVHFRNQIKIRRRVDINPGHADLSAEEAQ DVIMEVVFPNEVGARILTSESQLTITKEKKEELQDCKIAPLMVAYMLERELVRKTRFL PVAGGTSSVYIEVLHLTQGTCWEQMYTPGGKVRNDDVDQSLIIAARNIVRRATVSADP LASLLEMCHSTQIGGTRMVDILRQNPTEEQAVDICKAAMGLRISSSFSFGGFTFKRTS GSSVRKEEEVLTGNLQTLKIRVHEGYEEFTMVGRRATAILRKATRRLIQLIVSGRDEQ SIAEAIIVAMVFSQEDCMIKAVRGDLNFVNRANQRLNPMHQLLRHFQKDAKVLFQNWG IEPIDNVMGMIGILPDMTPSTEMSLRGVRVSKMGVDEYSSTERVVVSIDRFLRVRDQQ GNVLLSPEEVSETLGTEKLTITYSSSMMWEINGPESVLVNTYQWIIRNWEIVKIQWSQ DPTMLYNKVEFEPFQSLVPKAARGQYSGFVRTLFQQMRDVLGTFDTIQIIKLLPFAAA PPEHSRMQFSSLTVNVRGSGMRILVRGNSPVFNYNKATKRLAVLGKDAGALTEDPDEG TTGVESAVLRGFLILGKEDRRYGPALSINELSNLAKGEKANVLIGQGDVVLVMKRKRD SSILTDSQTATKRIRMVIN "

BASE COUNT ORIGIN

795 a 446 c 590 g 510 t

1
61
121
181
241
301
361
421
481
541
601

agcaaaagca ggtcaaatat attcagtatg gagagaataa aagaactaag agatctaatg tctcaatccc gcactcgcga gatactaaca aaaaccactg tggaccatat ggccataatc aagaaataca catcaggaag acaagagaag aatcctgctc tcagaatgaa atggatgatg gcaatgaaat atccaatcac agcagacaag agaataatgg aaatgattcc tgaaagaaat gaacaaggcc agacgctttg gagcaagaca aatgatgctg gatcagacag agtgatggtg tctcccctag ctgtaacttg gtggaataga aatggaccaa cagcaagtac agtccattat ccaaaggtct acaaaacata ctttgagaag gttgaaaggt taaagcatgg aaccttcggt cccgttcact tccgaaacca aattaagata cgccgccgag ttgacataaa cccaggccat gcagatctca gtgccgaaga agcacaagat gtcatcatgg aggtcgtttt cccaaatgaa gtgggagcta gaatattgac atcagagtca caattgacaa taacgaaaga gaaaaaagaa gaactccagg attgcaagat tgctccttta atggtggcat acatgttgga aagagaactg

661 gtccgcaaaa ccagattcct accagtagca ggtgggacaa gcagtgtgta cattgaggta

721
781
841

ctgcacttga ctcaagggac ctgctgggaa cagatgtaca ctccaggcgg aaaagtgagg aatgacgatg ttgaccagag tttgatcatc gcggccagaa acattgtcag gagagcaacg gtatcagc'gg atccactggc atcattattg gagatgtgcc acagcacaca aattggtggg

901 acaaggatgg tggatattct taggcaaaat ccaactgagg aacaagctgt ggatatatgc 961 aaagcagcaa tgggtttgag gattagttca tcctttagct ttggaggatt caccttcaaa 1021 agaacaagtg gttcatccgt tagaaaggaa gaggaagtgc ttacaggcaa cctccaaaca 1081 ttgaaaataa gagtacatga ggggtatgag gagttcacaa tggttgggcg aagagcaaca 1141 gccattctaa ggaaagcaac tagaaggctg attcagttga tagtaagtgg aagagacgaa 1201 caatcaatcg ctgaagcaat catcgtagcc atggtgttct cacaggagga ttgcatgata 1261 aaggcagtcc gaggcgatct aaattttgtg aacagagcaa accaaagatt gaaccccatg 1321 catcaactcc tgagacactt ccaaaaagat gcaaaagtgc tgtttcaaaa ttgggggatt 1381 gaacctattg ataatgtcat ggggatgatt gggatattac ctgacatgac tccaagcaca 1441 gagatgtcac taagaggagt aagagttagt aaaatgggag tagatgaata ttccagcact 1501 gagagagtgg ttgtaagcat tgaccgtttc ttgcgggttc gagatcagca ggggaacgta 1561 ctcctatctc ccgaagaggt cagcgaaaca ctgggaacag aaaaattaac aataacatat 1621 tcatcatcaa tgatgtggga aatcaatggt cctgagtcag tgctggtcaa cacctatcaa 1681 tggatcatca gaaattggga aattgtgaag attcaatggt ctcaagaccc cacgatgctg 1741 tacaataagg tggagtttga accgttccaa tccttggtac ctaaagctgc cagaggccaa 1801 tacagtggat ttgtgagaac actgttccaa caaatgcgtg acgtattggg gacatttgat 1861 actattcaga taataaagct gttaccgttt gcagcagccc caccggagca tagcagaatg 1921 caattttctt ccctgaccgt gaatgtaaga ggctcgggaa tgagaatact cgtaaggggt 1981 aactcccctg tgttcaacta caataaggca accaaaaggc ttgcagtc ct tggaaaggac 2041 gcaggtgcat taacagagga tccagatgag gggacaacag gagtggaatc cgcagtactg 2101 agggggttcc taattctggg caaggaggac agaagatatg gaccagcact aagcatcaat 2161 gaactgagca atcttgcgaa aggggagaaa gccaatgtgc tgatagggca aggagacgtg 2221 gtgctggtaa tgaaacggaa acgggactct agcatactta ctgacagcca gacagcgacc 2281 aaaagaattc ggatggtcat caattagtat cgaattgttt aaaaacgacc ttgtttctac
2341 t

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Tue Feb 10, 2015 11:50 pm 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
EPI553205 A/crane/Kagoshima/KU1/2014 (A/H5N8) segment 1 (PB2) 4172.7 0.000000e+00 2273/2280 (99%)
EPI561702 A/bean goose/Korea/H40/2014 (A/H5N8) segment 1 (PB2) 4133.9 0.000000e+00 2266/2280 (99%)
EPI561672 A/bean goose/Korea/H328/2014 (A/H5N8) segment 1 (PB2) 4133.9 0.000000e+00 2266/2280 (99%)
EPI561631 A/white-fronted goose/Korea/H231/2014 (A/H5N8) segment 1 (PB2) 4133.9 0.000000e+00 2266/2280 (99%)
EPI561624 A/mallard/Korea/H207/2014 (A/H5N8) segment 1 (PB2) 4133.9 0.000000e+00 2266/2280 (99%)
EPI561568 A/Baikal teal/Korea/H96/2014 (A/H5N8) segment 1 (PB2) 4133.9 0.000000e+00 2266/2280 (99%)
EPI561540 A/Baikal teal/Korea/H68/2014 (A/H5N8) segment 1 (PB2) 4133.9 0.000000e+00 2266/2280 (99%)
EPI561527 A/Baikal teal/Korea/H66/2014 (A/H5N8) segment 1 (PB2) 4133.9 0.000000e+00 2266/2280 (99%)
EPI561506 A/bean goose/Korea/H53/2014 (A/H5N8) segment 1 (PB2) 4133.9 0.000000e+00 2266/2280 (99%)
EPI561358 A/broiler duck/Korea/H49/2014 (A/H5N8) segment 1 (PB2) 4133.9 0.000000e+00 2266/2280 (99%)
EPI561610 A/breeder duck/Korea/H158/2014 (A/H5N8) segment 1 (PB2) 4128.4 0.000000e+00 2265/2280 (99%)
EPI561603 A/broiler duck/Korea/H145/2014 (A/H5N8) segment 1 (PB2) 4128.4 0.000000e+00 2265/2280 (99%)
EPI561575 A/breeder chicken/Korea/H122/2014 (A/H5N8) segment 1 (PB2) 4128.4 0.000000e+00 2265/2280 (99%)
EPI561561 A/Baikal teal/Korea/H84/2014 (A/H5N8) segment 1 (PB2) 4128.4 0.000000e+00 2265/2280 (99%)
EPI561513 A/Baikal teal/Korea/H62/2014 (A/H5N8) segment 1 (PB2) 4128.4 0.000000e+00 2265/2280 (99%)
EPI561353 A/broiler duck/Korea/H48/2014 (A/H5N8) segment 1 (PB2) 4128.4 0.000000e+00 2265/2280 (99%)
EPI561339 A/Baikal teal/Korea/H41/2014 (A/H5N8) segment 1 (PB2) 4128.4 0.000000e+00 2265/2280 (99%)
EPI561679 A/tundra swan/Korea/H411/2014 (A/H5N8) segment 1 (PB2) 4122.8 0.000000e+00 2264/2280 (99%)
EPI561665 A/mallard/Korea/H297/2014 (A/H5N8) segment 1 (PB2) 4122.8 0.000000e+00 2264/2280 (99%)
EPI561651 A/breeder chicken/Korea/H250/2014 (A/H5N8) segment 1 (PB2) 4122.8 0.000000e+00 2264/2280 (99%)
EPI561644 A/breeder duck/Korea/H249/2014 (A/H5N8) segment 1 (PB2) 4122.8 0.000000e+00 2264/2280 (99%)
EPI561596 A/broiler duck/Korea/H133/2014 (A/H5N8) segment 1 (PB2) 4122.8 0.000000e+00 2264/2280 (99%)
EPI561589 A/breeder duck/Korea/H128/2014 (A/H5N8) segment 1 (PB2) 4122.8 0.000000e+00 2264/2280 (99%)
EPI561554 A/Coot/Korea/H81/2014 (A/H5N8) segment 1 (PB2) 4122.8 0.000000e+00 2264/2280 (99%)
EPI561547 A/Baikal teal/Korea/H80/2014 (A/H5N8) segment 1 (PB2) 4122.8 0.000000e+00 2264/2280 (99%)
EPI561520 A/broiler duck/Korea/H65/2014 (A/H5N8) segment 1 (PB2) 4122.8 0.000000e+00 2264/2280 (99%)
EPI561346 A/broiler duck/Korea/H47/2014 (A/H5N8) segment 1 (PB2) 4122.8 0.000000e+00 2264/2280 (99%)
EPI561201 A/broiler duck/Korea/H31/2014 (A/H5N8) segment 1 (PB2) 4122.8 0.000000e+00 2264/2280 (99%)
EPI561194 A/broiler duck/Korea/H29/2014 (A/H5N8) segment 1 (PB2) 4122.8 0.000000e+00 2264/2280 (99%)
EPI561185 A/waterfowl/Korea/S005/2014 (A/H5N8) segment 1 (PB2) 4122.8 0.000000e+00 2264/2280 (99%)
EPI542630 A/mallard/Korea/W452/2014 (A/H5N8) segment 1 (PB2) 4122.8 0.000000e+00 2264/2280 (99%)
EPI509707 A/baikal teal/Korea/Donglim3/2014 (A/H5N8) segment 1 (PB2) 4122.8 0.000000e+00 2264/2280 (99%)
EPI509702 A/broiler duck/Korea/Buan2/2014 (A/H5N8) segment 1 (PB2) 4122.8 0.000000e+00 2264/2280 (99%)
EPI561695 A/spot-billed duck/Korea/H455-42/2014 (A/H5N8) segment 1 (PB2) 4117.3 0.000000e+00 2263/2280 (99%)
EPI561658 A/Korean native chicken/Korea/H257/2014 (A/H5N8) segment 1 (PB2) 4117.3 0.000000e+00 2263/2280 (99%)
EPI561617 A/breeder duck/Korea/H200/2014 (A/H5N8) segment 1 (PB2) 4117.3 0.000000e+00 2263/2280 (99%)
EPI517158 A/Chicken/Kumamoto/1-7/2014 (A/H5N8) segment 1 (PB2) 4117.3 0.000000e+00 2263/2280 (99%)
EPI561688 A/common teal/Korea/H455-30/2014 (A/H5N8) segment 1 (PB2) 4111.8 0.000000e+00 2262/2280 (99%)
EPI553340 A/chicken/Miyazaki/7/2014 (A/H5N8) segment 1 (PB2) 4095.1 0.000000e+00 2259/2280 (99%)
EPI548490 A/duck/Chiba/26-372-61/2014 (A/H5N8) segment 1 (PB2) 4084.1 0.000000e+00 2257/2280 (98%)
EPI548482 A/duck/Chiba/26-372-48/2014 (A/H5N8) segment 1 (PB2) 4084.1 0.000000e+00 2257/2280 (98%)
EPI547679 A/Chicken/Netherlands/14015526/2014 (A/H5N8) segment 1 (PB2) 4084.1 0.000000e+00 2257/2280 (98%)
EPI552743 A/turkey/Germany/R2474-L00899/2014 (A/H5N8) segment 1 (PB2) 4078.5 0.000000e+00 2256/2280 (98%)
EPI548620 A/chicken/Netherlands/14015531/2014 (A/H5N8) segment 1 (PB2) 4078.5 0.000000e+00 2256/2280 (98%)
EPI547670 A/duck/England/36254/14 (A/H5N8) segment 1 (PB2) 4078.5 0.000000e+00 2256/2280 (98%)
EPI558008 A/duck/England/36038/14 (A/H5N8) segment 1 (PB2) 4073.0 0.000000e+00 2255/2280 (98%)
EPI558001 A/duck/England/36226/14 (A/H5N8) segment 1 (PB2) 4073.0 0.000000e+00 2255/2280 (98%)
EPI543007 A/duck/Beijing/CT01/2014 (A/H5N8) segment 1 (PB2) 4069.3 0.000000e+00 2251/2277 (98%)
EPI553359 A/environment/Kagoshima/KU-ngr-H/2014 (A/H5N8) segment 1 (PB2) 4067.4 0.000000e+00 2254/2280 (98%)
EPI542999 A/duck/Beijing/FS01/2014 (A/H5N8) segment 1 (PB2) 4060.1 0.000000e+00 2248/2277 (98%)
EPI553186 A/turkey/Italy/14VIR7898-10/2014 (A/H5N8) segment 1 (PB2) 4023.1 0.000000e+00 2231/2258 (98%)
EPI552773 A/chicken/Netherlands/emc-3/2014 (A/H5N8) segment 1 (PB2) 4023.1 0.000000e+00 2230/2256 (98%)
EPI552765 A/eurasian wigeon/Netherlands/emc-2/2014 (A/H5N8) segment 1 (PB2) 3980.7 0.000000e+00 2201/2224 (98%)
EPI475576 A/wild duck/Shandong/628/2011 (A/H5N1) segment 1 (PB2) 3978.8 0.000000e+00 2238/2280 (98%)
EPI552757 A/eurasian wigeon/Netherlands/emc-1/2014 (A/H5N8) segment 1 (PB2) 3971.4 0.000000e+00 2200/2225 (98%)
EPI442014 A/duck/Jiangsu/k1203/2010 (A/H5N8) segment 1 (PB2) 3962.2 0.000000e+00 2225/2265 (98%)
EPI399957 A/duck/Jiangsu/m234/2012 (A/H5N2) segment 1 (PB2) 3945.6 0.000000e+00 2232/2280 (97%)
EPI544889 A/duck/Shandong/Q1/2013 (A/H5N8) segment 1 (PB2) 3932.6 0.000000e+00 2229/2279 (97%)
EPI493814 A/duck/Guangdong/wy11/2008 (A/H5N5) segment 1 (PB2) 3862.5 0.000000e+00 2218/2281 (97%)
EPI493822 A/duck/Guangdong/wy19/2008 (A/H5N5) segment 1 (PB2) 3851.4 0.000000e+00 2215/2280 (97%)
EPI493830 A/duck/Guangdong/wy24/2008 (A/H5N5) segment 1 (PB2) 3779.4 0.000000e+00 2202/2280 (96%)
EPI548431 A/turkey/Germany-MV/R2472/2014 (A/H5N8) segment 1 (PB2) 3773.8 0.000000e+00 2088/2111 (98%)
EPI328897 A/duck/Eastern China/909/2009 (A/H5N1) segment 1 (PB2) 3724.0 0.000000e+00 2192/2280 (96%)
EPI328889 A/duck/Eastern China/108/2008 (A/H5N1) segment 1 (PB2) 3718.4 0.000000e+00 2191/2280 (96%)
EPI328881 A/duck/Eastern China/031/2009 (A/H5N5) segment 1 (PB2) 3718.4 0.000000e+00 2191/2280 (96%)
EPI328873 A/duck/Eastern China/008/2008 (A/H5N5) segment 1 (PB2) 3718.4 0.000000e+00 2191/2280 (96%)
EPI441998 A/goose/Shandong/k1204/2009 (A/H5N5) segment 1 (PB2) 3685.2 0.000000e+00 2186/2281 (95%)
EPI442006 A/goose/Guangdong/k0103/2010 (A/H5N5) segment 1 (PB2) 3679.6 0.000000e+00 2184/2280 (95%)
EPI398954 A/goose/Eastern China/1112/2011 (A/H5N2) segment 1 (PB2) 3640.9 0.000000e+00 2179/2282 (95%)
EPI431453 A/duck/Hebei/3/2011 (A/H5N2) segment 1 (PB2) 3624.2 0.000000e+00 2177/2283 (95%)
EPI431445 A/duck/Hebei/2/2011 (A/H5N2) segment 1 (PB2) 3624.2 0.000000e+00 2175/2281 (95%)
EPI414235 A/duck/Jiangsu/1-15/2011 (A/H4N2) segment 1 (PB2) 3624.2 0.000000e+00 2176/2282 (95%)
EPI326731 A/environment/Korea/CSM3/2002 (A/H3N6) segment 1 (PB2) 3602.1 0.000000e+00 2167/2275 (95%)
EPI398953 A/duck/Eastern China/1111/2011 (A/H5N2) segment 1 (PB2) 3591.0 0.000000e+00 2170/2282 (95%)
EPI387471 A/canvasback/Mongolia/2-69/2007 (A/H10) segment 1 (PB2) 3587.3 0.000000e+00 2168/2280 (95%)
EPI387371 A/whooper swan/Mongolia/1-14/2007 (A/H3N8) segment 1 (PB2) 3587.3 0.000000e+00 2168/2280 (95%)
EPI387468 A/ruddy shelduck/Mongolia/2-29/2007 (A/H3N2) segment 1 (PB2) 3581.8 0.000000e+00 2167/2280 (95%)
EPI387467 A/pintail/Mongolia/2-11/2007 (A/H4N2) segment 1 (PB2) 3574.4 0.000000e+00 2165/2279 (94%)
EPI387473 A/pintail/Mongolia/2-80/2007 (A/H4N6) segment 1 (PB2) 3572.5 0.000000e+00 2162/2275 (95%)
EPI272278 A/duck/Korea/A14/2008 (A/H5N2) segment 1 (PB2) 3563.3 0.000000e+00 2165/2282 (94%)
EPI387375 A/whooper swan/Mongolia/1-25/2007 (A/H3N8) segment 1 (PB2) 3557.8 0.000000e+00 2163/2280 (94%)
EPI231142 A/spot-billed duck/Korea/527/2008 (A/H6N1) segment 1 (PB2) 3546.7 0.000000e+00 2162/2282 (94%)
EPI231150 A/spot-billed duck/Korea/528/2008 (A/H6N8) segment 1 (PB2) 3543.0 0.000000e+00 2158/2277 (94%)
EPI401351 A/wild duck/Korea/SH5-60/2008 (A/H4N6) segment 1 (PB2) 3541.1 0.000000e+00 2162/2283 (94%)
EPI231182 A/spot-billed duck/Korea/540/2008 (A/H6N1) segment 1 (PB2) 3537.5 0.000000e+00 2153/2271 (94%)
EPI469140 A/duck/Guangdong/4323/2007 (A/H11N9) segment 1 (PB2) 3533.8 0.000000e+00 2159/2282 (94%)
EPI387376 A/ruddy shelduck/Mongolia/1-26/2007 (A/H3N8) segment 1 (PB2) 3533.8 0.000000e+00 2139/2251 (95%)
EPI231190 A/spot-billed duck/Korea/545/2008 (A/H6N1) segment 1 (PB2) 3531.9 0.000000e+00 2152/2271 (94%)
EPI231174 A/spot-billed duck/Korea/537/2008 (A/H6N1) segment 1 (PB2) 3531.9 0.000000e+00 2152/2271 (94%)
EPI508024 A/wild duck/Korea/CSM27-12/2009 (A/H7N6) segment 1 (PB2) 3530.1 0.000000e+00 2159/2282 (94%)
EPI503958 A/wild duck/SH17-1/2008 (A/H2N3) segment 1 (PB2) 3530.1 0.000000e+00 2160/2283 (94%)
EPI272279 A/duck/Korea/A93/2008 (A/H5N2) segment 1 (PB2) 3530.1 0.000000e+00 2159/2282 (94%)
EPI231206 A/spot-billed duck/Korea/619/2008 (A/H6N2) segment 1 (PB2) 3530.1 0.000000e+00 2159/2282 (94%)
EPI21386 A/duck/Zhejiang/11/2000 (A/H5N1) segment 1 (PB2) 3530.1 0.000000e+00 2158/2281 (94%)
EPI387374 A/whooper swan/Mongolia/1-23/2007 (A/H3N8) segment 1 (PB2) 3526.4 0.000000e+00 2158/2281 (94%)
EPI508023 A/wild duck/Korea/SH20-27/2008 (A/H7N9) segment 1 (PB2) 3524.5 0.000000e+00 2159/2283 (94%)
EPI227118 A/duck/Beijing/61/05 (A/H3N8) segment 1 (PB2) 3524.5 0.000000e+00 2158/2282 (94%)
EPI469202 A/duck/Jiangxi/3286/2009 (A/H7N9) segment 1 (PB2) 3519.0 0.000000e+00 2157/2282 (94%)
EPI469201 A/duck/Jiangxi/3230/2009 (A/H7N9) segment 1 (PB2) 3519.0 0.000000e+00 2157/2282 (94%)
EPI469200 A/duck/Jiangxi/3214/2009 (A/H7N9) segment 1 (PB2) 3519.0 0.000000e+00 2157/2282 (94%)

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Tue Feb 10, 2015 11:53 pm 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
2 2340 bp mRNA linear 10-FEB-2015
DEFINITION Influenza A virus (A/Goose/Taiwan/0103/201S(HSN8)) polymerase PBl (PBl) gene , complete eds].

ACCESSION VERSION KEYWORDS SOURCE

ORGANISM


REFERENCE AUTHORS

TITLE JOURNAL
REFERENCE AUTHORS

TITLE JOURNAL
COMMENT FEATURES
source











gene CDS




Viruses ; ssRNA negative-strand viruses ; Orthom yxoviridae ; Influenzavirus A.
Viruses ; ssRNA negative-strand viru ses; Orthomyxoviridae ; Influenzavirus A .
Unclass ified.
1 (bases 1 to 2340 )
Lee,M .S., Chen,L.H. , Liu,Y. P ., Chen,Y.P. , Li,W.C. , Lee, F. ,
Ting ,L.J. and Lin , Y.L .
Avian influenza subtype HS in geese in Taiwan, 2015 Unpubli shed
2 (bases 1 to 2340 )
Lee,M.S ., Chen , L.H. , Liu,Y .P., Chen,Y .P. , Li,W .C. , Lee , F. ,
Ting,L .J. and Lin,Y .L. Direc Submission
Submitted (10- FEB- 2015) Epidemiology Research Department , Nationa l Institute for Animal Health, Chung- Cheng Rd , Tansui, Taiwan 251, Taiwan
##Metadata-START##
Sequencing Technology :: Sanger dideoxy sequencing
##Metadata-END##
Location/Qualifiers
1. . 2340
/organism="Viruses ; ssRNA negative-strand viruses; Orthomyxoviridae ; Influenzavirus A. "
/mol type= "mRNA "
/strain= "A/Goose/Taiwan/0103/2015"
/isolation_source= "organ"
/host= "goose"
/segment= "2 "
/country= "Taiwan"
/collection_date= " 2015- 0l-09 "
/identified by= "RT-PCR"
/subtype= "HSN8 " 1 . .2340
/gene= " PBl" 24 ..2297
/gene= "PBl"
/codon start=l
/translation= "MDVNPTLLFLKV PAQNAISTTFPYTGDPPYSHGTGTGYTMDTVN RTHQYSEKGKWTTNTETGAPQLNPIDGPLPEDNEPSGYAQTDCVLEAMAFLEESHPGI FENSCLETMEVVQQTRVDKLTQGRQTYDWTLNRNQPAATALANTIEVFRSNGLAANES GRLIDFLKDVMESMDKEEMEITTHFQRKRRVRDNMTKKMVTQRTIGKKKQRLNKRSYL IRALTLNTMTKDAERGKLKRRAIATPGMQIRGFVYFVETLARSICEKLEQSGLPVGGN EKKAKLANVVRKMMTNSQDTELSFTITGDNTKWNENQNPRMFLAMITYITRNQPEWFR









gene CDS




BASE COUNT ORIGIN

NVLSIAPIMFSNKMARLGKGYMFESKSMKLRTQIPAEMLANIDLKYFNESTRKKIEKI RPLLIDGTASLSPGMMMGMFNMLSTVLGVSILNLGQKRYTKTTYWWDGLQSSDDFALI VNAPNHEGIQAGVDRFYRTCKLVGINMSKKKSYINRTGTFEFTSFFYRYGFVANFSME LPSFGVSGINESADMSIGVTVIKNNMINNDLGPATAQMALQLFIKDYRYTYRCHRGDT QIQTRRSFELKKLWEQTRSKAGLLVSDGGPNLYNIRNLHIPEVCLKWELMDEDYQGRL CNPQNPFVSHKEIESVNNAVVMPAHGPAKSMEYDAVATTHLWIPKRNRSILNTSQRG I LEDEQMYQKCCSLFEKFFPSSSYRRPVGISSMVEAMVSRARIDARIDFESGRIKKEEF AEIMKICSTIEELRRQK "
118 . .390
lgene= " PB1-F2 " 118 . .390
lgene= "PB1-F2 " lcodon_ start= l
lproduct= "PB1-F2 protein "
ltranslation = "MEQEQDIPWTQSTEHINTQRRESGQQTQRPEHPNSTQLMDHYRR TMSQADMHKQTACWKQWLSLKNPTQGSLKTLVLKRWKSFSKQEWTN "
792 a 474 c 564 g 510 t

1 agcgaaagca ggcaaccatt tgaatggatg tcaatccgac tttacttttc ttaaaagtgc
61 cagcgcaaaa tgctataagc actacattcc cttacactgg agatcctcca tacagccatg
121 gaacaggaac aggatatacc atggacacag tcaacagaac acatcaatac tcagagaagg
181 gaaagtggac aacaaacaca gagaccggag caccccaact caacccaatt gatggaccat
241 taccggagga caatgagcca agcggatatg cacaaacaga ctgcgtgttg gaagcaatgg 301 ctttccttga agaatcccac ccagggatct ttgaaaactc ttgtcttgaa acgatggaag
361 tcgttcagca aacaagagtg gacaaactaa cccaaggtcg ccagacttat gactggacac
421 tgaatagaaa ccaaccggct gcaactgctt tggccaacac tatagaagtc ttcagatcga
481 atggtctggc ggccaatgaa tcggggagac taatagattt cctcaaggat gtgatggagt
541 caatggataa agaagaaatg gaaataacaa cacatttcca gagaaagaga agggtaagag 601 acaacatgac caagaagatg gtcacacaaa gaacaatagg gaagaagaag caaaggctaa 661 acaagaggag ctatttgata agagcactga cactgaacac aatgacaaaa gatgcagaac 721 gaggcaaatt gaagaggcgg gcaattgcaa cacccgggat gcagattaga ggattcgtgt 781 attttgtcga aacactagcg aggagcatct gtgagaaact cgagcaatct gggctccc tg 841 ttggagggaa tgagaagaag gctaaattgg caaatgtcgt gagaaaaatg atgactaact 901 cacaagatac agagctttcc ttcacaatca caggagacaa caccaaatgg aatgagaatc 961 aaaatcctcg gatgtttttg gcaatgataa catacatcac aaggaatcaa cctgaatggt 1021 ttaggaatgt cttgagcatt gcccctataa tgttctcaaa caaaatggca agattaggga 1081 aaggatacat gtttgaaagt aagagcatga agctacggac acaaataccg gcagaaatgc 1141 ttgcaaacat tgacttgaaa tacttcaacg aatccacgag aaagaaaatc gagaaaataa 1201 gacc tctgct gatcgatggc acagcctcat tgagtcctgg aatgatgatg ggcatgttca 1261 acatgctgag cacagtac ta ggggtctcaa tcctgaatct tggacaaaag aggtacacca 1321 aaaccacata ctggtgggat ggacttcaat cctctgatga tttcgctctc atagtgaatg 1381 cgccgaatca tgaggggata caagcaggag tggataggtt ctataggact tgcaaactgg 1441 ttgggatcaa catgagcaaa aagaagtctt acataaaccg gacagggaca tttgagttca 1501 caagcttttt ctatcgctac ggatttgtag ccaacttcag tatggagcta cccagctttg 1561 gagtatctgg gatcaatgaa tcggctgaca tgagcattgg agtcacagtg ataaaaaaca 1621 atatgataaa caatgatctt ggaccagcaa cagctcagat ggctctccaa ctattcatca 1681 aagactatag gtacacatac cgatgccaca ggggtgatac acaaattcaa acgaggagat 1741 cattcgagct gaagaagctg tgggagcaga cccgttcaaa ggcagggctg ttggtatcag 1801 atggagggcc aaatctatac aacattcgga atctccacat cccagaggtc tgcttgaagt 1861 gggaactgat ggatgaagat taccagggca ggctgtgtaa tcctcagaac ccgtttgtta 1921 gtcataagga aattgagtcc gtaaacaatg ctgtggtaat gccagcccat ggtccggcca 1981 agagcatgga atatgatgct gttgcgacta cacatttatg gattcctaag aggaaccgtt 2041 ccattctcaa taccagccaa aggggaatcc ttgaggatga gcagatgtac cagaagtgct 2101 gcagtctatt cgagaaattc ttccccagta gttcatacag gaggccagtt ggaatttcca 2161 gcatggtgga ggccatggtg tctagggccc gaattgatgc acgcattgat ttcgaatctg 2221 gaaggatcaa gaaagaagag tttgctgaga tcatgaagat ctgttccacc attgaagagc 2281 tcagacggca aaaatagtga atttagcttg tccttcatga gaaaatgcct tgtttctact

_________________
www.twitter.com/hniman


Top
 Profile  
 
Display posts from previous:  Sort by  
Post new topic Reply to topic  [ 26 posts ]  Go to page 1, 2, 3  Next

All times are UTC - 5 hours [ DST ]


Who is online

Users browsing this forum: No registered users and 58 guests


You cannot post new topics in this forum
You cannot reply to topics in this forum
You cannot edit your posts in this forum
You cannot delete your posts in this forum
You cannot post attachments in this forum

Search for:
Jump to:  
cron
Powered by phpBB® Forum Software © phpBB Group