Rhiza Labs FluTracker Forum

The place to discuss the flu
It is currently Mon Oct 16, 2017 6:01 pm

All times are UTC - 5 hours [ DST ]




Post new topic Reply to topic  [ 13 posts ]  Go to page 1, 2  Next
Author Message
PostPosted: Thu Jan 22, 2015 6:36 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
Media reports cite sequences most closely related to Fujian H5N2 from Taiwan. The only internal gene segments closely related to Korean H5N8 are MP and NS.

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Thu Jan 22, 2015 6:37 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
The Guardian home: new non-self Taiwanese H5N2 mutation
2015-01-22 13:36:03 CNA Taipei 22 (Xinhua)
Animal Health Research Council of Agriculture today announced the new director Cai Xiangrong H5N2 and H5N8 internal 6 gene segment, saying Wei 7 days would be at home in the official website announced, and with the old section of the fund six different internal H5N2, the virus does not exist in Taiwan variation come.

Cai Xiangrong released, the ducks and geese in the highly pathogenic avian influenza H5N2 and H5N8 novel internal gene segments than 6 results, including MP and 2011 Jiangsu duck H4N2 is most similar to the M1 (99%).

NS 2014 with South Korea Pakistan's duck H5N8 NS1 most similar (99%), NP and NP H3N8 2011 Mongolia duck most similar (98%), PA and in 2004 Japan's Shiga duck H4N6 closest PA (98%) .

PB1 and 2011 Hunan Dongting geese H12N8 of PB1 most similar (97%), PB2 with the 2011 Hunan Dongting geese H12N8 the PB2 most similar (98%).

He said that compared to the conclusions show that ducks and geese avian influenza virus HA gene with South Korea and N8 H5N8 strain is most similar, N2, and the other six internal gene segments are attached to the internal genes of avian influenza virus in mainland China pool.

Cai Xiangrong further judgment, ducks and geese bird flu virus is a new virus invasion, not a virus strain evolution Taiwan produce.

Eight gene segments of all avian influenza viruses released, he said the two Taiwanese emerging virus gene segments and six external N, H gene, published in 7 days, other viruses in the epidemic ended, than there are human will be announced later.

http://udn.com/news/story/1/659267

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Thu Jan 22, 2015 6:39 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
Internal genes most closely related to the isolates below

PB2 goose/Hunan Dongting/2011 H12N8 98% A/wild goose/Dongting/C1037/2011
PB1 goose/Hunan Dongting/2011 H12N8 97% A/wild goose/Dongting/C1037/2011
PA duck/Japan Shiga/2004 H4N6 98% A/duck/Shiga/8/2004
NP duck//Mongolia/2011 H3N8 98% A/common shelduck/Mongolia/2185/2011?
MP duck/Jiangsu/2011 H4N2 99% A/duck/Jiangsu/1-15/2011

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Thu Jan 22, 2015 6:52 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
LOCUS KC876688 2341 bp cRNA linear VRL 04-NOV-2013
DEFINITION Influenza A virus (A/wild goose/Dongting/C1037/2011(H12N8)) segment
1 polymerase PB2 (PB2) gene, complete cds.
ACCESSION KC876688
VERSION KC876688.1 GI:485085738
KEYWORDS .
SOURCE Influenza A virus (A/wild goose/Dongting/C1037/2011(H12N8))
ORGANISM Influenza A virus (A/wild goose/Dongting/C1037/2011(H12N8))
Viruses; ssRNA negative-strand viruses; Orthomyxoviridae;
Influenzavirus A.
REFERENCE 1 (bases 1 to 2341)
AUTHORS Zhang,H., Li,Z., Yang,H., Liu,Y., Li,F., Wang,L., Li,X., Zhu,Y.,
Cai,Y., Bai,Z., Yi,F. and Shu,Y.
TITLE Complete Genome Sequence of an H12N8 Avian Influenza Virus Isolated
from Wild Bird Feces in Hunan East Dongting Lake National Nature
Reserve
JOURNAL Genome Announc 1 (5), e00891-13 (2013)
PUBMED 24158557
REMARK Publication Status: Online-Only
REFERENCE 2 (bases 1 to 2341)
AUTHORS Zhu,Y.
TITLE Direct Submission
JOURNAL Submitted (09-APR-2013) Chinese National Influenza Center, National
Institute for Viral Disease Control and Prevention, 155 Changbai
Road, Beijing, Beijing 102206, P. R China
COMMENT GenBank Accession Numbers KC876688-KC876695 represent sequences
from the 8 segments of Influenza A virus (A/wild
goose/Dongting/C1037/2011(H12N8)).

##Assembly-Data-START##
Sequencing Technology :: Sanger dideoxy sequencing
##Assembly-Data-END##
FEATURES Location/Qualifiers
source 1..2341
/organism="Influenza A virus (A/wild
goose/Dongting/C1037/2011(H12N8))"
/mol_type="viral cRNA"
/strain="A/wild goose/Dongting/C1037/2011"
/serotype="H12N8"
/isolation_source="feces"
/host="wild goose"
/db_xref="taxon:1317097"
/segment="1"
/country="China"
/collection_date="10-Nov-2011"
gene 28..2307
/gene="PB2"
CDS 28..2307
/gene="PB2"
/codon_start=1
/product="polymerase PB2"
/protein_id="AGK72299.1"
/db_xref="GI:485085739"
/translation="MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPA
LRMKWMMAMKYPITADKRIMEMIPERNEQGQTLWSKTNDAGSDRVMVSPLAVTWWNRN
GPTTSTVHYPKVYKTYFEKVERLKHGTFGPVHFRNQVKIRRRVDINPGHADLSAKEAQ
DVIMEVVFPNEVGARILTSESQLTITKEKKEELQDCKIAPLMVAYMLERELVRKTRFL
PVAGGTSSVYIEVLHLTQGTCWEQMYTPGGEVRNDDVDQSLIIAARNIVRRATVSADP
LASLLEMCHSTQIGGIRMVDILRQNPTEEQAVDICKAAMGLRISSSFSFGGFTFKRTS
GSSVKREEEVLTGNLQTLKIRVHEGYEEFTMVGRRATAILRKATRRLIQLIVSGKDEQ
SIAEAIIVAMVFSQEDCMIKAVRGDLNFVNRANQRLNPMHQLLRHFQKDAKVLFQNWG
IEPIDNVMGMIGILPDMTPSTEMSLRGVRVSKMGVDEYSSTERVVVSIDRFLRVRDQR
GNVLLSPEEVSETQGTEKLTITYSSSMMWEINGPESVLVNTYQWIIRNWETVKIQWSQ
DPTMLYNKMEFEPFQSLVPKAARGQYSGFVRTLFQQMRDVLGTFDTVQIIKLLPFAAA
PPEQSRMQFSSLTVNVRGSGMRILVRGNSPVFNYNKATKRLTVLGKDAGALTEDPDEG
TAGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGEKANVLIGQGDVVLVMKRKRD
SSILTDSQTATKRIRMAIN"
ORIGIN
1 agcgaaagca ggtcaattat attcaatatg gagagaataa aagaactaag agatttgatg
61 tcgcagtctc gcactcgcga gatactgaca aaaaccaccg tggaccatat ggccataatt
121 aagaaataca cgtcaggaag acaggagaag aatcctgccc ttaggatgaa atggatgatg
181 gcaatgaaat atccgattac agcagacaaa agaataatgg aaatgatccc cgaaagaaat
241 gaacaaggtc agactctctg gagcaaaaca aatgatgctg gatcagacag agtgatggtg
301 tcacctctgg ctgtgacatg gtggaataga aatgggccga cgacaagtac agtccactat
361 ccaaaggtct acaaaaccta ctttgaaaaa gtcgaaaggt tgaaacatgg aaccttcggt
421 cctgttcact ttcgaaatca ggttaaaata cgccgcaggg ttgacataaa cccgggccat
481 gcagatctca gtgccaaaga agcacaagat gtcatcatgg aggtcgtttt cccaaacgaa
541 gttggagcca ggatattgac atcagagtca caattaacaa taacaaagga aaagaaggag
601 gagcttcagg actgtaaaat cgctcctttg atggtggcat acatgttgga gagagaactg
661 gttcgcaaaa ccagattcct accagtagct ggcggaacaa gcagcgtgta tatcgaggta
721 ttgcatttga ctcaaggaac ctgctgggaa caaatgtaca caccgggagg ggaggtgaga
781 aatgatgatg tcgatcagag tttgatcatt gctgctagaa atattgttag gagagcaaca
841 gtatcagcag acccgttggc ttcgctcttg gagatgtgcc atagtacaca aattggcggg
901 ataaggatgg tggacattct tagacagaac ccaacagaag agcaagctgt ggatatatgc
961 aaagcagcaa tgggtttgag aatcagttca tccttcagct ttggaggttt cactttcaaa
1021 agaacaagtg ggtcatctgt caaaagagaa gaagaagtgc tcacaggcaa cctccaaaca
1081 ttgaaaataa gagtacatga agggtatgaa gaattcacaa tggttgggcg aagagctaca
1141 gccattctaa ggaaagcaac cagaaggctg atccaattaa tagtgagtgg gaaagatgag
1201 cagtcaatcg ctgaagcgat tatagtggca atggttttct cacaagagga ttgcatgata
1261 aaagcagtac gaggtgattt gaattttgtt aacagagcaa atcagcggct aaatcctatg
1321 catcaacttt tgaggcattt ccaaaaggat gcaaaggtgc tgtttcaaaa ctggggaatt
1381 gaaccaattg acaatgtcat ggggatgatc ggaatactgc ctgacatgac ccccagcaca
1441 gagatgtcac tgagaggagt aagagtcagt aaaatgggag tggatgaata ttccagtact
1501 gagagagtgg tcgtgagcat tgatcgtttc ttgagagtcc gagatcagag gggaaacgta
1561 ctcttgtctc ctgaagaagt tagtgaaaca cagggaacag agaaactgac gataacatat
1621 tcatcgtcta tgatgtggga aatcaatggt ccggaatcag tgctagtcaa cacataccaa
1681 tggatcatta gaaattggga aactgtgaaa attcaatggt cccaagaccc tacaatgttg
1741 tacaataaga tggagtttga gcccttccaa tccttggtgc ccaaggctgc cagaggccag
1801 tatagtggat ttgtgaggac gttattccaa cagatgcgtg atgtgctggg gacatttgac
1861 actgtccaaa taataaagct cctaccattt gcagcagccc caccggaaca gagtaggatg
1921 cagttctctt ctctgacggt gaatgtaaga ggttcaggaa tgagaatcct tgtgagaggc
1981 aactcccctg tgttcaacta taacaaggca accaagagac tcacagtcct tggaaaggat
2041 gcaggtgcat tgacagaaga tccagatgag ggaacagcag gagtggaatc tgcggtatta
2101 agaggatttc taattctggg caaagaagac aaaagatatg gaccagcatt gagcatcaac
2161 gaattgagca atcttgcgaa aggggagaag gctaatgtgt tgatagggca aggagacgtg
2221 gtgttggtaa tgaaacggaa acgggactct agcatactta ctgacagcca gacagcgacc
2281 aaaaggattc ggatggccat caattagtgt cgaattgttt aaaaacgacc ttgtttctac
2341 t

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Thu Jan 22, 2015 6:54 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
EPI446495 A/wild goose/Dongting/C1037/2011 (A/H12N8) segment 1 (PB2) 4211.5 0.000000e+00 2280/2280 (100%)
EPI493021 A/wild waterfowl/Dongting/C2383/2012 (A/H1N2) segment 1 (PB2) 4122.8 0.000000e+00 2264/2280 (99%)
EPI469137 A/duck/Jiangxi/22537/2012 (A/H11N9) segment 1 (PB2) 4111.8 0.000000e+00 2262/2280 (99%)
EPI469138 A/duck/Jiangxi/22597/2012 (A/H11N9) segment 1 (PB2) 4100.7 0.000000e+00 2260/2280 (99%)
EPI513369 A/mallard/Sweden/101900/2009 (A/H4N3) segment 1 (PB2) 4045.3 0.000000e+00 2250/2280 (98%)
EPI375105 A/wild bird/Korea/A330/09 (A/H7N7) segment 1 (PB2) 4039.7 0.000000e+00 2249/2280 (98%)
EPI513202 A/mallard/Sweden/124418/2010 (A/H4N6) segment 1 (PB2) 4028.7 0.000000e+00 2247/2280 (98%)
EPI513195 A/mallard/Sweden/124228/2010 (A/H4N6) segment 1 (PB2) 4028.7 0.000000e+00 2247/2280 (98%)
EPI375106 A/wild bird/Korea/A331/09 (A/H7N7) segment 1 (PB2) 4025.0 0.000000e+00 2241/2272 (98%)
EPI375107 A/pintail/Korea/1173/09 (A/H7N7) segment 1 (PB2) 4008.4 0.000000e+00 2240/2275 (98%)
EPI544771 A/chicken/Shanghai/LPM2/2013 (A/H3N2) segment 1 (PB2) 3978.8 0.000000e+00 2238/2280 (98%)
EPI461626 A/duck/Hunan/S1256/2012 (A/H3N8) segment 1 (PB2) 3971.4 0.000000e+00 2236/2280 (98%)
EPI222084 A/garganey/Altai/1213/2007 (A/H5N2) segment 1 (PB2) 3951.1 0.000000e+00 2233/2280 (97%)
EPI508029 A/wild duck/Korea/SH19-47/2010 (A/H7N9) segment 1 (PB2) 3945.6 0.000000e+00 2232/2280 (97%)
EPI508028 A/wild duck/Korea/SH19-44/2010 (A/H7N9) segment 1 (PB2) 3945.6 0.000000e+00 2232/2280 (97%)
EPI508027 A/wild duck/Korea/SH19-27/2010 (A/H7N9) segment 1 (PB2) 3945.6 0.000000e+00 2232/2280 (97%)
EPI508026 A/wild duck/Korea/SH19-50/2010 (A/H7N9) segment 1 (PB2) 3943.7 0.000000e+00 2231/2279 (97%)
EPI401308 A/duck/Korea/DY104/2007 (A/H4N6) segment 1 (PB2) 3940.0 0.000000e+00 2231/2280 (97%)
EPI372328 A/shoveler/Egypt/00134-NAMRU3/2005 (A/H1N1) segment 1 (PB2) 3936.3 0.000000e+00 2230/2280 (97%)
EPI515121 A/duck/Vietnam/LBM533/2013 (A/H3N6) segment 1 (PB2) 3928.9 0.000000e+00 2229/2280 (97%)
EPI508034 A/wild duck/Korea/MHC39-26/2011(H7N9) (A/H7N9) segment 1 (PB2) 3928.9 0.000000e+00 2229/2280 (97%)
EPI508033 A/wild duck/Korea/MHC39-13/2011(H7N9) (A/H7N9) segment 1 (PB2) 3928.9 0.000000e+00 2229/2280 (97%)
EPI508031 A/wild duck/Korea/MHC35-41/2011 (A/H7N9) segment 1 (PB2) 3928.9 0.000000e+00 2229/2280 (97%)
EPI221960 A/environment/Dongting Lake/Hunan/3-9/2007 (A/H10N8) segment 1 (PB2) 3928.9 0.000000e+00 2229/2280 (97%)
EPI221952 A/water/Dongting Lake/Hunan/3-9/2007 (A/H10N8) segment 1 (PB2) 3928.9 0.000000e+00 2229/2280 (97%)
EPI508032 A/wild duck/Korea/MHC35-25/2011 (A/H7N9) segment 1 (PB2) 3923.4 0.000000e+00 2228/2280 (97%)
EPI221968 A/environment/Dongting Lake/Hunan/3-9/2007 (A/H10N8) segment 1 (PB2) 3923.4 0.000000e+00 2228/2280 (97%)
EPI221976 A/environment/Dongting Lake/Hunan/3-9/2007 (A/H10N8) segment 1 (PB2) 3917.9 0.000000e+00 2227/2280 (97%)
EPI375109 A/wild bird/Korea/A3/11 (A/H7N9) segment 1 (PB2) 3914.2 0.000000e+00 2222/2273 (97%)
EPI506541 A/duck/Thailand/CU-12326T/2012 (A/H11N2) segment 1 (PB2) 3912.3 0.000000e+00 2227/2281 (97%)
EPI514962 A/mallard/Sweden/79391/2008 (A/H4N2) segment 1 (PB2) 3906.8 0.000000e+00 2225/2280 (97%)
EPI513902 A/mallard/Sweden/79308/2008 (A/H4N2) segment 1 (PB2) 3906.8 0.000000e+00 2225/2280 (97%)
EPI513895 A/mallard/Sweden/79230/2008 (A/H0) segment 1 (PB2) 3906.8 0.000000e+00 2225/2280 (97%)
EPI513865 A/mallard/Sweden/79367/2008 (A/H4N6) segment 1 (PB2) 3906.8 0.000000e+00 2225/2280 (97%)
EPI513851 A/mallard/Sweden/79332/2008 (A/H4N6) segment 1 (PB2) 3906.8 0.000000e+00 2225/2280 (97%)
EPI513828 A/mallard/Sweden/79328/2008 (A/H4N6) segment 1 (PB2) 3906.8 0.000000e+00 2225/2280 (97%)
EPI513826 A/mallard/Sweden/79956/2008 (A/H0) segment 1 (PB2) 3906.8 0.000000e+00 2225/2280 (97%)
EPI513805 A/mallard/Sweden/79412/2008 (A/H4N6) segment 1 (PB2) 3906.8 0.000000e+00 2225/2280 (97%)
EPI513798 A/mallard/Sweden/79388/2008 (A/H4N6) segment 1 (PB2) 3906.8 0.000000e+00 2225/2280 (97%)
EPI513760 A/mallard/Sweden/79981/2008 (A/H4N6) segment 1 (PB2) 3906.8 0.000000e+00 2225/2280 (97%)
EPI513728 A/mallard/Sweden/80078/2008 (A/H4N6) segment 1 (PB2) 3906.8 0.000000e+00 2225/2280 (97%)
EPI513707 A/mallard/Sweden/80051/2008 (A/H4N6) segment 1 (PB2) 3906.8 0.000000e+00 2225/2280 (97%)
EPI513690 A/mallard/Sweden/80173/2008 (A/H4N6) segment 1 (PB2) 3906.8 0.000000e+00 2225/2280 (97%)
EPI513676 A/mallard/Sweden/80148/2008 (A/H4N6) segment 1 (PB2) 3906.8 0.000000e+00 2225/2280 (97%)
EPI513669 A/mallard/Sweden/80127/2008 (A/H4N6) segment 1 (PB2) 3906.8 0.000000e+00 2225/2280 (97%)
EPI513662 A/mallard/Sweden/80114/2008 (A/H4N2) segment 1 (PB2) 3906.8 0.000000e+00 2225/2280 (97%)
EPI513646 A/mallard/Sweden/80260/2008 (A/H4N6) segment 1 (PB2) 3906.8 0.000000e+00 2225/2280 (97%)
EPI513610 A/mallard/Sweden/80178/2008 (A/H4N6) segment 1 (PB2) 3906.8 0.000000e+00 2225/2280 (97%)
EPI513565 A/mallard/Sweden/80299/2008 (A/H4N6) segment 1 (PB2) 3906.8 0.000000e+00 2225/2280 (97%)
EPI508035 A/wild duck/Korea/SH41-33/2011 (A/H7N7) segment 1 (PB2) 3906.8 0.000000e+00 2225/2280 (97%)
EPI375111 A/spot-billed duck/Korea/447/11 (A/H7N9) segment 1 (PB2) 3906.8 0.000000e+00 2219/2271 (97%)
EPI375110 A/wild bird/Korea/A4/11 (A/H7N3) segment 1 (PB2) 3903.1 0.000000e+00 2219/2272 (97%)
EPI513887 A/mallard/Sweden/79187/2008 (A/H4N6) segment 1 (PB2) 3901.2 0.000000e+00 2224/2280 (97%)
EPI513791 A/mallard/Sweden/79375/2008 (A/H4N6) segment 1 (PB2) 3901.2 0.000000e+00 2224/2280 (97%)
EPI513781 A/mallard/Sweden/80010/2008 (A/H4N6) segment 1 (PB2) 3901.2 0.000000e+00 2224/2280 (97%)
EPI513774 A/mallard/Sweden/80009/2008 (A/H4N6) segment 1 (PB2) 3901.2 0.000000e+00 2224/2280 (97%)
EPI513767 A/mallard/Sweden/79998/2008 (A/H4N6) segment 1 (PB2) 3901.2 0.000000e+00 2224/2280 (97%)
EPI513714 A/mallard/Sweden/80063/2008 (A/H4N6) segment 1 (PB2) 3901.2 0.000000e+00 2224/2280 (97%)
EPI513700 A/mallard/Sweden/80014/2008 (A/H4N6) segment 1 (PB2) 3901.2 0.000000e+00 2224/2280 (97%)
EPI513617 A/mallard/Sweden/80185/2008 (A/H4N6) segment 1 (PB2) 3901.2 0.000000e+00 2224/2280 (97%)
EPI513581 A/mallard/Sweden/80389/2008 (A/H4N6) segment 1 (PB2) 3901.2 0.000000e+00 2224/2280 (97%)
EPI513241 A/mallard/Sweden/104925/2009 (A/H4N6) segment 1 (PB2) 3901.2 0.000000e+00 2224/2280 (97%)
EPI513596 A/mallard/Sweden/81019/2008 (A/H4N6) segment 1 (PB2) 3895.7 0.000000e+00 2223/2280 (97%)
EPI513573 A/mallard/Sweden/80348/2008 (A/H0) segment 1 (PB2) 3895.7 0.000000e+00 2223/2280 (97%)
EPI401294 A/wild duck/Korea/CSM4-28/2010 (A/H4N6) segment 1 (PB2) 3895.7 0.000000e+00 2223/2280 (97%)
EPI514904 A/mallard/Sweden/105093/2009 (A/H4N6) segment 1 (PB2) 3890.2 0.000000e+00 2222/2280 (97%)
EPI513248 A/mallard/Sweden/104931/2009 (A/H4N6) segment 1 (PB2) 3890.2 0.000000e+00 2222/2280 (97%)
EPI513181 A/mallard/Sweden/105137/2009 (A/H4N6) segment 1 (PB2) 3890.2 0.000000e+00 2222/2280 (97%)
EPI316757 A/mallard/Czech Republic/13577-24K/2010 (A/H3N8) segment 1 (PB2) 3890.2 0.000000e+00 2222/2280 (97%)
EPI513550 A/mallard/Sweden/101010/2009 (A/H4N6) segment 1 (PB2) 3879.1 0.000000e+00 2220/2280 (97%)
EPI513518 A/mallard/Sweden/101524/2009 (A/H4N6) segment 1 (PB2) 3879.1 0.000000e+00 2220/2280 (97%)
EPI513511 A/mallard/Sweden/101504/2009 (A/H4N6) segment 1 (PB2) 3879.1 0.000000e+00 2220/2280 (97%)
EPI513497 A/mallard/Sweden/101329/2009 (A/H4N6) segment 1 (PB2) 3879.1 0.000000e+00 2220/2280 (97%)
EPI513472 A/mallard/Sweden/101640/2009 (A/H4N6) segment 1 (PB2) 3879.1 0.000000e+00 2220/2280 (97%)
EPI513391 A/mallard/Sweden/101642/2009 (A/H4N6) segment 1 (PB2) 3879.1 0.000000e+00 2220/2280 (97%)
EPI513383 A/mallard/Sweden/102024/2009 (A/H4N6) segment 1 (PB2) 3879.1 0.000000e+00 2220/2280 (97%)
EPI513348 A/mallard/Sweden/101785/2009 (A/H4N6) segment 1 (PB2) 3879.1 0.000000e+00 2220/2280 (97%)
EPI513338 A/mallard/Sweden/102157/2009 (A/H4N6) segment 1 (PB2) 3879.1 0.000000e+00 2220/2280 (97%)
EPI513331 A/mallard/Sweden/102124/2009 (A/H4N6) segment 1 (PB2) 3879.1 0.000000e+00 2220/2280 (97%)
EPI513324 A/mallard/Sweden/102114/2009 (A/H4N6) segment 1 (PB2) 3879.1 0.000000e+00 2220/2280 (97%)
EPI513317 A/mallard/Sweden/102056/2009 (A/H4N6) segment 1 (PB2) 3879.1 0.000000e+00 2220/2280 (97%)
EPI513310 A/mallard/Sweden/102045/2009 (A/H4N6) segment 1 (PB2) 3879.1 0.000000e+00 2220/2280 (97%)
EPI513303 A/mallard/Sweden/102029/2009 (A/H4N6) segment 1 (PB2) 3879.1 0.000000e+00 2220/2280 (97%)
EPI513220 A/mallard/Sweden/104793/2009 (A/H4N6) segment 1 (PB2) 3879.1 0.000000e+00 2220/2280 (97%)
EPI513213 A/mallard/Sweden/104690/2009 (A/H4N6) segment 1 (PB2) 3879.1 0.000000e+00 2220/2280 (97%)
EPI513188 A/mallard/Sweden/105516/2009 (A/H4N6) segment 1 (PB2) 3879.1 0.000000e+00 2220/2280 (97%)
EPI513130 A/mallard/Sweden/102250/2009 (A/H4N6) segment 1 (PB2) 3879.1 0.000000e+00 2220/2280 (97%)
EPI399891 A/aquatic bird/Korea/CN5/2009 (A/H6N5) segment 1 (PB2) 3879.1 0.000000e+00 2221/2281 (97%)
EPI378025 A/mallard/Netherlands/1/2010 (A/H2N3) segment 1 (PB2) 3879.1 0.000000e+00 2220/2280 (97%)
EPI314734 A/aquatic bird/Korea/CN5/2009 (A/H6N5) segment 1 (PB2) 3879.1 0.000000e+00 2221/2281 (97%)
EPI387519 A/snow goose/Mongolia/1-29/2008 (A/H3N8) segment 1 (PB2) 3877.2 0.000000e+00 2219/2279 (97%)
EPI387520 A/snow goose/Mongolia/1-44/2008 (A/H3N8) segment 1 (PB2) 3875.4 0.000000e+00 2218/2278 (97%)
EPI513564 A/mallard/Sweden/101180/2009 (A/H4N6) segment 1 (PB2) 3873.5 0.000000e+00 2219/2280 (97%)
EPI513557 A/mallard/Sweden/101081/2009 (A/H4N6) segment 1 (PB2) 3873.5 0.000000e+00 2219/2280 (97%)
EPI513543 A/mallard/Sweden/100881/2009 (A/H4N6) segment 1 (PB2) 3873.5 0.000000e+00 2219/2280 (97%)
EPI513504 A/mallard/Sweden/101431/2009 (A/H4N6) segment 1 (PB2) 3873.5 0.000000e+00 2219/2280 (97%)
EPI513490 A/mallard/Sweden/101298/2009 (A/H4N6) segment 1 (PB2) 3873.5 0.000000e+00 2219/2280 (97%)
EPI513465 A/mallard/Sweden/101632/2009 (A/H4N6) segment 1 (PB2) 3873.5 0.000000e+00 2219/2280 (97%)
EPI513458 A/mallard/Sweden/101603/2009 (A/H4N6) segment 1 (PB2) 3873.5 0.000000e+00 2219/2280 (97%)
EPI513451 A/mallard/Sweden/101602/2009 (A/H4N6) segment 1 (PB2) 3873.5 0.000000e+00 2219/2280 (97%)

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Thu Jan 22, 2015 7:01 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
EPI446505 A/wild goose/Dongting/C1037/2011 (A/H12N8) segment 2 (PB1) 4200.4 0.000000e+00 2274/2274 (100%)
EPI461627 A/duck/Hunan/S1256/2012 (A/H3N8) segment 2 (PB1) 4183.8 0.000000e+00 2271/2274 (99%)
EPI461569 A/duck/Hunan/S11313/2012 (A/H4N2) segment 2 (PB1) 4117.3 0.000000e+00 2259/2274 (99%)
EPI387896 A/wild bird/Korea/A13/2010 (A/H10N1) segment 2 (PB1) 4084.1 0.000000e+00 2254/2275 (99%)
EPI387895 A/wild bird/Korea/A12/2010 (A/H10N1) segment 2 (PB1) 4084.1 0.000000e+00 2254/2275 (99%)
EPI469411 A/common teal/Hong Kong/MPK630/2009 (A/H10N9) segment 2 (PB1) 4073.0 0.000000e+00 2251/2274 (98%)
EPI469483 A/chicken/Jiangxi/2369/2010 (A/H7N7) segment 2 (PB1) 4061.9 0.000000e+00 2249/2274 (98%)
EPI469333 A/wild waterfowl/Hong Kong/MPJ1815/2010 (A/H11N9) segment 2 (PB1) 4050.8 0.000000e+00 2247/2274 (98%)
EPI476581 A/duck/Thailand/CU-8319T/2010 (A/H9N7) segment 2 (PB1) 3995.4 0.000000e+00 2237/2274 (98%)
EPI372456 A/shoveler/Egypt/01574-NAMRU3/2007 (A/H10N4) segment 2 (PB1) 3978.8 0.000000e+00 2234/2274 (98%)
EPI461661 A/duck/Hunan/S1824/2012 (A/H3N8) segment 2 (PB1) 3973.3 0.000000e+00 2235/2276 (98%)
EPI372273 A/teal/Egypt/20431-NAMRU3/2003 (A/H1N2) segment 2 (PB1) 3967.7 0.000000e+00 2232/2274 (98%)
EPI469432 A/wild waterfowl/Hong Kong/MPL1060/2011 (A/H11N9) segment 2 (PB1) 3962.2 0.000000e+00 2232/2275 (98%)
EPI285821 A/avian/Egypt/920431/2006 (A/H9N2) segment 2 (PB1) 3962.2 0.000000e+00 2231/2274 (98%)
EPI469398 A/common teal/Hong Kong/MPL1075/2011 (A/H11N9) segment 2 (PB1) 3956.6 0.000000e+00 2231/2275 (98%)
EPI493022 A/wild waterfowl/Dongting/C2383/2012 (A/H1N2) segment 2 (PB1) 3945.6 0.000000e+00 2228/2274 (97%)
EPI222162 A/mallard/Altai/1208/2007 (A/H3N6) segment 2 (PB1) 3934.5 0.000000e+00 2226/2274 (97%)
EPI222093 A/garganey/Altai/1216/2007 (A/H3N6) segment 2 (PB1) 3934.5 0.000000e+00 2226/2274 (97%)
EPI544765 A/environment/Shanghai/LPM1/2013 (A/H3N2) segment 2 (PB1) 3928.9 0.000000e+00 2225/2274 (97%)
EPI533778 A/Caspian seal/Russia/T1/2012 (A/H4N6) segment 2 (PB1) 3928.9 0.000000e+00 2225/2274 (97%)
EPI533772 A/Caspian seal/Russia/1884/2002 (A/H4N6) segment 2 (PB1) 3928.9 0.000000e+00 2225/2274 (97%)
EPI514657 A/mallard/Sweden/6134/2005 (A/H4N6) segment 2 (PB1) 3923.4 0.000000e+00 2224/2274 (97%)
EPI372313 A/shoveler/Egypt/09782-NAMRU3/2004 (A/H10N7) segment 2 (PB1) 3923.4 0.000000e+00 2224/2274 (97%)
EPI181975 A/common teal/Netherlands/1/2005 (A/H8N4) segment 2 (PB1) 3923.4 0.000000e+00 2224/2274 (97%)
EPI544772 A/chicken/Shanghai/LPM2/2013 (A/H3N2) segment 2 (PB1) 3917.9 0.000000e+00 2223/2274 (97%)
EPI461833 A/environment/Hunan/S4484/2011 (A/H12N7) segment 2 (PB1) 3917.9 0.000000e+00 2223/2274 (97%)
EPI511808 A/mallard/Italy/4518/2007 (A/H10N1) segment 2 (PB1) 3912.3 0.000000e+00 2222/2274 (97%)
EPI372337 A/shoveler/Egypt/09781-NAMRU3/2004 (A/H10N7) segment 2 (PB1) 3901.2 0.000000e+00 2220/2274 (97%)
EPI372353 A/teal/Egypt/09888-NAMRU3/2005 (A/H4N6) segment 2 (PB1) 3895.7 0.000000e+00 2219/2274 (97%)
EPI514200 A/mallard/Sweden/52462/2006 (A/H4N6) segment 2 (PB1) 3890.2 0.000000e+00 2218/2274 (97%)
EPI190338 A/mallard/Netherlands/22/2007 (A/H7N1) segment 2 (PB1) 3886.5 0.000000e+00 2216/2272 (97%)
EPI485608 A/mallard/Sweden/16/2002 (A/H12N9) segment 2 (PB1) 3884.6 0.000000e+00 2217/2274 (97%)
EPI372479 A/teal/Egypt/12908-NAMRU3/2005 (A/H10N1) segment 2 (PB1) 3884.6 0.000000e+00 2217/2274 (97%)
EPI269009 A/duck/Hunan/491/2005 (A/H6N2) segment 2 (PB1) 3884.6 0.000000e+00 2217/2274 (97%)
EPI469402 A/northern shoveler/Hong Kong/MPC657/2006 (A/H10N9) segment 2 (PB1) 3879.1 0.000000e+00 2217/2275 (97%)
EPI372265 A/shoveler/Egypt/20313-NAMRU3/2003 (A/H5N2) segment 2 (PB1) 3879.1 0.000000e+00 2216/2274 (97%)
EPI173879 A/goose/Italy/296426/2003 (A/H1N1) segment 2 (PB1) 3879.1 0.000000e+00 2217/2275 (97%)
EPI167837 A/goose/Italy/296426/2003 (A/H1N1) segment 2 (PB1) 3879.1 0.000000e+00 2217/2275 (97%)
EPI554980 A/mallard/Italy/3342/2006 (A/H3N6) segment 2 (PB1) 3873.5 0.000000e+00 2215/2274 (97%)
EPI514671 A/mallard/Sweden/7582/2003 (A/H4N6) segment 2 (PB1) 3873.5 0.000000e+00 2215/2274 (97%)
EPI469426 A/wild duck/Jiangxi/10179/2005 (A/H7N3) segment 2 (PB1) 3873.5 0.000000e+00 2215/2274 (97%)
EPI377678 A/mallard/Sweden/99/2002 (A/H2N3) segment 2 (PB1) 3873.5 0.000000e+00 2215/2274 (97%)
EPI254405 A/Egyptian goose/South Africa/AI1448/2007 (A/H1N8) segment 2 (PB1) 3873.5 0.000000e+00 2209/2265 (97%)
EPI229961 A/duck/France/05057b/2005 (A/H5N2) segment 2 (PB1) 3873.5 0.000000e+00 2215/2274 (97%)
EPI178534 A/Duck/Italy/62330/2006 (A/H10N7) segment 2 (PB1) 3873.5 0.000000e+00 2215/2274 (97%)
EPI169291 A/duck/France/05057b/2005 (A/H5N2) segment 2 (PB1) 3873.5 0.000000e+00 2215/2274 (97%)
EPI377662 A/mallard/Sweden/6/2002 (A/H2N3) segment 2 (PB1) 3868.0 0.000000e+00 2214/2274 (97%)
EPI296630 A/mallard/Sweden/95/2005 (A/H7N7) segment 2 (PB1) 3868.0 0.000000e+00 2214/2274 (97%)
EPI251767 A/mallard/Sweden/6/2002 (A/H2N3) segment 2 (PB1) 3868.0 0.000000e+00 2214/2274 (97%)
EPI377772 A/mallard/Sweden/30/2002 (A/H2N5) segment 2 (PB1) 3862.5 0.000000e+00 2213/2274 (97%)
EPI372494 A/pied avocet/Ukraine/05848-NAMRU3/2006 (A/H10N4) segment 2 (PB1) 3862.5 0.000000e+00 2213/2274 (97%)
EPI372487 A/garganey/Ukraine/05834-NAMRU3/2006 (A/H10N9) segment 2 (PB1) 3862.5 0.000000e+00 2213/2274 (97%)
EPI372369 A/shoveler/Egypt/13251-NAMRU3/2006 (A/H6N2) segment 2 (PB1) 3862.5 0.000000e+00 2214/2275 (97%)
EPI251814 A/mallard/Sweden/86/2003 (A/H12N5) segment 2 (PB1) 3862.5 0.000000e+00 2213/2274 (97%)
EPI514716 A/mallard/Sweden/5763/2005 (A/H4N6) segment 2 (PB1) 3856.9 0.000000e+00 2212/2274 (97%)
EPI514681 A/mallard/Sweden/5714/2005 (A/H4N6) segment 2 (PB1) 3856.9 0.000000e+00 2212/2274 (97%)
EPI514650 A/mallard/Sweden/5814/2005 (A/H4N6) segment 2 (PB1) 3856.9 0.000000e+00 2212/2274 (97%)
EPI514334 A/mallard/Sweden/52249/2006 (A/H4N6) segment 2 (PB1) 3856.9 0.000000e+00 2213/2275 (97%)
EPI439580 A/avian/Israel/824/2005 (A/H10N2) segment 2 (PB1) 3856.9 0.000000e+00 2212/2274 (97%)
EPI401307 A/duck/Korea/DY104/2007 (A/H4N6) segment 2 (PB1) 3856.9 0.000000e+00 2212/2274 (97%)
EPI372416 A/shoveler/Egypt/00241-NAMRU3/2007 (A/H7N3) segment 2 (PB1) 3856.9 0.000000e+00 2212/2274 (97%)
EPI514709 A/mallard/Sweden/5755/2005 (A/H4N6) segment 2 (PB1) 3851.4 0.000000e+00 2211/2274 (97%)
EPI514276 A/mallard/Sweden/52334/2006 (A/H4N6) segment 2 (PB1) 3851.4 0.000000e+00 2212/2275 (97%)
EPI514050 A/mallard/Sweden/68504/2007 (A/H4N2) segment 2 (PB1) 3851.4 0.000000e+00 2211/2274 (97%)
EPI513699 A/mallard/Sweden/80014/2008 (A/H4N6) segment 2 (PB1) 3851.4 0.000000e+00 2211/2274 (97%)
EPI485651 A/mallard/Sweden/64/2003 (A/H7N7) segment 2 (PB1) 3851.4 0.000000e+00 2211/2274 (97%)
EPI372440 A/shoveler/Egypt/00006-NAMRU3/2007 (A/H10N1) segment 2 (PB1) 3851.4 0.000000e+00 2211/2274 (97%)
EPI372384 A/teal/Egypt/13203-NAMRU3/2006 (A/H6N2) segment 2 (PB1) 3851.4 0.000000e+00 2213/2276 (97%)
EPI251759 A/mallard/Sweden/58/2003 (A/H11N1) segment 2 (PB1) 3851.4 0.000000e+00 2211/2274 (97%)
EPI225317 A/northern pintail/Akita/714/2006 (A/H5N2) segment 2 (PB1) 3851.4 0.000000e+00 2211/2274 (97%)
EPI514643 A/mallard/Sweden/5811/2005 (A/H4N6) segment 2 (PB1) 3845.8 0.000000e+00 2210/2274 (97%)
EPI514636 A/mallard/Sweden/5803/2005 (A/H4N6) segment 2 (PB1) 3845.8 0.000000e+00 2210/2274 (97%)
EPI514012 A/mallard/Sweden/68551/2007 (A/H4N2) segment 2 (PB1) 3845.8 0.000000e+00 2210/2274 (97%)
EPI513968 A/mallard/Sweden/68677/2007 (A/H0) segment 2 (PB1) 3845.8 0.000000e+00 2210/2274 (97%)
EPI513535 A/mallard/Sweden/100049/2009 (A/H4N6) segment 2 (PB1) 3845.8 0.000000e+00 2210/2274 (97%)
EPI513528 A/mallard/Sweden/99967/2009 (A/H4N6) segment 2 (PB1) 3845.8 0.000000e+00 2210/2274 (97%)
EPI372472 A/teal/Ukraine/12177-NAMRU3/2005 (A/H7N9) segment 2 (PB1) 3845.8 0.000000e+00 2210/2274 (97%)
EPI372329 A/shoveler/Egypt/00134-NAMRU3/2005 (A/H1N1) segment 2 (PB1) 3845.8 0.000000e+00 2211/2275 (97%)
EPI345546 A/chicken/Eastern China/42/2007 (A/H6N2) segment 2 (PB1) 3845.8 0.000000e+00 2210/2274 (97%)
EPI345545 A/chicken/Eastern China/44/2007 (A/H6N2) segment 2 (PB1) 3845.8 0.000000e+00 2210/2274 (97%)
EPI307305 A/mallard duck/Korea/6L/2007 (A/H7N6) segment 2 (PB1) 3845.8 0.000000e+00 2211/2275 (97%)
EPI296558 A/dunlin/Sweden/1/2005 (A/H4N6) segment 2 (PB1) 3845.8 0.000000e+00 2210/2274 (97%)
EPI270060 A/aquatic bird/India/NIV-17095/2007 (A/H11N1) segment 2 (PB1) 3845.8 0.000000e+00 2210/2274 (97%)
EPI173735 A/duck/Italy/69238/2007 (A/H1N1) segment 2 (PB1) 3845.8 0.000000e+00 2210/2274 (97%)
EPI167813 A/duck/Italy/69238/2007 (A/H1N1) segment 2 (PB1) 3845.8 0.000000e+00 2210/2274 (97%)
EPI514961 A/mallard/Sweden/79391/2008 (A/H4N2) segment 2 (PB1) 3840.3 0.000000e+00 2209/2274 (97%)
EPI514736 A/mallard/Sweden/3715/2004 (A/H4N6) segment 2 (PB1) 3840.3 0.000000e+00 2209/2274 (97%)
EPI514589 A/mallard/Sweden/7925/2005 (A/H4N6) segment 2 (PB1) 3840.3 0.000000e+00 2209/2274 (97%)
EPI514003 A/mallard/Sweden/68940/2007 (A/H4N2) segment 2 (PB1) 3840.3 0.000000e+00 2209/2274 (97%)
EPI513638 A/mallard/Sweden/80236/2008 (A/H0) segment 2 (PB1) 3840.3 0.000000e+00 2209/2274 (97%)
EPI513630 A/mallard/Sweden/80195/2008 (A/H4N6) segment 2 (PB1) 3840.3 0.000000e+00 2209/2274 (97%)
EPI469414 A/duck/Yunnan/87/2007 (A/H7N6) segment 2 (PB1) 3840.3 0.000000e+00 2207/2271 (97%)
EPI413893 A/ostrich/South Africa/AI2512/2011 (A/H5N2) segment 2 (PB1) 3840.3 0.000000e+00 2210/2275 (97%)
EPI413879 A/ostrich/South Africa/AI2114/2011 (A/H5N2) segment 2 (PB1) 3840.3 0.000000e+00 2210/2275 (97%)
EPI401364 A/wild bird/Korea/YS109/2007 (A/H4N6) segment 2 (PB1) 3840.3 0.000000e+00 2209/2274 (97%)
EPI387558 A/Baer's pochard/HuNan/414/2010(H7N1) (A/H7N1) segment 2 (PB1) 3840.3 0.000000e+00 2209/2274 (97%)
EPI377582 A/mallard/Sweden/58112/2006 (A/H2N2) segment 2 (PB1) 3840.3 0.000000e+00 2209/2274 (97%)
EPI345544 A/chicken/Eastern China/45/2007 (A/H6N2) segment 2 (PB1) 3840.3 0.000000e+00 2209/2274 (97%)
EPI307306 A/aquatic bird/Korea/MA44/2007 (A/H7N3) segment 2 (PB1) 3840.3 0.000000e+00 2209/2274 (97%)
EPI268984 A/mallard/Jiangxi/10668/2005 (A/H6N1) segment 2 (PB1) 3840.3 0.000000e+00 2209/2274 (97%)

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Thu Jan 22, 2015 7:05 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
LOCUS AB304146 2233 bp RNA linear VRL 29-OCT-2008
DEFINITION Influenza A virus (A/duck/Shiga/8/2004(H4N6)) PA gene for
polymerase acidic protein, complete cds.
ACCESSION AB304146
VERSION AB304146.1 GI:160624935
KEYWORDS .
SOURCE Influenza A virus (A/duck/Shiga/8/2004(H4N6))
ORGANISM Influenza A virus (A/duck/Shiga/8/2004(H4N6))
Viruses; ssRNA negative-strand viruses; Orthomyxoviridae;
Influenzavirus A.
REFERENCE 1
AUTHORS Imai,K.
TITLE Isolation of Influenza A virus H4N6 from duck in Japan
JOURNAL Unpublished
REFERENCE 2 (bases 1 to 2233)
AUTHORS Imai,K., Ogawa,H., Horie,M., Yamada,K., Ozawa,K., Yonezawa,Y. and
Nakamura,K.
TITLE Direct Submission
JOURNAL Submitted (18-MAY-2007) Contact:Kunitoshi Imai Obihiro University
of Agriculture and Veterinary Medicine, Research Unit For Emerging
& Re-emerging Diseases; Inada 2-11, Obihiro, Hokkaido 080-8555,
Japan
FEATURES Location/Qualifiers
source 1..2233
/organism="Influenza A virus (A/duck/Shiga/8/2004(H4N6))"
/mol_type="genomic RNA"
/strain="A/duck/Shiga/8/2004"
/serotype="H4N6"
/host="Anas platyrhyncha var. domestica, domestic duck
(Aigamo duck)"
/db_xref="taxon:444501"
/segment="3"
/country="Japan: Shiga"
gene 25..2175
/gene="PA"
CDS 25..2175
/gene="PA"
/codon_start=1
/product="polymerase acidic protein"
/protein_id="BAF93497.1"
/db_xref="GI:160624936"
/translation="MEDFVRQCFNPMIVELAEKAMKEYGEDPKIETNKFAAICTHLEV
CFMYSDFHFIDERGESIIVESGDPNALLKHRFEIIEGRDRTMAWTVVNSICNTTGVDK
PKFLPDLYDYKENRFIEIGVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKAD
YTLDEESRARIKTRLFTIRQEMASRGLWDSFRQSERGEETIEERFEITGTMRRLADQS
LPPNFSSLENFRAYVDGFEPNGCIEGKLSQMSKEVNARIEPFLKTTPRPLRLPDGPPC
SQRSKFLLMDALKLSIEDPSHEGEGIPLYDAIKCMKTFFGWKEPNIVKPHEKGINPNY
LLAWKQVLAELQDIENEEKIPKTKNMKKTSQLKWALGENMAPEKVDFEDCKDVSDLRQ
YDSDEPESRSLASWIQSEFNKACELTDSSWIELDEIGEDVAPIEHIASMRRNYFTAEV
SHCRATEYIMKGVYINTALLNASCAAMDDFQLIPMISKCRTKEGRRKTNLYGFIIKGR
SHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKYCVLEIGDMLLRTAIGQVSRPMFLYVR
TNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAESSVKEKDMTKEFFENKSETWPIGES
PKGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSAESRKLLLIVQALRDNLEPGTFD
LGGLYEAIEECLINDPWVLLNASWFNSFLTHALK"
ORIGIN
1 agcgaaagca ggtactgatt caaaatggaa gactttgtgc gacaatgctt caatccaatg
61 attgtcgagc ttgcggaaaa ggcaatgaaa gaatatgggg aagatccgaa aatcgaaacg
121 aacaaatttg ccgcaatatg cacacacttg gaagtctgtt tcatgtattc ggatttccac
181 tttattgatg aacggggcga atcaataatt gtagaatctg gcgatccgaa cgcattattg
241 aaacaccgat ttgagataat tgaagggaga gaccgaacaa tggcctggac agtggtgaat
301 agtatctgca acaccacagg agtcgacaag cctaaatttc tcccagattt gtatgactac
361 aaagagaacc gattcattga aattggagtg acacgaaggg aagttcacat atactatcta
421 gaaaaagcca acaagataaa atcggagaag acacacattc acatattctc attcactgga
481 gaggaaatgg ccaccaaagc ggactatact cttgatgaag agagcagagc aagaatcaaa
541 accaggctgt tcactataag gcaagaaatg gccagtaggg gtctatggga ttcctttcgt
601 cagtccgaga gaggcgaaga gacaattgaa gaaagatttg aaatcacagg aaccatgcgc
661 aggcttgccg accaaagtct cccaccgaac ttctccagcc ttgaaaactt tagagcctat
721 gtggatggat tcgaaccgaa cggctgcatt gagggcaagc tttctcaaat gtcaaaagaa
781 gtgaacgcca gaattgagcc atttctgaaa acaacaccac gccctctcag attacctgat
841 gggcctccct gctctcagcg gtcgaagttc ttgctgatgg atgccctcaa attaagcatc
901 gaagacccga gccatgaggg ggaaggcata ccactatatg atgcaatcaa atgcatgaag
961 acattcttcg gctggaaaga gcccaacatc gtaaaaccac atgaaaaggg cataaacccc
1021 aattacctcc tggcttggaa gcaggtgctg gcagaactcc aagatattga aaatgaagag
1081 aaaatcccaa aaacaaagaa catgaagaaa acaagccaat tgaagtgggc acttggtgag
1141 aatatggcac cagagaaagt agactttgag gactgcaaag atgttagcga tctaagacag
1201 tatgatagtg atgaaccaga gtctagatcg ctagcaagct ggatccagag cgaattcaac
1261 aaggcatgcg aattgacaga ttcgagttgg attgaacttg atgaaatagg ggaagacgtt
1321 gctccaattg agcacattgc gagtatgaga agaaactatt tcacagcgga agtatcccat
1381 tgcagggcta ctgaatacat aatgaaggga gtgtacataa acacagccct gttgaatgca
1441 tcctgtgcag ccatggatga cttccaactg attccaatga taagcaagtg cagaaccaaa
1501 gaaggaagac ggaagacaaa tctgtatgga ttcattataa agggaagatc ccatttgagg
1561 aatgacactg atgtggtaaa ctttgtgagc atggaattct ctcttactga cccgaggctg
1621 gagccacaca agtgggaaaa gtactgtgtt ctcgagatag gagacatgct cctacggact
1681 gcaataggcc aagtgtcaag gccaatgttc ctgtatgtga gaaccaatgg gacttccaag
1741 attaagatga aatggggcat ggagatgagg cgatgccttc ttcaatccct tcaacaaatt
1801 gaaagcatga ttgaggccga gtcttctgtc aaagagaagg acatgaccaa agaattcttt
1861 gaaaacaaat cagaaacatg gccaattgga gaatccccca aaggggtgga ggaaggctcc
1921 attgggaagg tgtgcagaac attactagca aaatctgtgt tcaacagcct atatgcatct
1981 ccacaactcg aggggttttc agctgaatca agaaaattgc ttctcattgt tcaggcactt
2041 agggacaacc ttgaacctgg gaccttcgat cttggggggc tatatgaagc aattgaggag
2101 tgcctgatta acgatccctg ggttttgctt aatgcgtctt ggttcaactc cttcctcaca
2161 catgcactga aatagttgtg gcaatgctac tatttgctat ccatactgtc caaaaaagta
2221 ccttgtttct act

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Thu Jan 22, 2015 7:06 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
EPI3435 A/duck/Shiga/8/2004 (A/H4N6) segment 3 (PA) 3973.3 0.000000e+00 2151/2151 (100%)
EPI487589 A/wild duck/Jiangxi/9157/2005 (A/H7N8) segment 3 (PA) 3928.9 0.000000e+00 2143/2151 (99%)
EPI296247 A/wild duck/Korea/UP122/2007 (A/H1N1) segment 3 (PA) 3917.9 0.000000e+00 2141/2151 (99%)
EPI387497 A/northern lapwing/Mongolia/2-66/2007 (A/H4N6) segment 3 (PA) 3912.3 0.000000e+00 2141/2152 (99%)
EPI262640 A/aquatic bird/Korea/w16/2005 (A/H5N3) segment 3 (PA) 3901.2 0.000000e+00 2138/2151 (99%)
EPI262645 A/aquatic bird/Korea/w96/2005 (A/H5N2) segment 3 (PA) 3899.4 0.000000e+00 2137/2150 (99%)
EPI326822 A/environment/Korea/ESD3/2003 (A/H3N8) segment 3 (PA) 3895.7 0.000000e+00 2137/2151 (99%)
EPI326820 A/environment/Korea/ESD14/2003 (A/H3N8) segment 3 (PA) 3895.7 0.000000e+00 2137/2151 (99%)
EPI268820 A/mallard/Jiangxi/6845/2003 (A/H6N1) segment 3 (PA) 3895.7 0.000000e+00 2137/2151 (99%)
EPI508083 A/wild duck/Korea/CSM27-12/2009 (A/H7N6) segment 3 (PA) 3890.2 0.000000e+00 2136/2151 (99%)
EPI140260 A/migratory duck/Jiang Xi/7231/2004 (A/H10N5) segment 3 (PA) 3890.2 0.000000e+00 2132/2145 (99%)
EPI387419 A/whooper swan/Mongolia/1-27/2007 (A/H3N8) segment 3 (PA) 3884.6 0.000000e+00 2133/2148 (99%)
EPI326785 A/environment/Korea/SH142/2007 (A/H3N8) segment 3 (PA) 3884.6 0.000000e+00 2135/2151 (99%)
EPI272288 A/duck/Korea/A14/2008 (A/H5N2) segment 3 (PA) 3879.1 0.000000e+00 2134/2151 (99%)
EPI262672 A/aquatic bird/Korea/w347/2008 (A/H5N2) segment 3 (PA) 3862.5 0.000000e+00 2132/2152 (99%)
EPI315130 A/duck/Vietnam/G30/2008 (A/H11N9) segment 3 (PA) 3856.9 0.000000e+00 2131/2152 (99%)
EPI508072 A/duck/Korea/BC10/2007 (A/H7N3) segment 3 (PA) 3851.4 0.000000e+00 2129/2151 (98%)
EPI315146 A/duck/Vietnam/G18/2009 (A/H12N5) segment 3 (PA) 3851.4 0.000000e+00 2130/2152 (98%)
EPI306418 A/mallard/Korea/KNU YP09/2009 (A/H1N1) segment 3 (PA) 3851.4 0.000000e+00 2129/2151 (98%)
EPI406484 A/baikal teal/Xianghai/421/2011 (A/H9N2) segment 3 (PA) 3849.5 0.000000e+00 2128/2150 (98%)
EPI341917 A/chicken/Korea/KNUGJ09/2009 (A/H9N2) segment 3 (PA) 3845.8 0.000000e+00 2128/2151 (98%)
EPI387889 A/wild bird/Korea/A323/2009 (A/H10N1) segment 3 (PA) 3840.3 0.000000e+00 2127/2151 (98%)
EPI504001 A/wild duck/SH17-34/2008 (A/H2N3) segment 3 (PA) 3834.8 0.000000e+00 2126/2151 (98%)
EPI341893 A/chicken/Korea/KNUSWR09/2009 (A/H9N2) segment 3 (PA) 3834.8 0.000000e+00 2126/2151 (98%)
EPI439148 A/duck/Nanjing/1102/2010 (A/H4N8) segment 3 (PA) 3829.2 0.000000e+00 2127/2153 (98%)
EPI341885 A/duck/Korea/KNUDPJ09/2009 (A/H9N2) segment 3 (PA) 3829.2 0.000000e+00 2125/2151 (98%)
EPI219339 A/mallard/Hokkaido/24/2009 (A/H5N1) segment 3 (PA) 3829.2 0.000000e+00 2125/2151 (98%)
EPI487584 A/duck/Fujian/5448/2008 (A/H7N7) segment 3 (PA) 3823.7 0.000000e+00 2124/2151 (98%)
EPI487449 A/duck/Fujian/5728/2008 (A/H7N7) segment 3 (PA) 3823.7 0.000000e+00 2124/2151 (98%)
EPI487448 A/duck/Fujian/5476/2008 (A/H7N7) segment 3 (PA) 3823.7 0.000000e+00 2124/2151 (98%)
EPI387524 A/pintail/Mongolia/2-84/2007 (A/H4N6) segment 3 (PA) 3823.7 0.000000e+00 2093/2104 (99%)
EPI341925 A/chicken/Korea/KNUWSJ09/2009 (A/H9N2) segment 3 (PA) 3823.7 0.000000e+00 2124/2151 (98%)
EPI119083 A/garganey/SanJiang/160/2006 (A/H5N2) segment 3 (PA) 3823.7 0.000000e+00 2124/2151 (98%)
EPI487573 A/northern shoveler/Hong Kong/MPK276/2009 (A/H11N9) segment 3 (PA) 3818.1 0.000000e+00 2123/2151 (98%)
EPI345607 A/duck/Eastern China/1/2008 (A/H6N1) segment 3 (PA) 3818.1 0.000000e+00 2123/2151 (98%)
EPI300953 A/duck/Korea/SH0915/2009 (A/H9N2) segment 3 (PA) 3818.1 0.000000e+00 2123/2151 (98%)
EPI300952 A/chicken/Korea/SH0914/2009 (A/H9N2) segment 3 (PA) 3818.1 0.000000e+00 2123/2151 (98%)
EPI300951 A/chicken/Korea/SH0913/2009 (A/H9N2) segment 3 (PA) 3818.1 0.000000e+00 2124/2152 (98%)
EPI272282 A/chicken/Korea/A146/2009 (A/H9N2) segment 3 (PA) 3818.1 0.000000e+00 2117/2142 (98%)
EPI487447 A/duck/Fujian/5408/2008 (A/H7N7) segment 3 (PA) 3812.6 0.000000e+00 2123/2152 (98%)
EPI341934 A/duck/Nanjing/20/2010 (A/H1N3) segment 3 (PA) 3807.1 0.000000e+00 2122/2152 (98%)
EPI272284 A/duck/Korea/A174/2009 (A/H9N2) segment 3 (PA) 3807.1 0.000000e+00 2115/2142 (98%)
EPI272283 A/chicken/Korea/A170/2009 (A/H9N2) segment 3 (PA) 3807.1 0.000000e+00 2115/2142 (98%)
EPI487594 A/wild waterfowl/Hong Kong/MPL696/2011 (A/H2N9) segment 3 (PA) 3801.5 0.000000e+00 2120/2151 (98%)
EPI341941 A/duck/Nanjing/19/2010 (A/H1N3) segment 3 (PA) 3801.5 0.000000e+00 2120/2151 (98%)
EPI326816 A/environment/Korea/CSM08/2004 (A/H3N3) segment 3 (PA) 3801.5 0.000000e+00 2120/2151 (98%)
EPI268842 A/duck/Guangxi/1598/2005 (A/H6N2) segment 3 (PA) 3801.5 0.000000e+00 2120/2151 (98%)
EPI326778 A/environment/Korea/SH11-10/2009 (A/H3N8) segment 3 (PA) 3792.3 0.000000e+00 2115/2146 (98%)
EPI476600 A/duck/Thailand/CU-8319T/2010 (A/H9N7) segment 3 (PA) 3790.4 0.000000e+00 2118/2151 (98%)
EPI356364 A/wild duck/Korea/CSM4-12/2009 (A/H5N1) segment 3 (PA) 3790.4 0.000000e+00 2096/2118 (98%)
EPI392512 A/duck/Korea/A349/09 (A/H7N2) segment 3 (PA) 3784.9 0.000000e+00 2117/2151 (98%)
EPI300940 A/chicken/Korea/SH0902/2009 (A/H9N2) segment 3 (PA) 3784.9 0.000000e+00 2117/2151 (98%)
EPI3391 A/duck/Hokkaido/84/2002 (A/H5N3) segment 3 (PA) 3779.4 0.000000e+00 2116/2151 (98%)
EPI335316 A/Korean native chicken/Korea/K040110/2010 (A/H9N2) segment 3 (PA) 3773.8 0.000000e+00 2115/2151 (98%)
EPI439598 A/avian/Israel/320/2001 (A/H6N2) segment 3 (PA) 3768.3 0.000000e+00 2114/2151 (98%)
EPI363454 A/duck/Guangxi/1074/2006 (A/H6N2) segment 3 (PA) 3768.3 0.000000e+00 2114/2151 (98%)
EPI363462 A/duck/Guangxi/1157/2006 (A/H6N2) segment 3 (PA) 3762.7 0.000000e+00 2113/2151 (98%)
EPI300954 A/chicken/Korea/HC0410/2009 (A/H9N2) segment 3 (PA) 3757.2 0.000000e+00 2114/2153 (98%)
EPI296257 A/wild duck/Korea/CSM38/2004 (A/H1N1) segment 3 (PA) 3757.2 0.000000e+00 2112/2151 (98%)
EPI3368 A/duck/Hokkaido/447/2000 (A/H5N3) segment 3 (PA) 3757.2 0.000000e+00 2112/2151 (98%)
EPI439594 A/avian/Israel/289/2001 (A/H6N2) segment 3 (PA) 3753.5 0.000000e+00 2111/2151 (98%)
EPI389753 A/swine/Guangdong/K4/2011 (A/H4N8) segment 3 (PA) 3753.5 0.000000e+00 2111/2151 (98%)
EPI363470 A/duck/Guangxi/1248/2006 (A/H6N2) segment 3 (PA) 3751.7 0.000000e+00 2111/2151 (98%)
EPI314206 A/wild duck/Taiwan/WB1364/2007 (A/H4N6) segment 3 (PA) 3751.7 0.000000e+00 2071/2091 (99%)
EPI296255 A/wild duck/Korea/SH60/2004 (A/H1N1) segment 3 (PA) 3751.7 0.000000e+00 2111/2151 (98%)
EPI262642 A/aquatic bird/Korea/w74/2005 (A/H5N2) segment 3 (PA) 3751.7 0.000000e+00 2112/2152 (98%)
EPI533743 A/Caspian seal/Russia/T1/2012 (A/H4N6) segment 3 (PA) 3746.1 0.000000e+00 2110/2151 (98%)
EPI533742 A/Caspian seal/Russia/1884/2002 (A/H4N6) segment 3 (PA) 3746.1 0.000000e+00 2110/2151 (98%)
EPI345928 A/whistling swan/Shimane/580/2002 (A/H5N3) segment 3 (PA) 3746.1 0.000000e+00 2110/2151 (98%)
EPI262643 A/aquatic bird/Korea/w79/2005 (A/H5N2) segment 3 (PA) 3746.1 0.000000e+00 2111/2152 (98%)
EPI262641 A/aquatic bird/Korea/w54/2005 (A/H5N2) segment 3 (PA) 3746.1 0.000000e+00 2111/2152 (98%)
EPI118289 A/duck/Jiang Xi/1286/2005 (A/H5N2) segment 3 (PA) 3746.1 0.000000e+00 2110/2151 (98%)
EPI510619 A/duck/Taiwan/4374/2013 (A/H5N2) segment 3 (PA) 3740.6 0.000000e+00 2109/2151 (98%)
EPI510618 A/duck/Taiwan/4372/2013 (A/H5N2) segment 3 (PA) 3740.6 0.000000e+00 2109/2151 (98%)
EPI392514 A/duck/Korea/109/11 (A/H7N7) segment 3 (PA) 3740.6 0.000000e+00 2110/2152 (98%)
EPI387412 A/ruddy shelduck/Mongolia/1-26/2007 (A/H3N8) segment 3 (PA) 3740.6 0.000000e+00 2110/2152 (98%)
EPI372287 A/shoveler/Egypt/00600-NAMRU3/2004 (A/H10N7) segment 3 (PA) 3740.6 0.000000e+00 2109/2151 (98%)
EPI326817 A/environment/Korea/CSM05/2004 (A/H3N1) segment 3 (PA) 3740.6 0.000000e+00 2109/2151 (98%)
EPI268981 A/duck/Hunan/1469/2002 (A/H6N8) segment 3 (PA) 3740.6 0.000000e+00 2109/2151 (98%)
EPI262644 A/aquatic bird/Korea/w81/2005 (A/H5N2) segment 3 (PA) 3740.6 0.000000e+00 2110/2152 (98%)
EPI178525 A/Goose/Italy/6117/2004 (A/H1N1) segment 3 (PA) 3740.6 0.000000e+00 2109/2151 (98%)
EPI140261 A/migratory duck/Jiang Xi/6568/2004 (A/H4N6) segment 3 (PA) 3740.6 0.000000e+00 2109/2151 (98%)
EPI118295 A/duck/Jiang Xi/2374/2005 (A/H3N6) segment 3 (PA) 3740.6 0.000000e+00 2109/2151 (98%)
EPI510633 A/duck/Taiwan/4379/2013 (A/H5N2) segment 3 (PA) 3735.0 0.000000e+00 2108/2151 (98%)
EPI510614 A/duck/Taiwan/758/2013 (A/H5N2) segment 3 (PA) 3735.0 0.000000e+00 2108/2151 (98%)
EPI268817 A/duck/Hunan/177/2005 (A/H6N1) segment 3 (PA) 3735.0 0.000000e+00 2108/2151 (98%)
EPI180351 A/duck/Primorie/2621/01 (A/H5N2) segment 3 (PA) 3735.0 0.000000e+00 2108/2151 (98%)
EPI118337 A/duck/Jiang Xi/3345/2005 (A/H5N2) segment 3 (PA) 3735.0 0.000000e+00 2108/2151 (98%)
EPI118321 A/duck/Jiang Xi/1850/2005 (A/H5N2) segment 3 (PA) 3735.0 0.000000e+00 2108/2151 (98%)
EPI510616 A/duck/Taiwan/4355/2013 (A/H5N2) segment 3 (PA) 3731.4 0.000000e+00 2107/2151 (97%)
EPI510617 A/duck/Taiwan/4360/2013 (A/H5N2) segment 3 (PA) 3729.5 0.000000e+00 2107/2151 (97%)
EPI387480 A/pintail/Mongolia/2-11/2007 (A/H4N2) segment 3 (PA) 3729.5 0.000000e+00 2103/2145 (98%)
EPI363534 A/duck/Guizhou/2773/2006 (A/H6N2) segment 3 (PA) 3729.5 0.000000e+00 2108/2152 (97%)
EPI335409 A/aquatic bird/Korea/CN17/2009 (A/H6N2) segment 3 (PA) 3729.5 0.000000e+00 2107/2151 (97%)
EPI307311 A/mallard duck/Korea/6L/2007 (A/H7N6) segment 3 (PA) 3729.5 0.000000e+00 2107/2151 (97%)
EPI296253 A/wild duck/Korea/CW09/2005 (A/H1N1) segment 3 (PA) 3729.5 0.000000e+00 2107/2151 (97%)
EPI268977 A/mallard/Jiangxi/4408/2005 (A/H6N8) segment 3 (PA) 3729.5 0.000000e+00 2107/2151 (97%)
EPI268960 A/mallard/Jiangxi/8346/2004 (A/H6N5) segment 3 (PA) 3729.5 0.000000e+00 2107/2151 (97%)
EPI389742 A/swine/Guangdong/L21/2011 (A/H3N2) segment 3 (PA) 3725.8 0.000000e+00 2106/2151 (97%)
EPI510623 A/duck/Taiwan/4380/2013 (A/H5N2) segment 3 (PA) 3724.0 0.000000e+00 2106/2151 (97%)

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Thu Jan 22, 2015 7:13 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
LOCUS KC886655 1458 bp cRNA linear VRL 11-APR-2014
DEFINITION Influenza A virus (A/common shelduck/Mongolia/2185/2011(H3N8))
segment 5 nucleocapsid protein (NP) gene, partial cds.
ACCESSION KC886655
VERSION KC886655.1 GI:485085881
KEYWORDS .
SOURCE Influenza A virus (A/common shelduck/Mongolia/2185/2011(H3N8))
ORGANISM Influenza A virus (A/common shelduck/Mongolia/2185/2011(H3N8))
Viruses; ssRNA negative-strand viruses; Orthomyxoviridae;
Influenzavirus A.
REFERENCE 1 (bases 1 to 1458)
AUTHORS Leung,C.Y., Gilbert,M., Chow,K.-C., Ho,C.-K., Tang,S.-C., Guan,Y.
and Peiris,M.
TITLE Avian influenza surveillance in wild populations
JOURNAL Unpublished
REFERENCE 2 (bases 1 to 1458)
AUTHORS Leung,C.Y., Gilbert,M., Chow,K.-C., Ho,C.-K., Tang,S.-C., Guan,Y.
and Peiris,M.
TITLE Direct Submission
JOURNAL Submitted (11-APR-2013) School of Public Health, The University of
Hong Kong, L5-36 Faculty of Medicine Building, 21 Sassoon Rd,
Pokfulam, Hong Kong, China
FEATURES Location/Qualifiers
source 1..1458
/organism="Influenza A virus (A/common
shelduck/Mongolia/2185/2011(H3N8))"
/mol_type="viral cRNA"
/strain="A/common shelduck/Mongolia/2185/2011"
/serotype="H3N8"
/host="common shelduck"
/db_xref="taxon:1316848"
/segment="5"
/country="Mongolia"
/collection_date="09-Oct-2011"
misc_feature 1..1458
/db_xref="IRD:CEIRS-UMN034-MN11-F_2185.5"
gene 46..>1458
/gene="NP"
CDS 46..>1458
/gene="NP"
/codon_start=1
/product="nucleocapsid protein"
/protein_id="AGK74918.1"
/db_xref="GI:485085882"
/translation="MASQGTKRSYEQMETGGERQNATEIRASVGRMVGGIGRFYIQMC
TELKLSDHEGRLIQNSITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRRDG
KWMRELILYDKEEIRRIWRQANNGEDATAGLTHLMIWHSNLNDATYQRTRALVRTGMD
PRMCSLMQGSTLPRRSGAAGAAVKGVGTMVMELIRMIKRGINDRNFWRGENGRRTRIA
YERMCNILKGKFQTAAQRAMMDQVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCL
PACVYGLAVASGYDFEREGYSLVGIDPFRLLQNSQVFSLIRPNENPAHKSQLVWMACH
SAAFEDLRVSSFIRGTRVVPRGQLSTRGVQIASNENMETMDSSTLELRSRYWAIRTRS
GGNTNQQRASAGQISVQPTFSVQRNLPFERATIMAAFTGNTEGRTSDMRTEIIRMMES
ARPEDVSFQGRGVFELSDEKA"
ORIGIN
1 agcaaaagca gggtagataa tcactcactg agtgacatca acatcatggc gtctcaaggc
61 accaaacgat cttatgaaca gatggaaact ggtggggaac gccagaatgc cactgagatc
121 agagcatctg ttgggagaat ggttggtgga attgggaggt tttatataca gatgtgcact
181 gagctcaaac tcagcgacca tgaaggaagg ctgatccaga acagcataac aatagagaga
241 atggttctct ctgcatttga tgaaaggagg aacaaatacc tggaagaaca tcccagtgcg
301 gggaaggacc cgaagaaaac tggaggtcca atctaccgaa ggagagacgg aaaatggatg
361 agggagctga ttctgtatga caaagaagag atcaggagga tttggcgtca agcgaacaat
421 ggagaagacg caaccgctgg tctcactcat ctgatgatct ggcattccaa cctaaatgat
481 gccacatacc agagaacaag agctctcgtg cgtactggga tggaccccag aatgtgctct
541 ctgatgcaag gatcgactct cccgaggaga tctggagctg ctggtgcagc agtaaagggt
601 gtcgggacga tggtgatgga actaattcgg atgataaagc gagggattaa tgatcggaat
661 ttctggagag gcgaaaatgg acgaagaaca aggattgcat atgagagaat gtgcaacatc
721 ctcaaaggga aattccaaac agcagcacaa agagcaatga tggatcaggt gcgggaaagc
781 agaaatcctg ggaatgctga aattgaagat ctcatctttc tggcacgatc tgcactcatc
841 ctgagaggat cagtggccca taaatcctgc ttgcctgctt gtgtgtacgg acttgccgtg
901 gccagtgggt atgactttga gagagaagga tactctctgg ttggaataga ccctttccgt
961 ctgctccaaa acagccaggt cttcagcctc attagaccaa atgagaatcc agcacataag
1021 agtcaattgg tatggatggc atgccattct gcagcatttg aagacctgag agtctcaagt
1081 ttcattagag ggacgagagt agtcccgaga ggacagctat ccaccagagg agttcaaatt
1141 gcttcaaatg agaacatgga aacaatggac tccagcactc ttgaactgag aagcagatat
1201 tgggctataa gaaccagaag tggaggaaac accaaccaac agagagcatc tgcaggacaa
1261 atcagtgtac agcctacgtt ctcggtacag agaaatcttc ccttcgaaag agcgaccatt
1321 atggcggcgt ttacagggaa tactgagggc agaacatctg acatgaggac tgaaatcata
1381 agaatgatgg aaagtgccag accagaagat gtgtctttcc aggggcgggg agtcttcgag
1441 ctctcggacg aaaaggca

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Thu Jan 22, 2015 7:15 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
EPI526131 A/common shelduck/Mongolia/2185/2011 (A/H3N8) segment 5 (NP) 2610.4 0.000000e+00 1413/1413 (100%)
EPI387401 A/whooper swan/Mongolia/1-23/2007 (A/H3N8) segment 5 (NP) 2579.0 0.000000e+00 1406/1411 (99%)
EPI387493 A/pintail/Mongolia/2-65/2007 (A/H3N8) segment 5 (NP) 2577.2 0.000000e+00 1407/1413 (99%)
EPI387421 A/whooper swan/Mongolia/1-27/2007 (A/H3N8) segment 5 (NP) 2577.2 0.000000e+00 1407/1413 (99%)
EPI387509 A/ruddy shelduck/Mongolia/2-79/2007 (A/H3N8) segment 5 (NP) 2571.7 0.000000e+00 1406/1413 (99%)
EPI313978 A/duck/Taiwan/5568/2006 (A/H4N6) segment 5 (NP) 2532.9 0.000000e+00 1399/1413 (99%)
EPI313940 A/duck/Taiwan/146/2006 (A/H4N6) segment 5 (NP) 2521.8 0.000000e+00 1397/1413 (98%)
EPI268797 A/duck/Fujian/12035/2005 (A/H6N6) segment 5 (NP) 2505.2 0.000000e+00 1394/1413 (98%)
EPI526112 A/northern shoveler/Mongolia/992V/2009 (A/H3N8) segment 5 (NP) 2471.9 0.000000e+00 1388/1413 (98%)
EPI387476 A/environment/Mongolia/1-33/2007 (A/H4N6) segment 5 (NP) 2460.9 0.000000e+00 1386/1413 (98%)
EPI387851 A/mallard/Korea/1242/2010 (A/H10N6) segment 5 (NP) 2455.3 0.000000e+00 1386/1414 (98%)
EPI526106 A/common teal/Mongolia/1906/2011 (A/H3N8) segment 5 (NP) 2449.8 0.000000e+00 1384/1413 (97%)
EPI526102 A/northern shoveler/ Mongolia/973/2009 (A/H3N8) segment 5 (NP) 2449.8 0.000000e+00 1384/1413 (97%)
EPI387414 A/ruddy shelduck/Mongolia/1-26/2007 (A/H3N8) segment 5 (NP) 2449.8 0.000000e+00 1384/1413 (97%)
EPI387408 A/whooper swan/Mongolia/1-25/2007 (A/H3N8) segment 5 (NP) 2449.8 0.000000e+00 1384/1413 (97%)
EPI268648 A/duck/Hunan/177/2005 (A/H6N1) segment 5 (NP) 2449.8 0.000000e+00 1384/1413 (97%)
EPI470395 A/duck/Jiangxi/22537/2012 (A/H11N9) segment 5 (NP) 2444.2 0.000000e+00 1383/1413 (97%)
EPI526107 A/northern shoveler/Mongolia/977V/2009 (A/H3N8) segment 5 (NP) 2442.4 0.000000e+00 1380/1409 (97%)
EPI268674 A/duck/Guangxi/141/2005 (A/H6N2) segment 5 (NP) 2433.2 0.000000e+00 1381/1413 (97%)
EPI258986 A/aquatic bird/Korea/w229/2007 (A/H5N2) segment 5 (NP) 2427.6 0.000000e+00 1380/1413 (97%)
EPI234645 A/duck/Beijing/40/04 (A/H3N8) segment 5 (NP) 2427.6 0.000000e+00 1380/1413 (97%)
EPI314200 A/wild duck/Taiwan/WB1162/2006 (A/H4N6) segment 5 (NP) 2416.5 0.000000e+00 1379/1414 (97%)
EPI268646 A/mallard/Jiangxi/10668/2005 (A/H6N1) segment 5 (NP) 2416.5 0.000000e+00 1378/1413 (97%)
EPI232399 A/duck/Beijing/61/05 (A/H3N8) segment 5 (NP) 2416.5 0.000000e+00 1378/1413 (97%)
EPI258983 A/aquatic bird/Korea/w217/2007 (A/H5N2) segment 5 (NP) 2411.0 0.000000e+00 1378/1414 (97%)
EPI470417 A/duck/Yunnan/2908/2009 (A/H11N9) segment 5 (NP) 2405.5 0.000000e+00 1376/1413 (97%)
EPI258977 A/aquatic bird/Korea/w202/2007 (A/H5N2) segment 5 (NP) 2405.5 0.000000e+00 1377/1414 (97%)
EPI258982 A/aquatic bird/Korea/w216/2007 (A/H5N2) segment 5 (NP) 2399.9 0.000000e+00 1376/1414 (97%)
EPI438436 A/duck/Vietnam/LBM6/2011 (A/H6N6) segment 5 (NP) 2394.4 0.000000e+00 1374/1413 (97%)
EPI372332 A/shoveler/Egypt/09781-NAMRU3/2004 (A/H10N7) segment 5 (NP) 2383.3 0.000000e+00 1373/1414 (97%)
EPI372308 A/shoveler/Egypt/09782-NAMRU3/2004 (A/H10N7) segment 5 (NP) 2383.3 0.000000e+00 1373/1414 (97%)
EPI118126 A/Chicken/Italy/9097/97 (A/H5N9) segment 5 (NP) 2383.3 0.000000e+00 1372/1413 (97%)
EPI63189 A/chicken/Italy/22A/1998 (A/H5N9) segment 5 (NP) 2383.3 0.000000e+00 1372/1413 (97%)
EPI88881 A/mallard duck/AST/244/1982 (A/H14N6) segment 5 (NP) 2366.7 0.000000e+00 1369/1413 (96%)
EPI240157 A/mallard/Astrakhan/244/1982 (A/H0N6) segment 5 (NP) 2361.1 0.000000e+00 1368/1413 (96%)
EPI10019 A/pheasant/Ireland/PV18/97 (A/H9N2) segment 5 (NP) 2361.1 0.000000e+00 1368/1413 (96%)
EPI485560 A/mallard/Sweden/54/2003 (A/H6N1) segment 5 (NP) 2355.6 0.000000e+00 1367/1413 (96%)
EPI164398 A/turkey/England/N50-92/1991 (A/H5N1) segment 5 (NP) 2355.6 0.000000e+00 1367/1413 (96%)
EPI533780 A/Caspian seal/Russia/T1/2012 (A/H4N6) segment 5 (NP) 2350.1 0.000000e+00 1366/1413 (96%)
EPI533774 A/Caspian seal/Russia/1884/2002 (A/H4N6) segment 5 (NP) 2350.1 0.000000e+00 1366/1413 (96%)
EPI387562 A/Baer's pochard/HuNan/414/2010(H7N1) (A/H7N1) segment 5 (NP) 2350.1 0.000000e+00 1366/1413 (96%)
EPI239866 A/turkey/England/50-92/1991 (A/H5N1) segment 5 (NP) 2350.1 0.000000e+00 1366/1413 (96%)
EPI43319 A/turkey/England/50-92/1991 (A/H5N1) segment 5 (NP) 2350.1 0.000000e+00 1366/1413 (96%)
EPI251859 A/whitefronted goose/Netherlands/2/1999 (A/H6N2) segment 5 (NP) 2344.5 0.000000e+00 1365/1413 (96%)
EPI251676 A/mallard/Sweden/110/2002 (A/H11N7) segment 5 (NP) 2344.5 0.000000e+00 1366/1414 (96%)
EPI251618 A/greylag goose/Netherlands/4/1999 (A/H6N1) segment 5 (NP) 2344.5 0.000000e+00 1365/1413 (96%)
EPI118136 A/mallard/Italy/36/2002 (A/H5N3) segment 5 (NP) 2344.5 0.000000e+00 1365/1413 (96%)
EPI314216 A/wild duck/Taiwan/WB147/2001 (A/H4N6) segment 5 (NP) 2339.0 0.000000e+00 1364/1413 (96%)
EPI251662 A/mallard/Netherlands/2/1999 (A/H3N5) segment 5 (NP) 2339.0 0.000000e+00 1364/1413 (96%)
EPI174848 A/duck/Denmark/75-65472-P34/2003 (A/H3N8) segment 5 (NP) 2339.0 0.000000e+00 1364/1413 (96%)
EPI171204 A/duck/Hokkaido/49/98 (A/H9N2) segment 5 (NP) 2339.0 0.000000e+00 1364/1413 (96%)
EPI102231 A/duck/Taiwan/WB29/99 (A/H6N1) segment 5 (NP) 2339.0 0.000000e+00 1365/1414 (96%)
EPI251817 A/mallard/Sweden/86/2003 (A/H12N5) segment 5 (NP) 2333.4 0.000000e+00 1363/1413 (96%)
EPI251648 A/mallard/Netherlands/12/2001 (A/H4N2) segment 5 (NP) 2333.4 0.000000e+00 1363/1413 (96%)
EPI102229 A/chicken/Taiwan/165/99 (A/H6N1) segment 5 (NP) 2333.4 0.000000e+00 1364/1414 (96%)
EPI7440 A/Duck/Hong Kong/P185/97 (A/H3N8) segment 5 (NP) 2333.4 0.000000e+00 1363/1413 (96%)
EPI7438 A/Aquatic Bird/Hong Kong/m603/98 (A/H11N1) segment 5 (NP) 2333.4 0.000000e+00 1364/1414 (96%)
EPI1362 A/duck/Hokkaido/Vac-2/04 (A/H7N7) segment 5 (NP) 2333.4 0.000000e+00 1363/1413 (96%)
EPI470944 A/duck/Hong Kong/Y439/1997 (A/H9N2) segment 5 (NP) 2327.9 0.000000e+00 1362/1413 (96%)
EPI439551 A/avian/Israel/824/2005 (A/H10N2) segment 5 (NP) 2327.9 0.000000e+00 1363/1414 (96%)
EPI377973 A/mallard/Netherlands/13/1999 (A/H0) segment 5 (NP) 2327.9 0.000000e+00 1362/1413 (96%)
EPI377964 A/mallard/Netherlands/12/1999 (A/H2N9) segment 5 (NP) 2327.9 0.000000e+00 1362/1413 (96%)
EPI377946 A/mallard/Netherlands/11/1999 (A/H2N9) segment 5 (NP) 2327.9 0.000000e+00 1362/1413 (96%)
EPI314232 A/wild duck/Taiwan/WB28/2000 (A/H4N6) segment 5 (NP) 2327.9 0.000000e+00 1362/1413 (96%)
EPI267610 A/mallard/Netherlands/5/1999 (A/H2N9) segment 5 (NP) 2327.9 0.000000e+00 1362/1413 (96%)
EPI89042 A/Pigeon/Nanchang/8-142/2000 (A/H3N6) segment 5 (NP) 2327.9 0.000000e+00 1362/1413 (96%)
EPI7442 A/Duck/Hong Kong/P54/97 (A/H11N9) segment 5 (NP) 2327.9 0.000000e+00 1362/1413 (96%)
EPI514839 A/mallard/Sweden/1869/2003 (A/H4N6) segment 5 (NP) 2322.4 0.000000e+00 1362/1414 (96%)
EPI514794 A/mallard/Sweden/3271/2003 (A/H4N6) segment 5 (NP) 2322.4 0.000000e+00 1362/1414 (96%)
EPI514787 A/mallard/Sweden/3223/2003 (A/H4N6) segment 5 (NP) 2322.4 0.000000e+00 1362/1414 (96%)
EPI485704 A/mallard/Netherlands/8/2001 (A/H4N6) segment 5 (NP) 2322.4 0.000000e+00 1362/1414 (96%)
EPI251778 A/mallard/Sweden/62/2003 (A/H4N6) segment 5 (NP) 2322.4 0.000000e+00 1362/1414 (96%)
EPI89082 A/duck/Nanchang/d106/1997 (A/H4N6) segment 5 (NP) 2322.4 0.000000e+00 1361/1413 (96%)
EPI10011 A/chicken/Germany/R45/98 (A/H9N2) segment 5 (NP) 2322.4 0.000000e+00 1361/1413 (96%)
EPI10005 A/ostrich/South Africa/9508103/95 (A/H9N2) segment 5 (NP) 2322.4 0.000000e+00 1361/1413 (96%)
EPI7436 A/Duck/Hong Kong/T37/97 (A/H11N8) segment 5 (NP) 2322.4 0.000000e+00 1361/1413 (96%)
EPI1744 A/duck/Hokkaido/9/99 (A/H9N2) segment 5 (NP) 2322.4 0.000000e+00 1361/1413 (96%)
EPI514846 A/mallard/Sweden/1883/2003 (A/H4N3) segment 5 (NP) 2316.8 0.000000e+00 1361/1414 (96%)
EPI514780 A/mallard/Sweden/3221/2003 (A/H4N6) segment 5 (NP) 2316.8 0.000000e+00 1361/1414 (96%)
EPI372284 A/shoveler/Egypt/00600-NAMRU3/2004 (A/H10N7) segment 5 (NP) 2316.8 0.000000e+00 1360/1413 (96%)
EPI268652 A/mallard/Jiangxi/227/2003 (A/H6N1) segment 5 (NP) 2316.8 0.000000e+00 1360/1413 (96%)
EPI251701 A/mallard/Sweden/4/2002 (A/H10N2) segment 5 (NP) 2316.8 0.000000e+00 1361/1414 (96%)
EPI251626 A/mallard/Netherlands/1/1999 (A/H4N6) segment 5 (NP) 2316.8 0.000000e+00 1360/1413 (96%)
EPI243273 A/R(duck/Mongolia/54/01-duck/Mongolia/47/01) (A/H5N1) segment 5 (NP) 2316.8 0.000000e+00 1360/1413 (96%)
EPI235052 A/chicken/Jilin/hj/2003 (A/H5N1) segment 5 (NP) 2316.8 0.000000e+00 1360/1413 (96%)
EPI226673 A/Eurasian wigeon/Netherlands/3/2005 (A/H9N2) segment 5 (NP) 2316.8 0.000000e+00 1360/1413 (96%)
EPI89064 A/duck/Nanchang/1681/1992 (A/H3N8) segment 5 (NP) 2316.8 0.000000e+00 1361/1414 (96%)
EPI42100 A/Chicken/Nanchang/7-010/2000 (A/H3N6) segment 5 (NP) 2316.8 0.000000e+00 1360/1413 (96%)
EPI3409 A/duck/Mongolia/54/01 (A/H5N2) segment 5 (NP) 2316.8 0.000000e+00 1360/1413 (96%)
EPI1652 A/duck/Hokkaido/Vac-1/04 (A/H5N1) segment 5 (NP) 2316.8 0.000000e+00 1360/1413 (96%)
EPI296230 A/wild duck/Korea/YS44/2004 (A/H1N2) segment 5 (NP) 2315.0 0.000000e+00 1359/1413 (96%)
EPI296222 A/wild duck/Korea/ESD48/2006 (A/H1N1) segment 5 (NP) 2311.3 0.000000e+00 1359/1413 (96%)
EPI89049 A/Duck/Nanchang/8-174/2000 (A/H3N6) segment 5 (NP) 2311.3 0.000000e+00 1359/1413 (96%)
EPI68956 A/chicken/Victoria/224/1992 (A/H7N3) segment 5 (NP) 2311.3 0.000000e+00 1359/1413 (96%)
EPI5945 A/Duck/Hong Kong/Y439/97 (A/H9N2) segment 5 (NP) 2307.6 0.000000e+00 1358/1413 (96%)
EPI514915 A/mallard/Sweden/274/2002 (A/H4N2) segment 5 (NP) 2305.7 0.000000e+00 1358/1413 (96%)
EPI439828 A/domestic green-winged teal/Hunan/2036/2007 (A/H3N6) segment 5 (NP) 2305.7 0.000000e+00 1358/1413 (96%)
EPI407982 A/mallard/Astrakhan/263/1982 (A/H14N5) segment 5 (NP) 2305.7 0.000000e+00 1358/1413 (96%)
EPI268650 A/mallard/Jiangxi/7787/2003 (A/H6N1) segment 5 (NP) 2305.7 0.000000e+00 1358/1413 (96%)
EPI248513 A/wild duck/Germany/WV30/06 (A/H1N1) segment 5 (NP) 2305.7 0.000000e+00 1358/1413 (96%)

_________________
www.twitter.com/hniman


Top
 Profile  
 
Display posts from previous:  Sort by  
Post new topic Reply to topic  [ 13 posts ]  Go to page 1, 2  Next

All times are UTC - 5 hours [ DST ]


Who is online

Users browsing this forum: Yahoo [Bot] and 59 guests


You cannot post new topics in this forum
You cannot reply to topics in this forum
You cannot edit your posts in this forum
You cannot delete your posts in this forum
You cannot post attachments in this forum

Search for:
Jump to:  
cron
Powered by phpBB® Forum Software © phpBB Group