Rhiza Labs FluTracker Forum

The place to discuss the flu
It is currently Sat Oct 21, 2017 5:02 pm

All times are UTC - 5 hours [ DST ]




Post new topic Reply to topic  [ 5 posts ] 
Author Message
PostPosted: Wed Dec 31, 2014 8:42 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
USDA release September 2014 Iowa Swine Match 2014 H3N2v Cases

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Wed Dec 31, 2014 8:43 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
LOCUS KP186109 1701 bp cRNA linear VRL 17-DEC-2014
DEFINITION Influenza A virus (A/swine/Iowa/A01566472/2014(H3N2)) segment 4
hemagglutinin (HA) gene, complete cds.
ACCESSION KP186109
VERSION KP186109.1 GI:732548833
KEYWORDS .
SOURCE Influenza A virus (A/swine/Iowa/A01566472/2014(H3N2))
ORGANISM Influenza A virus (A/swine/Iowa/A01566472/2014(H3N2))
Viruses; ssRNA negative-strand viruses; Orthomyxoviridae;
Influenzavirus A.
REFERENCE 1 (bases 1 to 1701)
CONSRTM Swine Surveillance
TITLE Direct Submission
JOURNAL Submitted (21-NOV-2014) NAHLN Voluntary Swine Influenza
Surveillance, USDA, 1920 Dayton Ave., Ames, IA 50010, USA
FEATURES Location/Qualifiers
source 1..1701
/organism="Influenza A virus
(A/swine/Iowa/A01566472/2014(H3N2))"
/mol_type="viral cRNA"
/strain="A/swine/Iowa/A01566472/2014"
/serotype="H3N2"
/host="swine"
/db_xref="taxon:1574607"
/segment="4"
/country="USA: Iowa"
/collection_date="24-Sep-2014"
gene 1..1701
/gene="HA"
CDS 1..1701
/gene="HA"
/function="receptor binding and fusion protein"
/codon_start=1
/product="hemagglutinin"
/protein_id="AIZ70302.1"
/db_xref="GI:732548834"
/translation="MKTIIAFSCILCQISAQNLPGSDNSMATLCLGHHAVPNGTLVKT
ITDDQIEVTNATELVQNTSKGEICNSPHQILDGKNCTLIDALLGDPHCDDFQNKKWDL
FVERSTAYSNCYPYYVPDYASLRSLVASSGTLEFTQESFNWTGVTQNGSSYSCRRESD
KSFFSRLNWLYNLNYKYPALNVTMPNNDKFDKLYIWGVHHPGTDQDQTSLYIQASGRV
TVSTKRSQQTVIPNIGSRPWIRGVSSIMSIYWTIVKPGDILLINSTGNLIAPRGYFKI
QSGRSSIMRSDAPIGNCNSECITPNGSIPNDKPFQNVNRITYGACPRYVKQNTLKLAT
GMRNVPEKQTRGIFGAIAGFIENGWEGMVDGWYGFRHQNSEGTGQAADLKSTQAAINQ
ITGKLNRVIKKTNEKFHQIEKEFSEVEGRIQDLEKYVEDTKIDLWSYNAELLVALENQ
HTIDLTDSEMNKLFERTRKQLRENAEDMGNGCFKIYHKCDNACIGSIRNGTYDHDVYR
DEAVNNRFQIKGVQLKLGYKDWILWISFAISCFLLCAVLLGFIMWACQKGNIRCNICI
"
sig_peptide 1..48
/gene="HA"
mat_peptide 49..1035
/gene="HA"
/product="HA1"
mat_peptide 1036..1698
/gene="HA"
/product="HA2"
misc_feature 1..1701
/db_xref="IRD:IRD-A01566472.4"
ORIGIN
1 atgaagacta tcattgcttt tagctgcatc ttatgtcaga tctccgctca aaacctcccc
61 ggaagtgaca acagcatggc aacgctgtgc ctggggcacc acgcagtacc aaacggaacg
121 ttagtgaaaa caataacgga tgaccaaatt gaagtgacta atgctactga gctggtccag
181 aatacctcaa aaggtgaaat atgcaacagt cctcaccaaa tccttgatgg gaaaaattgt
241 acactgatag atgctctatt aggagaccct cattgtgatg acttccaaaa caagaaatgg
301 gacctttttg ttgaacgaag cacagcctac agcaactgtt acccctatta tgtgccggat
361 tatgcctccc ttaggtcact agttgcttca tccggcacct tggaatttac tcaagaaagc
421 ttcaattgga ctggggttac tcaaaacgga tcaagttatt cttgcagaag ggaatctgat
481 aaaagtttct ttagtagatt gaattggtta tataatttga actacaaata tccagcgctg
541 aacgtaacta tgccaaacaa tgacaaattt gacaaattgt acatttgggg ggtacaccac
601 ccgggtacgg accaggacca aaccagccta tatattcaag catcagggag agttacagtc
661 tccaccaaaa ggagccaaca aactgtaatc ccgaatattg ggtctagacc ctggataagg
721 ggtgtctcca gcataatgag catctattgg acaatagtaa aaccgggaga catacttttg
781 attaacagca cagggaatct aattgcccct cggggttact tcaaaataca aagtgggaga
841 agctcaataa tgaggtcaga tgcacccatt ggcaactgca actctgaatg cattacccca
901 aatggaagca ttcccaatga caaacctttt caaaatgtaa acagaataac atatggggca
961 tgtcccagat atgttaagca aaacactctg aaattggcaa caggaatgcg gaatgtgcca
1021 gagaaacaaa ctagaggcat attcggcgca atcgcaggtt tcatagaaaa tggttgggaa
1081 gggatggtgg acggttggta tggtttcagg catcaaaact ctgaaggcac agggcaagca
1141 gcagatctta aaagcactca agcagcaatc aaccaaatca ccgggaaact aaatagagta
1201 atcaagaaga cgaacgaaaa attccatcag atcgaaaaag aattctcaga agtagaaggg
1261 agaattcagg acctagagaa atacgttgaa gacactaaaa tagacctatg gtcttacaac
1321 gcggagcttc ttgttgccct ggagaaccaa catacaattg atctaactga ctcagaaatg
1381 aacaaactgt tcgaaagaac aaggaagcaa ctgcgggaaa atgctgagga catgggcaat
1441 ggatgcttta aaatatatca caaatgtgac aatgcttgca taggatcaat cagaaatgga
1501 acttatgacc atgatgtata cagagacgaa gcagtaaaca atcggttcca gatcaagggt
1561 gttcagctga agttaggata caaagattgg atcctatgga tttcctttgc catatcatgc
1621 tttttgcttt gtgctgttct gctgggattc attatgtggg catgccaaaa aggcaacatt
1681 aggtgcaaca tttgcatttg a

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Wed Dec 31, 2014 8:43 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
EPI508878 A/swine/Minnesota/A01409771/2014 (A/H3N2) segment 4 (HA) 3075.8 0.000000e+00 1689/1701 (99%)
EPI502646 A/swine/South Dakota/A01366205/2013 (A/H3N2) segment 4 (HA) 3075.8 0.000000e+00 1689/1701 (99%)
EPI508840 A/swine/Minnesota/A01410096/2014 (A/H3N2) segment 4 (HA) 3072.1 0.000000e+00 1688/1701 (99%)
EPI499897 A/swine/Minnesota/A01366004/2013 (A/H3N2) segment 4 (HA) 3048.1 0.000000e+00 1685/1702 (99%)
EPI538920 A/swine/Minnesota/A01501738/2014 (A/H3N2) segment 4 (HA) 3044.4 0.000000e+00 1684/1702 (98%)
EPI393232 A/swine/Iowa/A01203612/2012 (A/H3N2) segment 4 (HA) 3014.9 0.000000e+00 1678/1701 (98%)
EPI439850 A/swine/Minnesota/A01432433/2013 (A/H3N2) segment 4 (HA) 3009.3 0.000000e+00 1677/1701 (98%)
EPI391396 A/swine/Iowa/A01203104/2011 (A/H3N2) segment 4 (HA) 3009.3 0.000000e+00 1678/1702 (98%)
EPI390887 A/swine/Iowa/A01203459/2012 (A/H3N2) segment 4 (HA) 3009.3 0.000000e+00 1678/1702 (98%)
EPI378028 A/swine/Minnesota/4/2012 (A/H3N2) segment 4 (HA) 3009.3 0.000000e+00 1677/1701 (98%)
EPI398513 A/swine/Minnesota/A01301665/2012 (A/H3N2) segment 4 (HA) 3003.8 0.000000e+00 1676/1701 (98%)
EPI390827 A/swine/Iowa/A01203304/2012 (A/H3N2) segment 4 (HA) 3003.8 0.000000e+00 1677/1702 (98%)
EPI383524 A/swine/Iowa/A01203492/2012 (A/H3N2) segment 4 (HA) 3003.8 0.000000e+00 1677/1702 (98%)
EPI416888 A/swine/Minnesota/A01442410/2012 (A/H3N2) segment 4 (HA) 2998.2 0.000000e+00 1676/1702 (98%)
EPI399408 A/swine/Minnesota/A01300160/2012 (A/H3N2) segment 4 (HA) 2998.2 0.000000e+00 1675/1701 (98%)
EPI390890 A/swine/Iowa/A01243311/2012 (A/H3N2) segment 4 (HA) 2998.2 0.000000e+00 1676/1702 (98%)
EPI383557 A/swine/Minnesota/A01203412/2012 (A/H0) segment 4 (HA) 2998.2 0.000000e+00 1676/1702 (98%)
EPI399453 A/swine/Iowa/A01300195/2012 (A/H3N2) segment 4 (HA) 2992.7 0.000000e+00 1674/1701 (98%)
EPI399438 A/swine/Iowa/A01300194/2012 (A/H3N2) segment 4 (HA) 2992.7 0.000000e+00 1674/1701 (98%)
EPI391412 A/swine/Iowa/A01203248/2012 (A/H3N2) segment 4 (HA) 2992.7 0.000000e+00 1674/1701 (98%)
EPI463694 A/swine/Illinois/A01271617/2012 (A/H3N2) segment 4 (HA) 2987.2 0.000000e+00 1674/1702 (98%)
EPI408382 A/swine/Illinois/A01271623/2012 (A/H3N2) segment 4 (HA) 2987.2 0.000000e+00 1674/1702 (98%)
EPI408379 A/swine/Minnesota/A01271731/2012 (A/H3N2) segment 4 (HA) 2987.2 0.000000e+00 1673/1701 (98%)
EPI399515 A/swine/Minnesota/A01240792/2012 (A/H3N2) segment 4 (HA) 2987.2 0.000000e+00 1673/1701 (98%)
EPI383523 A/swine/Iowa/A01203482/2012 (A/H3N2) segment 4 (HA) 2987.2 0.000000e+00 1673/1701 (98%)
EPI390886 A/swine/Iowa/A01203463/2012 (A/H3N2) segment 4 (HA) 2985.3 0.000000e+00 1673/1702 (98%)
EPI414162 A/swine/Iowa/A01203891/2012 (A/H0) segment 4 (HA) 2976.1 0.000000e+00 1672/1702 (98%)
EPI406582 A/swine/Iowa/A01203954/2012 (A/H3N2) segment 4 (HA) 2976.1 0.000000e+00 1672/1702 (98%)
EPI406555 A/swine/Iowa/A01203872/2012 (A/H3N2) segment 4 (HA) 2976.1 0.000000e+00 1672/1702 (98%)
EPI433282 A/swine/Minnesota/A01280543/2013 (A/H3N2) segment 4 (HA) 2970.5 0.000000e+00 1670/1701 (98%)
EPI416921 A/swine/Minnesota/A01442411/2012 (A/H3N2) segment 4 (HA) 2970.5 0.000000e+00 1670/1701 (98%)
EPI416882 A/swine/Illinois/A01244402/2012 (A/H3N2) segment 4 (HA) 2970.5 0.000000e+00 1670/1701 (98%)
EPI406622 A/swine/Minnesota/A01271001/2012 (A/H3N2) segment 4 (HA) 2970.5 0.000000e+00 1671/1702 (98%)
EPI406611 A/swine/Minnesota/A01271014/2012 (A/H3N2) segment 4 (HA) 2970.5 0.000000e+00 1671/1702 (98%)
EPI406573 A/swine/Iowa/A01203943/2012 (A/H3N2) segment 4 (HA) 2970.5 0.000000e+00 1671/1702 (98%)
EPI406518 A/swine/Iowa/A01432077/2012 (A/H3N2) segment 4 (HA) 2970.5 0.000000e+00 1671/1702 (98%)
EPI467460 A/swine/Minnesota/A01432932/2013 (A/H3N2) segment 4 (HA) 2966.8 0.000000e+00 1670/1702 (98%)
EPI439859 A/swine/Minnesota/A01432462/2013 (A/H3N2) segment 4 (HA) 2966.8 0.000000e+00 1669/1701 (98%)
EPI492366 A/swine/Minnesota/A01392044/2013 (A/H3N2) segment 4 (HA) 2965.0 0.000000e+00 1669/1701 (98%)
EPI406527 A/swine/Iowa/A01432072/2012 (A/H3N2) segment 4 (HA) 2965.0 0.000000e+00 1670/1702 (98%)
EPI401102 A/swine/Minnesota/A01301617/2012 (A/H3N2) segment 4 (HA) 2965.0 0.000000e+00 1669/1701 (98%)
EPI399450 A/swine/Minnesota/A01300992/2012 (A/H3N2) segment 4 (HA) 2965.0 0.000000e+00 1669/1701 (98%)
EPI453591 A/swine/Minnesota/A01379746/2013 (A/H3N2) segment 4 (HA) 2959.5 0.000000e+00 1668/1701 (98%)
EPI424012 A/swine/Minnesota/A01442898/2012 (A/H3N2) segment 4 (HA) 2959.5 0.000000e+00 1669/1702 (98%)
EPI406462 A/swine/Minnesota/A01271227/2012 (A/H3N2) segment 4 (HA) 2955.8 0.000000e+00 1668/1702 (98%)
EPI414034 A/swine/Iowa/A01279512/2012 (A/H3N2) segment 4 (HA) 2953.9 0.000000e+00 1668/1702 (98%)
EPI399294 A/swine/Minnesota/A01327922/2012 (A/H3N2) segment 4 (HA) 2953.9 0.000000e+00 1667/1701 (98%)
EPI399147 A/swine/Minnesota/A01327921/2012 (A/H3N2) segment 4 (HA) 2953.9 0.000000e+00 1667/1701 (98%)
EPI383529 A/swine/Minnesota/A01203517/2012 (A/H3N2) segment 4 (HA) 2953.9 0.000000e+00 1667/1701 (98%)
EPI408385 A/swine/Minnesota/A01271443/2012 (A/H3N2) segment 4 (HA) 2948.4 0.000000e+00 1668/1703 (97%)
EPI406561 A/swine/Iowa/A01203936/2012 (A/H3N2) segment 4 (HA) 2948.4 0.000000e+00 1667/1702 (97%)
EPI472192 A/swine/Iowa/A01432826/2013 (A/H3N2) segment 4 (HA) 2944.7 0.000000e+00 1666/1702 (97%)
EPI467894 A/swine/Iowa/A01398028/2013 (A/H3N2) segment 4 (HA) 2942.8 0.000000e+00 1666/1702 (97%)
EPI459630 A/swine/Iowa/A01432731/2013 (A/H3N2) segment 4 (HA) 2942.8 0.000000e+00 1666/1702 (97%)
EPI459624 A/swine/Iowa/A01432680/2013 (A/H3N2) segment 4 (HA) 2942.8 0.000000e+00 1666/1702 (97%)
EPI463726 A/swine/Iowa/A01432770/2013 (A/H3N2) segment 4 (HA) 2937.3 0.000000e+00 1665/1702 (97%)
EPI499641 A/swine/Iowa/A01290671/2013 (A/H3N2) segment 4 (HA) 2933.6 0.000000e+00 1664/1702 (97%)
EPI446473 A/swine/Minnesota/A01432544/2013 (A/H3N2) segment 4 (HA) 2933.6 0.000000e+00 1665/1703 (97%)
EPI545828 A/swine/Iowa/A01476395/2014 (A/H3N2) segment 4 (HA) 2931.8 0.000000e+00 1664/1702 (97%)
EPI408401 A/swine/South Dakota/A01279279/2012 (A/H3N2) segment 4 (HA) 2931.8 0.000000e+00 1663/1701 (97%)
EPI406537 A/swine/Minnesota/A01267989/2012 (A/H3N2) segment 4 (HA) 2926.2 0.000000e+00 1663/1702 (97%)
EPI324852 A/swine/Minnesota/A01049346/2010 (A/H3N2) segment 4 (HA) 2926.2 0.000000e+00 1662/1701 (97%)
EPI548241 A/swine/Iowa/A01476456/2014 (A/H3N2) segment 4 (HA) 2920.7 0.000000e+00 1662/1702 (97%)
EPI545370 A/swine/Iowa/A01476238/2014 (A/H3N2) segment 4 (HA) 2920.7 0.000000e+00 1662/1702 (97%)
EPI545268 A/swine/Minnesota/A01565076/2014 (A/H3N2) segment 4 (HA) 2920.7 0.000000e+00 1662/1702 (97%)
EPI544946 A/swine/Minnesota/A01503773/2014 (A/H3N2) segment 4 (HA) 2920.7 0.000000e+00 1662/1702 (97%)
EPI544943 A/swine/Minnesota/A01503777/2014 (A/H3N2) segment 4 (HA) 2920.7 0.000000e+00 1662/1702 (97%)
EPI544940 A/swine/Minnesota/A01503779/2014 (A/H3N2) segment 4 (HA) 2920.7 0.000000e+00 1662/1702 (97%)
EPI544808 A/swine/Minnesota/A01503781/2014 (A/H3N2) segment 4 (HA) 2920.7 0.000000e+00 1662/1702 (97%)
EPI541960 A/Ohio/4319/2014 (A/H3N2) segment 4 (HA) 2920.7 0.000000e+00 1662/1702 (97%)
EPI539159 A/Ohio/02/2014 (A/H3N2) segment 4 (HA) 2920.7 0.000000e+00 1662/1702 (97%)
EPI545773 A/swine/Minnesota/A01565290/2014 (A/H3N2) segment 4 (HA) 2909.6 0.000000e+00 1660/1702 (97%)
EPI487945 A/swine/Minnesota/A01392515/2013 (A/H3N2) segment 4 (HA) 2909.6 0.000000e+00 1660/1702 (97%)
EPI484465 A/swine/Iowa/A01290414/2013 (A/H3N2) segment 4 (HA) 2909.6 0.000000e+00 1661/1703 (97%)
EPI399465 A/swine/Minnesota/A01300213/2012 (A/H3N2) segment 4 (HA) 2909.6 0.000000e+00 1659/1701 (97%)
EPI545140 A/swine/Indiana/A01260591/2014 (A/H3N2) segment 4 (HA) 2904.1 0.000000e+00 1660/1703 (97%)
EPI472146 A/swine/Minnesota/A01397282/2013 (A/H3N2) segment 4 (HA) 2904.1 0.000000e+00 1659/1702 (97%)
EPI545810 A/swine/Indiana/A01476391/2014 (A/H3N2) segment 4 (HA) 2894.8 0.000000e+00 1657/1702 (97%)
EPI546922 A/swine/North Dakota/A01104084/2014 (A/H3N2) segment 4 (HA) 2893.0 0.000000e+00 1657/1702 (97%)
EPI504891 A/swine/Iowa/A01290933/2013 (A/H3N2) segment 4 (HA) 2883.7 0.000000e+00 1655/1702 (97%)
EPI533919 A/swine/Iowa/A01481221/2014 (A/H3N2) segment 4 (HA) 2881.9 0.000000e+00 1656/1703 (97%)
EPI542517 A/swine/Iowa/A01476055/2014 (A/H3N2) segment 4 (HA) 2876.4 0.000000e+00 1654/1702 (97%)
EPI399351 A/swine/Minnesota/A01328451/2012 (A/H3N2) segment 4 (HA) 2848.7 0.000000e+00 1649/1702 (96%)
EPI399204 A/swine/Minnesota/A01125992/2012 (A/H3N2) segment 4 (HA) 2843.1 0.000000e+00 1648/1702 (96%)
EPI399030 A/swine/Minnesota/A01125993/2012 (A/H3N2) segment 4 (HA) 2843.1 0.000000e+00 1648/1702 (96%)
EPI489259 A/swine/Manitoba/02182/2008 (A/H3N2) segment 4 (HA) 2761.9 0.000000e+00 1634/1702 (96%)
EPI490235 A/swine/Manitoba/00446/2005 (A/H3N2) segment 4 (HA) 2748.9 0.000000e+00 1632/1703 (95%)
EPI489252 A/swine/Manitoba/01782/2007 (A/H3N2) segment 4 (HA) 2748.9 0.000000e+00 1632/1703 (95%)
EPI489182 A/swine/Manitoba/00446/2005 (A/H3N2) segment 4 (HA) 2748.9 0.000000e+00 1632/1703 (95%)
EPI489203 A/swine/Alberta/00805/2005 (A/H3N2) segment 4 (HA) 2743.4 0.000000e+00 1631/1703 (95%)
EPI489196 A/swine/Alberta/SG1405/2005 (A/H3N2) segment 4 (HA) 2743.4 0.000000e+00 1631/1703 (95%)
EPI489189 A/swine/British Columbia/00633/2005 (A/H3N2) segment 4 (HA) 2743.4 0.000000e+00 1632/1704 (95%)
EPI488564 A/swine/Minnesota/SG1238/2005 (A/H3N2) segment 4 (HA) 2743.4 0.000000e+00 1631/1703 (95%)
EPI488557 A/swine/Minnesota/SG1236/2005 (A/H3N2) segment 4 (HA) 2743.4 0.000000e+00 1631/1703 (95%)
EPI457162 A/swine/Nebraska/9330/2006 (A/H3N2) segment 4 (HA) 2743.4 0.000000e+00 1631/1703 (95%)
EPI337441 A/swine/Minnesota/00611/2005 (A/H3N2) segment 4 (HA) 2743.4 0.000000e+00 1631/1703 (95%)
EPI489224 A/swine/Manitoba/01179/2006 (A/H3N2) segment 4 (HA) 2737.9 0.000000e+00 1630/1703 (95%)
EPI103199 A/swine/Ontario/33853/2005 (A/H3N2) segment 4 (HA) 2737.9 0.000000e+00 1631/1704 (95%)
EPI103127 A/Ontario/RV1273/2005 (A/H3N2) segment 4 (HA) 2737.9 0.000000e+00 1631/1704 (95%)
EPI488923 A/swine/Georgia/02604/2009 (A/H3N2) segment 4 (HA) 2734.2 0.000000e+00 1629/1702 (95%)

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Wed Dec 31, 2014 8:44 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
EPI508879 A/swine/Minnesota/A01409771/2014 (A/H3N2) segment 6 (NA) 2588.3 0.000000e+00 1407/1410 (99%)
EPI508841 A/swine/Minnesota/A01410096/2014 (A/H3N2) segment 6 (NA) 2584.6 0.000000e+00 1406/1410 (99%)
EPI499899 A/swine/Minnesota/A01366004/2013 (A/H3N2) segment 6 (NA) 2582.7 0.000000e+00 1406/1410 (99%)
EPI502648 A/swine/South Dakota/A01366205/2013 (A/H3N2) segment 6 (NA) 2577.2 0.000000e+00 1405/1410 (99%)
EPI416881 A/swine/Illinois/A01244402/2012 (A/H3N2) segment 6 (NA) 2499.6 0.000000e+00 1391/1410 (98%)
EPI433284 A/swine/Minnesota/A01280543/2013 (A/H3N2) segment 6 (NA) 2488.6 0.000000e+00 1389/1410 (98%)
EPI391420 A/swine/Iowa/A01203104/2011 (A/H3N2) segment 6 (NA) 2488.6 0.000000e+00 1389/1410 (98%)
EPI390851 A/swine/Iowa/A01203304/2012 (A/H3N2) segment 6 (NA) 2488.6 0.000000e+00 1389/1410 (98%)
EPI416887 A/swine/Minnesota/A01442410/2012 (A/H3N2) segment 6 (NA) 2483.0 0.000000e+00 1388/1410 (98%)
EPI406621 A/swine/Minnesota/A01271001/2012 (A/H3N2) segment 6 (NA) 2483.0 0.000000e+00 1388/1410 (98%)
EPI399407 A/swine/Minnesota/A01300160/2012 (A/H3N2) segment 6 (NA) 2483.0 0.000000e+00 1388/1410 (98%)
EPI383535 A/swine/Iowa/A01203492/2012 (A/H3N2) segment 6 (NA) 2483.0 0.000000e+00 1388/1410 (98%)
EPI439858 A/swine/Minnesota/A01432462/2013 (A/H3N2) segment 6 (NA) 2481.2 0.000000e+00 1387/1410 (98%)
EPI472193 A/swine/Iowa/A01432826/2013 (A/H3N2) segment 6 (NA) 2477.5 0.000000e+00 1387/1410 (98%)
EPI399437 A/swine/Iowa/A01300194/2012 (A/H3N2) segment 6 (NA) 2477.5 0.000000e+00 1387/1410 (98%)
EPI390897 A/swine/Iowa/A01203459/2012 (A/H3N2) segment 6 (NA) 2477.5 0.000000e+00 1387/1410 (98%)
EPI390894 A/swine/Iowa/A01243311/2012 (A/H3N2) segment 6 (NA) 2477.5 0.000000e+00 1387/1410 (98%)
EPI398512 A/swine/Minnesota/A01301665/2012 (A/H3N2) segment 6 (NA) 2473.8 0.000000e+00 1386/1410 (98%)
EPI406610 A/swine/Minnesota/A01271014/2012 (A/H3N2) segment 6 (NA) 2471.9 0.000000e+00 1386/1410 (98%)
EPI406517 A/swine/Iowa/A01432077/2012 (A/H3N2) segment 6 (NA) 2471.9 0.000000e+00 1386/1410 (98%)
EPI399452 A/swine/Iowa/A01300195/2012 (A/H3N2) segment 6 (NA) 2471.9 0.000000e+00 1386/1410 (98%)
EPI391437 A/swine/Iowa/A01203248/2012 (A/H3N2) segment 6 (NA) 2471.9 0.000000e+00 1387/1411 (98%)
EPI390896 A/swine/Iowa/A01203463/2012 (A/H3N2) segment 6 (NA) 2471.9 0.000000e+00 1386/1410 (98%)
EPI424011 A/swine/Minnesota/A01442898/2012 (A/H3N2) segment 6 (NA) 2468.2 0.000000e+00 1385/1410 (98%)
EPI492367 A/swine/Minnesota/A01392044/2013 (A/H3N2) segment 6 (NA) 2466.4 0.000000e+00 1385/1410 (98%)
EPI408378 A/swine/Minnesota/A01271731/2012 (A/H3N2) segment 6 (NA) 2466.4 0.000000e+00 1385/1410 (98%)
EPI406560 A/swine/Iowa/A01203936/2012 (A/H3N2) segment 6 (NA) 2466.4 0.000000e+00 1385/1410 (98%)
EPI406554 A/swine/Iowa/A01203872/2012 (A/H3N2) segment 6 (NA) 2466.4 0.000000e+00 1385/1410 (98%)
EPI406526 A/swine/Iowa/A01432072/2012 (A/H3N2) segment 6 (NA) 2466.4 0.000000e+00 1386/1411 (98%)
EPI499645 A/swine/Iowa/A01290671/2013 (A/H3N2) segment 6 (NA) 2460.9 0.000000e+00 1384/1410 (98%)
EPI472147 A/swine/Minnesota/A01397282/2013 (A/H3N2) segment 6 (NA) 2460.9 0.000000e+00 1384/1410 (98%)
EPI459625 A/swine/Iowa/A01432680/2013 (A/H3N2) segment 6 (NA) 2460.9 0.000000e+00 1384/1410 (98%)
EPI446472 A/swine/Minnesota/A01432544/2013 (A/H3N2) segment 6 (NA) 2460.9 0.000000e+00 1384/1410 (98%)
EPI406581 A/swine/Iowa/A01203954/2012 (A/H3N2) segment 6 (NA) 2460.9 0.000000e+00 1384/1410 (98%)
EPI399293 A/swine/Minnesota/A01327922/2012 (A/H3N2) segment 6 (NA) 2460.9 0.000000e+00 1385/1411 (98%)
EPI399146 A/swine/Minnesota/A01327921/2012 (A/H3N2) segment 6 (NA) 2460.9 0.000000e+00 1385/1411 (98%)
EPI383540 A/swine/Minnesota/A01203517/2012 (A/H3N2) segment 6 (NA) 2460.9 0.000000e+00 1385/1411 (98%)
EPI546924 A/swine/North Dakota/A01104084/2014 (A/H3N2) segment 6 (NA) 2455.3 0.000000e+00 1383/1410 (98%)
EPI545811 A/swine/Indiana/A01476391/2014 (A/H3N2) segment 6 (NA) 2455.3 0.000000e+00 1383/1410 (98%)
EPI545141 A/swine/Indiana/A01260591/2014 (A/H3N2) segment 6 (NA) 2455.3 0.000000e+00 1383/1410 (98%)
EPI533921 A/swine/Iowa/A01481221/2014 (A/H3N2) segment 6 (NA) 2455.3 0.000000e+00 1383/1410 (98%)
EPI467454 A/swine/Iowa/A01432902/2013 (A/H0) segment 6 (NA) 2455.3 0.000000e+00 1383/1410 (98%)
EPI459631 A/swine/Iowa/A01432731/2013 (A/H3N2) segment 6 (NA) 2455.3 0.000000e+00 1383/1410 (98%)
EPI446924 A/swine/Ohio/12TOSU50/2012 (A/H3N2) segment 6 (NA) 2455.3 0.000000e+00 1384/1411 (98%)
EPI446916 A/swine/Ohio/12TOSU52/2012 (A/H3N2) segment 6 (NA) 2455.3 0.000000e+00 1384/1411 (98%)
EPI446860 A/swine/Ohio/12TOSU421/2012 (A/H3N2) segment 6 (NA) 2455.3 0.000000e+00 1384/1411 (98%)
EPI446835 A/swine/Ohio/12TOSU433/2012 (A/H3N2) segment 6 (NA) 2455.3 0.000000e+00 1384/1411 (98%)
EPI414036 A/swine/Iowa/A01279512/2012 (A/H3N2) segment 6 (NA) 2455.3 0.000000e+00 1383/1410 (98%)
EPI401703 A/swine/Ohio/12TOSU527/2012 (A/H3N2) segment 6 (NA) 2455.3 0.000000e+00 1384/1411 (98%)
EPI401688 A/swine/Ohio/12TOSU522/2012 (A/H3N2) segment 6 (NA) 2455.3 0.000000e+00 1384/1411 (98%)
EPI398671 A/swine/North Carolina/A01270394/2012 (A/H3N2) segment 6 (NA) 2455.3 0.000000e+00 1384/1411 (98%)
EPI398544 A/swine/Ohio/A00152576/2012 (A/H3N2) segment 6 (NA) 2455.3 0.000000e+00 1384/1411 (98%)
EPI398536 A/swine/Ohio/A01208457/2012 (A/H3N2) segment 6 (NA) 2455.3 0.000000e+00 1384/1411 (98%)
EPI397946 A/Ohio/84/2012 (A/H3N2) segment 6 (NA) 2455.3 0.000000e+00 1384/1411 (98%)
EPI397904 A/Hawaii/03/2012 (A/H3N2) segment 6 (NA) 2455.3 0.000000e+00 1384/1411 (98%)
EPI397626 A/Ohio/57/2012 (A/H3N2) segment 6 (NA) 2455.3 0.000000e+00 1384/1411 (98%)
EPI397554 A/Ohio/86/2012 (A/H3N2) segment 6 (NA) 2455.3 0.000000e+00 1384/1411 (98%)
EPI397425 A/Minnesota/15/2012 (A/H3N2) segment 6 (NA) 2455.3 0.000000e+00 1384/1411 (98%)
EPI397387 A/Indiana/49/2012 (A/H3N2) segment 6 (NA) 2455.3 0.000000e+00 1384/1411 (98%)
EPI397212 A/Indiana/115/2012 (A/H3N2) segment 6 (NA) 2455.3 0.000000e+00 1384/1411 (98%)
EPI396245 A/Indiana/125/2012 (A/H3N2) segment 6 (NA) 2455.3 0.000000e+00 1384/1411 (98%)
EPI396229 A/Indiana/147/2012 (A/H3N2) segment 6 (NA) 2455.3 0.000000e+00 1384/1411 (98%)
EPI396222 A/Indiana/57/2012 (A/H3N2) segment 6 (NA) 2455.3 0.000000e+00 1384/1411 (98%)
EPI396191 A/Ohio/77/2012 (A/H3N2) segment 6 (NA) 2455.3 0.000000e+00 1384/1411 (98%)
EPI395876 A/swine/Ohio/12TOSU447/2012 (A/H3N2) segment 6 (NA) 2455.3 0.000000e+00 1384/1411 (98%)
EPI395868 A/swine/Ohio/12TOSU450/2012 (A/H3N2) segment 6 (NA) 2455.3 0.000000e+00 1384/1411 (98%)
EPI394925 A/Illinois/11/2012 (A/H3N2) segment 6 (NA) 2455.3 0.000000e+00 1384/1411 (98%)
EPI394065 A/Indiana/60/2012 (A/H3N2) segment 6 (NA) 2455.3 0.000000e+00 1384/1411 (98%)
EPI393701 A/Ohio/64/2012 (A/H3N2) segment 6 (NA) 2455.3 0.000000e+00 1384/1411 (98%)
EPI392710 A/Indiana/60/2012 (A/H3N2) segment 6 (NA) 2455.3 0.000000e+00 1384/1411 (98%)
EPI392707 A/Indiana/59/2012 (A/H3N2) segment 6 (NA) 2455.3 0.000000e+00 1384/1411 (98%)
EPI383539 A/swine/Indiana/A01203509/2012 (A/H3N2) segment 6 (NA) 2455.3 0.000000e+00 1384/1411 (98%)
EPI545829 A/swine/Iowa/A01476395/2014 (A/H3N2) segment 6 (NA) 2449.8 0.000000e+00 1382/1410 (98%)
EPI545774 A/swine/Minnesota/A01565290/2014 (A/H3N2) segment 6 (NA) 2449.8 0.000000e+00 1382/1410 (98%)
EPI545371 A/swine/Iowa/A01476238/2014 (A/H3N2) segment 6 (NA) 2449.8 0.000000e+00 1382/1410 (98%)
EPI545269 A/swine/Minnesota/A01565076/2014 (A/H3N2) segment 6 (NA) 2449.8 0.000000e+00 1382/1410 (98%)
EPI544947 A/swine/Minnesota/A01503773/2014 (A/H3N2) segment 6 (NA) 2449.8 0.000000e+00 1382/1410 (98%)
EPI544944 A/swine/Minnesota/A01503777/2014 (A/H3N2) segment 6 (NA) 2449.8 0.000000e+00 1382/1410 (98%)
EPI544941 A/swine/Minnesota/A01503779/2014 (A/H3N2) segment 6 (NA) 2449.8 0.000000e+00 1382/1410 (98%)
EPI544809 A/swine/Minnesota/A01503781/2014 (A/H3N2) segment 6 (NA) 2449.8 0.000000e+00 1382/1410 (98%)
EPI509736 A/swine/Iowa/13H075/2013 (A/H3N2) segment 6 (NA) 2449.8 0.000000e+00 1383/1411 (98%)
EPI492350 A/swine/Indiana/A00968364/2012 (A/H3N2) segment 6 (NA) 2449.8 0.000000e+00 1383/1411 (98%)
EPI446885 A/swine/Ohio/12TOSU409/2012 (A/H3N2) segment 6 (NA) 2449.8 0.000000e+00 1383/1411 (98%)
EPI446876 A/swine/Ohio/12TOSU439/2012 (A/H3N2) segment 6 (NA) 2449.8 0.000000e+00 1383/1411 (98%)
EPI446827 A/swine/Ohio/12TOSU338/2012 (A/H3N2) segment 6 (NA) 2449.8 0.000000e+00 1383/1411 (98%)
EPI446797 A/swine/Ohio/12TOSU333/2012 (A/H3N2) segment 6 (NA) 2449.8 0.000000e+00 1383/1411 (98%)
EPI443547 A/swine/Ohio/12TOSU318/2012 (A/H3N2) segment 6 (NA) 2449.8 0.000000e+00 1383/1411 (98%)
EPI443539 A/swine/Ohio/12TOSU176/2012 (A/H3N2) segment 6 (NA) 2449.8 0.000000e+00 1383/1411 (98%)
EPI443531 A/swine/Ohio/12TOSU129/2012 (A/H3N2) segment 6 (NA) 2449.8 0.000000e+00 1383/1411 (98%)
EPI443523 A/swine/Ohio/12TOSU308/2012 (A/H3N2) segment 6 (NA) 2449.8 0.000000e+00 1383/1411 (98%)
EPI443515 A/swine/Ohio/12TOSU138/2012 (A/H3N2) segment 6 (NA) 2449.8 0.000000e+00 1383/1411 (98%)
EPI443507 A/swine/Ohio/12TOSU175/2012 (A/H3N2) segment 6 (NA) 2449.8 0.000000e+00 1383/1411 (98%)
EPI443111 A/swine/Ohio/A01349495/2013 (A/H3N2) segment 6 (NA) 2449.8 0.000000e+00 1384/1412 (98%)
EPI443101 A/swine/Ohio/A01349302/2013 (A/H3N2) segment 6 (NA) 2449.8 0.000000e+00 1384/1412 (98%)
EPI443098 A/swine/Ohio/A01349305/2013 (A/H3N2) segment 6 (NA) 2449.8 0.000000e+00 1384/1412 (98%)
EPI433303 A/swine/Ohio/12TOSU363/2012 (A/H3N2) segment 6 (NA) 2449.8 0.000000e+00 1383/1411 (98%)
EPI433295 A/swine/Ohio/12TOSU370/2012 (A/H3N2) segment 6 (NA) 2449.8 0.000000e+00 1383/1411 (98%)
EPI426886 A/swine/Iowa/A01432271/2012 (A/H3N2) segment 6 (NA) 2449.8 0.000000e+00 1383/1411 (98%)
EPI414172 A/swine/Indiana/A00968398/2012 (A/H3N2) segment 6 (NA) 2449.8 0.000000e+00 1383/1411 (98%)
EPI414155 A/swine/Iowa/A01244302/2012 (A/H3N2) segment 6 (NA) 2449.8 0.000000e+00 1384/1412 (98%)

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Wed Dec 31, 2014 8:45 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
EPI502647 A/swine/South Dakota/A01366205/2013 (A/H3N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI499898 A/swine/Minnesota/A01366004/2013 (A/H3N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI508880 A/swine/Minnesota/A01409771/2014 (A/H3N2) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI508842 A/swine/Minnesota/A01410096/2014 (A/H3N2) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI504911 A/swine/South Dakota/SJ1319788/2013 (A/H1N1) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
EPI464493 A/swine/South Dakota/A01351105/2013 (A/H1N1) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
EPI408327 A/swine/Minnesota/A01244318/2012 (H1N2) (A/H1N2) segment 7 (MP) 1781.3 0.000000e+00 976/982 (99%)
EPI406653 A/swine/Iowa/A01203944/2012 (A/H1N1) segment 7 (MP) 1781.3 0.000000e+00 976/982 (99%)
EPI406556 A/swine/Iowa/A01203953/2012 (A/H1N1) segment 7 (MP) 1781.3 0.000000e+00 976/982 (99%)
EPI406531 A/swine/Iowa/A01432085/2012 (A/H1N1) segment 7 (MP) 1781.3 0.000000e+00 976/982 (99%)
EPI399505 A/swine/Minnesota/A01240292/2011 (A/H1N1) segment 7 (MP) 1781.3 0.000000e+00 976/982 (99%)
EPI391455 A/swine/Iowa/A01203116/2012 (A/H1N1) segment 7 (MP) 1781.3 0.000000e+00 976/982 (99%)
EPI399103 A/swine/Iowa/A01328941/2012 (A/H1N1) segment 7 (MP) 1779.4 0.000000e+00 975/981 (99%)
EPI467627 A/swine/Minnesota/A01432889/2013 (A/H1N2) segment 7 (MP) 1775.8 0.000000e+00 975/982 (99%)
EPI467535 A/swine/Minnesota/A01351891/2013 (A/H1N1) segment 7 (MP) 1775.8 0.000000e+00 975/982 (99%)
EPI463701 A/swine/Iowa/A01432780/2013 (A/H1N1) segment 7 (MP) 1775.8 0.000000e+00 975/982 (99%)
EPI441646 A/swine/Minnesota/A01445818/2013 (A/H1N1) segment 7 (MP) 1775.8 0.000000e+00 975/982 (99%)
EPI416877 A/swine/Iowa/A01432233/2012 (A/H1N1) segment 7 (MP) 1775.8 0.000000e+00 975/982 (99%)
EPI414157 A/swine/Iowa/A01432141/2012 (A/H1N1) segment 7 (MP) 1775.8 0.000000e+00 975/982 (99%)
EPI414151 A/swine/Iowa/A01432105/2012 (A/H1N2) segment 7 (MP) 1775.8 0.000000e+00 975/982 (99%)
EPI414058 A/swine/Iowa/A01277915/2012 (A/H3N2) segment 7 (MP) 1775.8 0.000000e+00 975/982 (99%)
EPI408377 A/swine/Minnesota/A01271731/2012 (A/H3N2) segment 7 (MP) 1775.8 0.000000e+00 975/982 (99%)
EPI408359 A/swine/South Dakota/A01267825/2012 (A/H1N1) segment 7 (MP) 1775.8 0.000000e+00 975/982 (99%)
EPI408303 A/swine/Minnesota/A01277996/2012 (A/H1N1) segment 7 (MP) 1775.8 0.000000e+00 975/982 (99%)
EPI406519 A/swine/Texas/A01432097/2012 (A/H1N1) segment 7 (MP) 1775.8 0.000000e+00 975/982 (99%)
EPI401163 A/swine/Minnesota/A01270515/2012 (A/H1N1) segment 7 (MP) 1775.8 0.000000e+00 975/982 (99%)
EPI401142 A/swine/Minnesota/A01270516/2012 (A/H1N1) segment 7 (MP) 1775.8 0.000000e+00 975/982 (99%)
EPI401139 A/swine/Minnesota/A01270667/2012 (A/H1N1) segment 7 (MP) 1775.8 0.000000e+00 975/982 (99%)
EPI399427 A/swine/Minnesota/A01301432/2012 (A/H1N1) segment 7 (MP) 1775.8 0.000000e+00 975/982 (99%)
EPI399403 A/swine/Minnesota/A01300441/2012 (A/H1N1) segment 7 (MP) 1775.8 0.000000e+00 975/982 (99%)
EPI399397 A/swine/Minnesota/A01301275/2012 (A/H1N1) segment 7 (MP) 1775.8 0.000000e+00 975/982 (99%)
EPI390909 A/swine/Iowa/A01203441/2012 (A/H1N1) segment 7 (MP) 1775.8 0.000000e+00 975/982 (99%)
EPI390880 A/swine/Iowa/A01203371/2012 (A/H1N1) segment 7 (MP) 1775.8 0.000000e+00 975/982 (99%)
EPI390879 A/swine/Iowa/A01203352/2012 (A/H1N1) segment 7 (MP) 1775.8 0.000000e+00 975/982 (99%)
EPI399298 A/swine/Iowa/A01328943/2012 (A/H1N1) segment 7 (MP) 1773.9 0.000000e+00 974/981 (99%)
EPI399277 A/swine/Illinois/A01327194/2012 (A/H1N1) segment 7 (MP) 1773.9 0.000000e+00 974/981 (99%)
EPI399064 A/swine/Illinois/A01327193/2012 (A/H1N1) segment 7 (MP) 1773.9 0.000000e+00 974/981 (99%)
EPI399049 A/swine/Minnesota/A01241397/2012 (A/H1N1) segment 7 (MP) 1773.9 0.000000e+00 974/981 (99%)
EPI440755 A/swine/Iowa/A0143271/2013 (A/H1N1) segment 7 (MP) 1772.1 0.000000e+00 974/982 (99%)
EPI399256 A/swine/Iowa/A01327334/2012 (A/H1N1) segment 7 (MP) 1772.1 0.000000e+00 973/981 (99%)
EPI548274 A/swine/Iowa/A01478049/2014 (A/H1N1) segment 7 (MP) 1770.2 0.000000e+00 974/982 (99%)
EPI546875 A/swine/Iowa/A01502541/2014 (A/H1N1) segment 7 (MP) 1770.2 0.000000e+00 974/982 (99%)
EPI530342 A/swine/Minnesota/A01480795/2014 (A/H1N1) segment 7 (MP) 1770.2 0.000000e+00 974/982 (99%)
EPI527875 A/swine/Texas/13TOSU0035/2013 (A/H1N1) segment 7 (MP) 1770.2 0.000000e+00 974/982 (99%)
EPI506613 A/swine/Minnesota/A01490569/2013 (A/H1N1) segment 7 (MP) 1770.2 0.000000e+00 974/982 (99%)
EPI504926 A/swine/Minnesota/A01366382/2013 (A/H1N1) segment 7 (MP) 1770.2 0.000000e+00 974/982 (99%)
EPI492368 A/swine/Minnesota/A01392044/2013 (A/H3N2) segment 7 (MP) 1770.2 0.000000e+00 974/982 (99%)
EPI489718 A/swine/Minnesota/A01394048/2013 (A/H1N1) segment 7 (MP) 1770.2 0.000000e+00 974/982 (99%)
EPI487995 A/swine/Iowa/A01290613/2013 (A/H1N1) segment 7 (MP) 1770.2 0.000000e+00 974/982 (99%)
EPI487201 A/swine/Iowa/A01290542/2013 (A/H1N1) segment 7 (MP) 1770.2 0.000000e+00 974/982 (99%)
EPI484439 A/swine/Iowa/A01364403/2013 (A/H1N1) segment 7 (MP) 1770.2 0.000000e+00 974/982 (99%)
EPI476680 A/swine/Minnesota/A01291315/2013 (A/H1N1) segment 7 (MP) 1770.2 0.000000e+00 974/982 (99%)
EPI467622 A/swine/Iowa/A01432819/2013 (A/H1N2) segment 7 (MP) 1770.2 0.000000e+00 974/982 (99%)
EPI467610 A/swine/Iowa/A01432854/2013 (A/H1N2) segment 7 (MP) 1770.2 0.000000e+00 974/982 (99%)
EPI459645 A/swine/Illinois/A01380195/2013 (A/H1N1) segment 7 (MP) 1770.2 0.000000e+00 974/982 (99%)
EPI441667 A/swine/Iowa/A01432535/2013 (A/H1N2) segment 7 (MP) 1770.2 0.000000e+00 974/982 (99%)
EPI439851 A/swine/Mississippi/A01432467/2013 (A/H1N1) segment 7 (MP) 1770.2 0.000000e+00 974/982 (99%)
EPI438221 A/swine/Illinois/A01445196/2013 (A/H1N1) segment 7 (MP) 1770.2 0.000000e+00 974/982 (99%)
EPI407038 A/swine/Minnesota/A01279213/2012 (A/H1N1) segment 7 (MP) 1770.2 0.000000e+00 974/982 (99%)
EPI406565 A/swine/Iowa/A01203890/2012 (A/H1N2) segment 7 (MP) 1770.2 0.000000e+00 974/982 (99%)
EPI401100 A/swine/Minnesota/A01301617/2012 (A/H3N2) segment 7 (MP) 1770.2 0.000000e+00 974/982 (99%)
EPI398125 A/swine/Iowa/A01203755/2012 (A/H1N1) segment 7 (MP) 1770.2 0.000000e+00 974/982 (99%)
EPI398119 A/swine/Iowa/A01203799/2012 (A/H1N1) segment 7 (MP) 1770.2 0.000000e+00 974/982 (99%)
EPI391467 A/swine/Iowa/A01203212/2012 (A/H1N1) segment 7 (MP) 1770.2 0.000000e+00 974/982 (99%)
EPI391104 A/swine/Iowa/A01202421/2011 (A/H1N1) segment 7 (MP) 1770.2 0.000000e+00 974/982 (99%)
EPI390908 A/swine/Iowa/A01203440/2012 (A/H1N1) segment 7 (MP) 1770.2 0.000000e+00 974/982 (99%)
EPI383789 A/swine/Iowa/A01203577/2012 (A/H1N1) segment 7 (MP) 1770.2 0.000000e+00 974/982 (99%)
EPI383543 A/swine/Iowa/A01203481/2012 (A/H1N1) segment 7 (MP) 1770.2 0.000000e+00 974/982 (99%)
EPI542347 A/swine/Indiana/13TOSU1992/2013 (A/H1N1) segment 7 (MP) 1764.7 0.000000e+00 973/982 (99%)
EPI530123 A/Uganda/MUWRP-093/2009 (A/H1N1) segment 7 (MP) 1764.7 0.000000e+00 973/982 (99%)
EPI528473 A/swine/Indiana/13TOSU1998/2013 (A/H1N1) segment 7 (MP) 1764.7 0.000000e+00 973/982 (99%)
EPI527961 A/swine/Indiana/13TOSU1989/2013 (A/H1N1) segment 7 (MP) 1764.7 0.000000e+00 973/982 (99%)
EPI527920 A/swine/Indiana/13TOSU1988/2013 (A/H1N1) segment 7 (MP) 1764.7 0.000000e+00 973/982 (99%)
EPI527206 A/swine/Ohio/13TOSU1020/2013 (A/H1N1) segment 7 (MP) 1764.7 0.000000e+00 973/982 (99%)
EPI527172 A/swine/Ohio/13TOSU1010/2013 (A/H1N1) segment 7 (MP) 1764.7 0.000000e+00 973/982 (99%)
EPI527147 A/swine/Indiana/13TOSU1996/2013 (A/H1N1) segment 7 (MP) 1764.7 0.000000e+00 973/982 (99%)
EPI527045 A/swine/Indiana/13TOSU0504/2013 (A/H1N1) segment 7 (MP) 1764.7 0.000000e+00 973/982 (99%)
EPI527032 A/swine/Indiana/13TOSU1993/2013 (A/H1N1) segment 7 (MP) 1764.7 0.000000e+00 973/982 (99%)
EPI526929 A/swine/Indiana/13TOSU1994/2013 (A/H1N1) segment 7 (MP) 1764.7 0.000000e+00 973/982 (99%)
EPI510251 A/swine/Iowa/A01480170/2014 (A/H1N1) segment 7 (MP) 1764.7 0.000000e+00 973/982 (99%)
EPI508857 A/swine/Iowa/A01410104/2014 (A/H1N1) segment 7 (MP) 1764.7 0.000000e+00 973/982 (99%)
EPI504935 A/swine/Minnesota/A01366468/2013 (A/H1N1) segment 7 (MP) 1764.7 0.000000e+00 973/982 (99%)
EPI504917 A/swine/Iowa/A01366350/2013 (A/H1N1) segment 7 (MP) 1764.7 0.000000e+00 973/982 (99%)
EPI499713 A/swine/Minnesota/A01290679/2013 (A/H1N2) segment 7 (MP) 1764.7 0.000000e+00 973/982 (99%)
EPI492966 A/swine/Minnesota/A01394332/2013 (A/H1N1) segment 7 (MP) 1764.7 0.000000e+00 973/982 (99%)
EPI492618 A/swine/Illinois/A01227426/2013 (A/H1N1) segment 7 (MP) 1764.7 0.000000e+00 973/982 (99%)
EPI492424 A/swine/Indiana/A01290415/2013 (A/H1N1) segment 7 (MP) 1764.7 0.000000e+00 973/982 (99%)
EPI472526 A/swine/South Dakota/A01364180/2013 (A/H1N1) segment 7 (MP) 1764.7 0.000000e+00 973/982 (99%)
EPI468193 A/swine/Indiana/13TOSU486/2013 (A/H1N1) segment 7 (MP) 1764.7 0.000000e+00 973/982 (99%)
EPI468186 A/swine/Minnesota/A01397284/2013 (A/H1N1) segment 7 (MP) 1764.7 0.000000e+00 973/982 (99%)
EPI461012 A/swine/Minnesota/A01350829/2013 (A/H1N1) segment 7 (MP) 1764.7 0.000000e+00 973/982 (99%)
EPI461009 A/swine/Minnesota/A01350755/2013 (A/H1N1) segment 7 (MP) 1764.7 0.000000e+00 973/982 (99%)
EPI457519 A/swine/Kansas/13-108011/2013 (A/H1N1) segment 7 (MP) 1764.7 0.000000e+00 973/982 (99%)
EPI446727 A/swine/Nebraska/A01349435/2013 (A/H1N1) segment 7 (MP) 1764.7 0.000000e+00 973/982 (99%)
EPI443775 A/swine/Illinois/A01443943/2013 (A/H1N1) segment 7 (MP) 1764.7 0.000000e+00 973/982 (99%)
EPI441160 A/swine/California/A00968789/2013 (A/H1N1) segment 7 (MP) 1764.7 0.000000e+00 973/982 (99%)
EPI439893 A/swine/Wyoming/A01445305/2013 (A/H3N2) segment 7 (MP) 1764.7 0.000000e+00 973/982 (99%)
EPI416907 A/swine/Minnesota/A01442414/2012 (A/H1N1) segment 7 (MP) 1764.7 0.000000e+00 973/982 (99%)
EPI416871 A/swine/Colorado/A01432240/2012 (A/H1N1) segment 7 (MP) 1764.7 0.000000e+00 973/982 (99%)
EPI408365 A/swine/Minnesota/A01277094/2012 (A/H1N1) segment 7 (MP) 1764.7 0.000000e+00 973/982 (99%)

_________________
www.twitter.com/hniman


Top
 Profile  
 
Display posts from previous:  Sort by  
Post new topic Reply to topic  [ 5 posts ] 

All times are UTC - 5 hours [ DST ]


Who is online

Users browsing this forum: No registered users and 36 guests


You cannot post new topics in this forum
You cannot reply to topics in this forum
You cannot edit your posts in this forum
You cannot delete your posts in this forum
You cannot post attachments in this forum

Search for:
Jump to:  
Powered by phpBB® Forum Software © phpBB Group