Rhiza Labs FluTracker Forum

The place to discuss the flu
It is currently Mon Oct 16, 2017 10:02 pm

All times are UTC - 5 hours [ DST ]




Post new topic Reply to topic  [ 5 posts ] 
Author Message
PostPosted: Wed Dec 31, 2014 7:43 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
USDA releases October 2014 swine sequences matching 2012 H3N2v cases.

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Wed Dec 31, 2014 7:44 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
LOCUS KP144940 1701 bp cRNA linear VRL 13-DEC-2014
DEFINITION Influenza A virus (A/swine/Illinois/A01520758/2014(H3N2)) segment 4
hemagglutinin (HA) gene, complete cds.
ACCESSION KP144940
VERSION KP144940.1 GI:730045286
KEYWORDS .
SOURCE Influenza A virus (A/swine/Illinois/A01520758/2014(H3N2))
ORGANISM Influenza A virus (A/swine/Illinois/A01520758/2014(H3N2))
Viruses; ssRNA negative-strand viruses; Orthomyxoviridae;
Influenzavirus A.
REFERENCE 1 (bases 1 to 1701)
CONSRTM USDA Swine Surveillance
TITLE Direct Submission
JOURNAL Submitted (14-NOV-2014) National Veterinary Services Laboratories,
USDA, 1920 Dayton Ave, Ames, IA 50010, USA
COMMENT ##Assembly-Data-START##
Sequencing Technology :: Sanger dideoxy sequencing
##Assembly-Data-END##
FEATURES Location/Qualifiers
source 1..1701
/organism="Influenza A virus
(A/swine/Illinois/A01520758/2014(H3N2))"
/mol_type="viral cRNA"
/strain="A/swine/Illinois/A01520758/2014"
/serotype="H3N2"
/isolation_source="oral fluid"
/host="swine"
/db_xref="taxon:1572586"
/segment="4"
/country="USA"
/collection_date="14-Oct-2014"
/note="passage details: P2"
gene 1..1701
/gene="HA"
CDS 1..1701
/gene="HA"
/function="receptor binding and fusion protein"
/codon_start=1
/product="hemagglutinin"
/protein_id="AIZ07379.1"
/db_xref="GI:730045287"
/translation="MKTIIAFSCILCLIFAQKLPESDNSMATLCLGHHAVPNGTLVKT
ITDDQIEVTNATELVQSSSTGRICNSPHQILDGKNCTLIDALLGDPHCDDFQNKEWDL
FVERSTAYSNCYPYYVPDYATLRSLVASSGNLEFTQESFNWTGVAQDGSSSACRRGSV
NSFFSRLNWLYNLNYKYPEQNVTMPNNDKFDKLYIWGVHHPGTDKDQTYLYAQAPGRV
IVSTKRSQQTVTPNIGSRPWVRGVSSIISIYWTIVKPGDMLLINSTGNLIAPRGYFKI
QSGKSSIMRSDAHIDECNSECITPNGSISNDKPFQNVNKITYGACPRYVKQNTLKLAT
GMRNVPEKQTRGIFGAIAGFIENGWEGMVDGWYGFRHQNYEGTGQAADLKSTQAAINQ
ITGKLNRVIKKTNEKFHQIEKEFSEVEGRIQDLEKYVEDTKIDLWSYNAELLVALENQ
HTIDLTDSEMSKLFERTRRQLRENAEDMGNGCFKIYHKCDNACIGSIRNGTYDHDIYR
NEALNNRFQIKGVQLKSGYKDWILWISFAISCFLLCVVLLGFIMRACQTANIRTNICI
"
sig_peptide 1..48
/gene="HA"
mat_peptide 49..1035
/gene="HA"
/product="HA1"
mat_peptide 1036..1698
/gene="HA"
/product="HA2"
ORIGIN
1 atgaagacta tcattgcttt tagctgcatt ctatgtctga ttttcgctca aaaacttccc
61 gaaagtgaca acagcatggc aacgctgtgc ctgggacacc atgcagtgcc aaacggaaca
121 ttagtgaaaa caatcacgga tgatcaaatt gaagtgacta atgctactga gctggtccag
181 agttcctcaa caggtagaat atgcaacagt cctcaccaaa tccttgatgg gaaaaattgc
241 acactgatag atgctctatt gggggaccct cattgtgatg acttccaaaa caaggaatgg
301 gacctttttg ttgaacgaag cacagcctac agcaactgtt acccttatta tgtgccagat
361 tatgccaccc ttaggtcact agttgcctca tctggcaacc tggaatttac ccaagaaagc
421 ttcaattgga ctggagttgc tcaagacgga tcaagctctg cctgcagaag gggatctgtt
481 aacagtttct ttagtagatt gaattggttg tacaacttga attacaagta tccagaacag
541 aacgtaacta tgccaaacaa tgacaaattt gacaaattgt acatttgggg ggttcaccac
601 ccgggtacgg acaaggatca aacctaccta tatgcccaag caccagggag agttatagtc
661 tctaccaaaa gaagccaaca aactgtaacc ccgaatatcg ggtctagacc ctgggtaagg
721 ggtgtatcca gcataataag catctattgg acgatagtaa aaccgggaga catgcttttg
781 attaacagca cagggaatct aattgcccct cggggttact tcaaaataca aagtgggaaa
841 agctcaataa tgagatcaga tgcacacatt gatgagtgca attctgaatg cattactcca
901 aatggaagca tttccaatga caaacctttt caaaatgtaa acaagatcac atatggagcc
961 tgtcccagat atgttaagca aaacaccctg aaattggcaa caggaatgcg gaatgtacca
1021 gagaaacaaa ctagaggcat attcggcgca attgcaggtt tcatagaaaa tggttgggag
1081 ggaatggtag acggttggta cggtttcagg catcagaatt atgaaggcac aggacaagca
1141 gcagatctta aaagcactca agcagcaatc aaccaaatca ccgggaaact aaatagagta
1201 atcaagaaaa cgaacgagaa attccatcaa atcgaaaaag aattctcaga agtagaaggg
1261 agaattcagg acctagagaa atacgttgaa gacactaaaa tagatctctg gtcttacaat
1321 gctgagcttc ttgttgccct ggagaaccaa catacaattg atttaaccga ctcagagatg
1381 agcaaactgt tcgaaagaac aagaaggcaa ctgcgggaaa atgctgagga catggggaat
1441 ggttgcttca aaatatacca caaatgtgac aatgcctgca taggatcaat cagaaatgga
1501 acttatgacc atgatatata cagaaacgag gcattaaaca atcggttcca gatcaaaggt
1561 gttcagctaa aatcaggata caaagattgg atcctatgga tttcctttgc catatcatgc
1621 ttcttgcttt gtgttgttct gctggggttc attatgcggg cctgccaaac agccaacatt
1681 aggaccaaca tttgcatttg a

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Wed Dec 31, 2014 7:46 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
EPI532466 A/swine/Illinois/A01536079/2014 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI505030 A/swine/Illinois/A01409735/2014 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI508905 A/swine/Illinois/A01411343/2014 (A/H0) segment 4 (HA) 3088.7 0.000000e+00 1691/1701 (99%)
EPI532469 A/swine/Illinois/A01536186/2014 (A/H3N2) segment 4 (HA) 3086.9 0.000000e+00 1691/1701 (99%)
EPI532463 A/swine/Illinois/A01536474/2014 (A/H3N2) segment 4 (HA) 3086.9 0.000000e+00 1691/1701 (99%)
EPI531035 A/swine/Illinois/A01475279/2014 (A/H3N2) segment 4 (HA) 3086.9 0.000000e+00 1691/1701 (99%)
EPI531026 A/swine/Illinois/A01475273/2014 (A/H3N2) segment 4 (HA) 3086.9 0.000000e+00 1691/1701 (99%)
EPI539079 A/swine/Illinois/A01502079/2014 (A/H3N2) segment 4 (HA) 3081.3 0.000000e+00 1690/1701 (99%)
EPI544811 A/swine/Illinois/A01503899/2014 (A/H3N2) segment 4 (HA) 3075.8 0.000000e+00 1689/1701 (99%)
EPI539073 A/swine/Illinois/A01502060/2014 (A/H3N2) segment 4 (HA) 3075.8 0.000000e+00 1689/1701 (99%)
EPI539070 A/swine/Illinois/A01502049/2014 (A/H3N2) segment 4 (HA) 3075.8 0.000000e+00 1689/1701 (99%)
EPI539067 A/swine/Illinois/A01501987/2014 (A/H3N2) segment 4 (HA) 3075.8 0.000000e+00 1689/1701 (99%)
EPI539076 A/swine/Illinois/A01502053/2014 (A/H3N2) segment 4 (HA) 3070.3 0.000000e+00 1688/1701 (99%)
EPI467961 A/swine/Minnesota/A01351603/2013 (A/H3N2) segment 4 (HA) 3070.3 0.000000e+00 1688/1701 (99%)
EPI545158 A/swine/Illinois/A00843206/2014 (A/H3N2) segment 4 (HA) 3064.7 0.000000e+00 1687/1701 (99%)
EPI539064 A/swine/Illinois/A01502005/2014 (A/H3N2) segment 4 (HA) 3064.7 0.000000e+00 1687/1701 (99%)
EPI492941 A/swine/Iowa/A01365015/2013 (A/H3N2) segment 4 (HA) 3059.2 0.000000e+00 1686/1701 (99%)
EPI487335 A/swine/Minnesota/A01364816/2013 (A/H3N2) segment 4 (HA) 3037.0 0.000000e+00 1682/1701 (98%)
EPI396280 A/Indiana/144/2012 (A/H3N2) segment 4 (HA) 3037.0 0.000000e+00 1682/1701 (98%)
EPI528431 A/swine/Ohio/13TOSU1547/2013 (A/H3N2) segment 4 (HA) 3031.5 0.000000e+00 1681/1701 (98%)
EPI527870 A/swine/Ohio/13TOSU2043/2013 (A/H3N2) segment 4 (HA) 3031.5 0.000000e+00 1681/1701 (98%)
EPI527113 A/swine/Ohio/13TOSU2052/2013 (A/H3N2) segment 4 (HA) 3031.5 0.000000e+00 1681/1701 (98%)
EPI451202 A/swine/Alabama/A01104056/2012 (A/H0) segment 4 (HA) 3031.5 0.000000e+00 1681/1701 (98%)
EPI446888 A/swine/Ohio/12TOSU409/2012 (A/H3N2) segment 4 (HA) 3031.5 0.000000e+00 1681/1701 (98%)
EPI446879 A/swine/Ohio/12TOSU439/2012 (A/H3N2) segment 4 (HA) 3031.5 0.000000e+00 1681/1701 (98%)
EPI446800 A/swine/Ohio/12TOSU333/2012 (A/H3N2) segment 4 (HA) 3031.5 0.000000e+00 1681/1701 (98%)
EPI443550 A/swine/Ohio/12TOSU318/2012 (A/H3N2) segment 4 (HA) 3031.5 0.000000e+00 1681/1701 (98%)
EPI426887 A/swine/Iowa/A01432271/2012 (A/H3N2) segment 4 (HA) 3031.5 0.000000e+00 1681/1701 (98%)
EPI414186 A/swine/Indiana/A00968394/2012 (A/H3N2) segment 4 (HA) 3031.5 0.000000e+00 1681/1701 (98%)
EPI414170 A/swine/Indiana/A00968398/2012 (A/H3N2) segment 4 (HA) 3031.5 0.000000e+00 1681/1701 (98%)
EPI408202 A/swine/Indiana/A01260099/2012 (A/H3N2) segment 4 (HA) 3031.5 0.000000e+00 1681/1701 (98%)
EPI406576 A/swine/Iowa/A01203863/2012 (A/H3N2) segment 4 (HA) 3031.5 0.000000e+00 1681/1701 (98%)
EPI406504 A/swine/Iowa/A01267939/2012 (A/H3N2) segment 4 (HA) 3031.5 0.000000e+00 1681/1701 (98%)
EPI404890 A/Iowa/16/2012 (A/H3N2) segment 4 (HA) 3031.5 0.000000e+00 1681/1701 (98%)
EPI401609 A/swine/Ohio/A00138552/2012 (A/H3N2) segment 4 (HA) 3031.5 0.000000e+00 1681/1701 (98%)
EPI397913 A/Indiana/123/2012 (A/H3N2) segment 4 (HA) 3031.5 0.000000e+00 1681/1701 (98%)
EPI397912 A/Indiana/114/2012 (A/H3N2) segment 4 (HA) 3031.5 0.000000e+00 1681/1701 (98%)
EPI397906 A/Illinois/11/2012 (A/H3N2) segment 4 (HA) 3031.5 0.000000e+00 1681/1701 (98%)
EPI397662 A/Maryland/28/2012 (A/H3N2) segment 4 (HA) 3031.5 0.000000e+00 1681/1701 (98%)
EPI397396 A/Indiana/93/2012 (A/H3N2) segment 4 (HA) 3031.5 0.000000e+00 1681/1701 (98%)
EPI397211 A/Indiana/113/2012 (A/H3N2) segment 4 (HA) 3031.5 0.000000e+00 1681/1701 (98%)
EPI397210 A/Maryland/25/2012 (A/H3N2) segment 4 (HA) 3031.5 0.000000e+00 1681/1701 (98%)
EPI397006 A/Ohio/78/2012 (A/H3N2) segment 4 (HA) 3031.5 0.000000e+00 1681/1701 (98%)
EPI396262 A/Indiana/127/2012 (A/H3N2) segment 4 (HA) 3031.5 0.000000e+00 1681/1701 (98%)
EPI396254 A/Indiana/126/2012 (A/H3N2) segment 4 (HA) 3031.5 0.000000e+00 1681/1701 (98%)
EPI395883 A/swine/Ohio/12TOSU307/2012 (A/H3N2) segment 4 (HA) 3031.5 0.000000e+00 1681/1701 (98%)
EPI395259 A/Ohio/35/2012 (A/H3N2) segment 4 (HA) 3031.5 0.000000e+00 1681/1701 (98%)
EPI394944 A/Maryland/22/2012 (A/H3N2) segment 4 (HA) 3031.5 0.000000e+00 1681/1701 (98%)
EPI393306 A/Indiana/18/2012 (A/H3N2) segment 4 (HA) 3031.5 0.000000e+00 1681/1701 (98%)
EPI392926 A/Maryland/20/2012 (A/H3N2) segment 4 (HA) 3031.5 0.000000e+00 1681/1701 (98%)
EPI388352 A/Indiana/20/2012 (A/H3N2) segment 4 (HA) 3031.5 0.000000e+00 1681/1701 (98%)
EPI388346 A/Indiana/15/2012 (A/H3N2) segment 4 (HA) 3031.5 0.000000e+00 1681/1701 (98%)
EPI388298 A/Indiana/19/2012 (A/H3N2) segment 4 (HA) 3031.5 0.000000e+00 1681/1701 (98%)
EPI388282 A/Indiana/13/2012 (A/H3N2) segment 4 (HA) 3031.5 0.000000e+00 1681/1701 (98%)
EPI398492 A/swine/Maryland/A01104048/2012 (A/H3N2) segment 4 (HA) 3027.8 0.000000e+00 1680/1701 (98%)
EPI493012 A/swine/Kansas/A01377090/2013 (A/H3N2) segment 4 (HA) 3025.9 0.000000e+00 1680/1701 (98%)
EPI492349 A/swine/Indiana/A00968364/2012 (A/H3N2) segment 4 (HA) 3025.9 0.000000e+00 1680/1701 (98%)
EPI446927 A/swine/Ohio/12TOSU50/2012 (A/H3N2) segment 4 (HA) 3025.9 0.000000e+00 1680/1701 (98%)
EPI446919 A/swine/Ohio/12TOSU52/2012 (A/H3N2) segment 4 (HA) 3025.9 0.000000e+00 1680/1701 (98%)
EPI446863 A/swine/Ohio/12TOSU421/2012 (A/H3N2) segment 4 (HA) 3025.9 0.000000e+00 1680/1701 (98%)
EPI446830 A/swine/Ohio/12TOSU338/2012 (A/H3N2) segment 4 (HA) 3025.9 0.000000e+00 1680/1701 (98%)
EPI443558 A/swine/Ohio/12TOSU325/2012 (A/H3N2) segment 4 (HA) 3025.9 0.000000e+00 1680/1701 (98%)
EPI443526 A/swine/Ohio/12TOSU308/2012 (A/H3N2) segment 4 (HA) 3025.9 0.000000e+00 1680/1701 (98%)
EPI433540 A/swine/Ohio/12TOSU374/2012 (A/H3N2) segment 4 (HA) 3025.9 0.000000e+00 1680/1701 (98%)
EPI433533 A/swine/Ohio/12TOSU371/2012 (A/H3N2) segment 4 (HA) 3025.9 0.000000e+00 1680/1701 (98%)
EPI433306 A/swine/Ohio/12TOSU363/2012 (A/H3N2) segment 4 (HA) 3025.9 0.000000e+00 1680/1701 (98%)
EPI433298 A/swine/Ohio/12TOSU370/2012 (A/H3N2) segment 4 (HA) 3025.9 0.000000e+00 1680/1701 (98%)
EPI424073 A/swine/Michigan/A01259003/2012 (A/H3N2) segment 4 (HA) 3025.9 0.000000e+00 1680/1701 (98%)
EPI414178 A/swine/Pennsylvania/A01104050/2012 (A/H3N2) segment 4 (HA) 3025.9 0.000000e+00 1680/1701 (98%)
EPI406530 A/swine/Illinois/A01432127/2012 (A/H3N2) segment 4 (HA) 3025.9 0.000000e+00 1680/1701 (98%)
EPI401702 A/swine/Ohio/12TOSU527/2012 (A/H3N2) segment 4 (HA) 3025.9 0.000000e+00 1680/1701 (98%)
EPI401684 A/swine/Ohio/12TOSU484/2012 (A/H3N2) segment 4 (HA) 3025.9 0.000000e+00 1680/1701 (98%)
EPI401680 A/swine/Ohio/12TOSU483/2012 (A/H3N2) segment 4 (HA) 3025.9 0.000000e+00 1680/1701 (98%)
EPI401667 A/swine/Pennsylvania/A01104049/2012 (A/H3N2) segment 4 (HA) 3025.9 0.000000e+00 1680/1701 (98%)
EPI400105 A/swine/Indiana/A00968308/2012 (A/H3N2) segment 4 (HA) 3025.9 0.000000e+00 1680/1701 (98%)
EPI398542 A/swine/Ohio/A00152576/2012 (A/H3N2) segment 4 (HA) 3025.9 0.000000e+00 1680/1701 (98%)
EPI398534 A/swine/Ohio/A01208457/2012 (A/H3N2) segment 4 (HA) 3025.9 0.000000e+00 1680/1701 (98%)
EPI398526 A/swine/Wisconsin/A00677500/2012 (A/H3N2) segment 4 (HA) 3025.9 0.000000e+00 1680/1701 (98%)
EPI398518 A/swine/Ohio/A01133464/2012 (A/H3N2) segment 4 (HA) 3025.9 0.000000e+00 1680/1701 (98%)
EPI398500 A/swine/Ohio/A01133466/2012 (A/H3N2) segment 4 (HA) 3025.9 0.000000e+00 1680/1701 (98%)
EPI398479 A/swine/Maryland/A01104040/2012 (A/H3N2) segment 4 (HA) 3025.9 0.000000e+00 1680/1701 (98%)
EPI397969 A/Wisconsin/34/2012 (A/H3N2) segment 4 (HA) 3025.9 0.000000e+00 1680/1701 (98%)
EPI397962 A/Wisconsin/30/2012 (A/H3N2) segment 4 (HA) 3025.9 0.000000e+00 1680/1701 (98%)
EPI397954 A/Ohio/85/2012 (A/H3N2) segment 4 (HA) 3025.9 0.000000e+00 1680/1701 (98%)
EPI397939 A/Ohio/41/2012 (A/H3N2) segment 4 (HA) 3025.9 0.000000e+00 1680/1701 (98%)
EPI397548 A/Ohio/84/2012 (A/H3N2) segment 4 (HA) 3025.9 0.000000e+00 1680/1701 (98%)
EPI397540 A/Ohio/56/2012 (A/H3N2) segment 4 (HA) 3025.9 0.000000e+00 1680/1701 (98%)
EPI397532 A/Ohio/47/2012 (A/H3N2) segment 4 (HA) 3025.9 0.000000e+00 1680/1701 (98%)
EPI397524 A/Ohio/44/2012 (A/H3N2) segment 4 (HA) 3025.9 0.000000e+00 1680/1701 (98%)
EPI397516 A/Ohio/36/2012 (A/H3N2) segment 4 (HA) 3025.9 0.000000e+00 1680/1701 (98%)
EPI397503 A/Indiana/104/2012 (A/H3N2) segment 4 (HA) 3025.9 0.000000e+00 1680/1701 (98%)
EPI397446 A/Wisconsin/31/2012 (A/H3N2) segment 4 (HA) 3025.9 0.000000e+00 1680/1701 (98%)
EPI397432 A/Ohio/81/2012 (A/H3N2) segment 4 (HA) 3025.9 0.000000e+00 1680/1701 (98%)
EPI397426 A/Minnesota/15/2012 (A/H3N2) segment 4 (HA) 3025.9 0.000000e+00 1680/1701 (98%)
EPI397385 A/Indiana/138/2012 (A/H3N2) segment 4 (HA) 3025.9 0.000000e+00 1680/1701 (98%)
EPI397351 A/Ohio/37/2012 (A/H3N2) segment 4 (HA) 3025.9 0.000000e+00 1680/1701 (98%)
EPI397340 A/Indiana/150/2012 (A/H3N2) segment 4 (HA) 3025.9 0.000000e+00 1680/1701 (98%)
EPI397089 A/Indiana/52/2012 (A/H3N2) segment 4 (HA) 3025.9 0.000000e+00 1680/1701 (98%)
EPI396299 A/Maryland/23/2012 (A/H3N2) segment 4 (HA) 3025.9 0.000000e+00 1680/1701 (98%)
EPI396208 A/Indiana/149/2012 (A/H3N2) segment 4 (HA) 3025.9 0.000000e+00 1680/1701 (98%)

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Wed Dec 31, 2014 7:51 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
EPI544812 A/swine/Illinois/A01503899/2014 (A/H3N2) segment 6 (NA) 2582.7 0.000000e+00 1406/1410 (99%)
EPI532471 A/swine/Illinois/A01536186/2014 (A/H3N2) segment 6 (NA) 2582.7 0.000000e+00 1406/1410 (99%)
EPI532468 A/swine/Illinois/A01536079/2014 (A/H3N2) segment 6 (NA) 2582.7 0.000000e+00 1406/1410 (99%)
EPI532465 A/swine/Illinois/A01536474/2014 (A/H3N2) segment 6 (NA) 2582.7 0.000000e+00 1406/1410 (99%)
EPI539074 A/swine/Illinois/A01502060/2014 (A/H3N2) segment 6 (NA) 2577.2 0.000000e+00 1405/1410 (99%)
EPI539071 A/swine/Illinois/A01502049/2014 (A/H3N2) segment 6 (NA) 2577.2 0.000000e+00 1405/1410 (99%)
EPI539068 A/swine/Illinois/A01501987/2014 (A/H3N2) segment 6 (NA) 2577.2 0.000000e+00 1405/1410 (99%)
EPI531036 A/swine/Illinois/A01475279/2014 (A/H3N2) segment 6 (NA) 2573.5 0.000000e+00 1404/1410 (99%)
EPI531027 A/swine/Illinois/A01475273/2014 (A/H3N2) segment 6 (NA) 2573.5 0.000000e+00 1404/1410 (99%)
EPI539077 A/swine/Illinois/A01502053/2014 (A/H3N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI508906 A/swine/Illinois/A01411343/2014 (A/H0) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI539080 A/swine/Illinois/A01502079/2014 (A/H3N2) segment 6 (NA) 2566.1 0.000000e+00 1403/1410 (99%)
EPI539065 A/swine/Illinois/A01502005/2014 (A/H3N2) segment 6 (NA) 2566.1 0.000000e+00 1403/1410 (99%)
EPI505031 A/swine/Illinois/A01409735/2014 (A/H3N2) segment 6 (NA) 2566.1 0.000000e+00 1403/1410 (99%)
EPI545159 A/swine/Illinois/A00843206/2014 (A/H3N2) segment 6 (NA) 2555.0 0.000000e+00 1401/1410 (99%)
EPI492943 A/swine/Iowa/A01365015/2013 (A/H3N2) segment 6 (NA) 2555.0 0.000000e+00 1401/1410 (99%)
EPI487337 A/swine/Minnesota/A01364816/2013 (A/H3N2) segment 6 (NA) 2549.5 0.000000e+00 1400/1410 (99%)
EPI501537 A/swine/Minnesota/A01366050/2013 (A/H3N2) segment 6 (NA) 2544.0 0.000000e+00 1399/1410 (99%)
EPI467963 A/swine/Minnesota/A01351603/2013 (A/H3N2) segment 6 (NA) 2544.0 0.000000e+00 1399/1410 (99%)
EPI460976 A/swine/Minnesota/A01350866/2013 (A/H3N2) segment 6 (NA) 2544.0 0.000000e+00 1399/1410 (99%)
EPI502642 A/swine/South Dakota/A01366093/2013 (A/H3N2) segment 6 (NA) 2538.4 0.000000e+00 1398/1410 (99%)
EPI448835 A/swine/Kansas/13-105721a/2013 (A/H3N2) segment 6 (NA) 2538.4 0.000000e+00 1398/1410 (99%)
EPI446924 A/swine/Ohio/12TOSU50/2012 (A/H3N2) segment 6 (NA) 2538.4 0.000000e+00 1398/1410 (99%)
EPI446916 A/swine/Ohio/12TOSU52/2012 (A/H3N2) segment 6 (NA) 2538.4 0.000000e+00 1398/1410 (99%)
EPI446860 A/swine/Ohio/12TOSU421/2012 (A/H3N2) segment 6 (NA) 2538.4 0.000000e+00 1398/1410 (99%)
EPI446835 A/swine/Ohio/12TOSU433/2012 (A/H3N2) segment 6 (NA) 2538.4 0.000000e+00 1398/1410 (99%)
EPI433281 A/swine/Minnesota/A01280462/2013 (A/H3N2) segment 6 (NA) 2538.4 0.000000e+00 1398/1410 (99%)
EPI401703 A/swine/Ohio/12TOSU527/2012 (A/H3N2) segment 6 (NA) 2538.4 0.000000e+00 1398/1410 (99%)
EPI401688 A/swine/Ohio/12TOSU522/2012 (A/H3N2) segment 6 (NA) 2538.4 0.000000e+00 1398/1410 (99%)
EPI398671 A/swine/North Carolina/A01270394/2012 (A/H3N2) segment 6 (NA) 2538.4 0.000000e+00 1398/1410 (99%)
EPI398544 A/swine/Ohio/A00152576/2012 (A/H3N2) segment 6 (NA) 2538.4 0.000000e+00 1398/1410 (99%)
EPI398536 A/swine/Ohio/A01208457/2012 (A/H3N2) segment 6 (NA) 2538.4 0.000000e+00 1398/1410 (99%)
EPI397946 A/Ohio/84/2012 (A/H3N2) segment 6 (NA) 2538.4 0.000000e+00 1398/1410 (99%)
EPI397904 A/Hawaii/03/2012 (A/H3N2) segment 6 (NA) 2538.4 0.000000e+00 1398/1410 (99%)
EPI397626 A/Ohio/57/2012 (A/H3N2) segment 6 (NA) 2538.4 0.000000e+00 1398/1410 (99%)
EPI397554 A/Ohio/86/2012 (A/H3N2) segment 6 (NA) 2538.4 0.000000e+00 1398/1410 (99%)
EPI397425 A/Minnesota/15/2012 (A/H3N2) segment 6 (NA) 2538.4 0.000000e+00 1398/1410 (99%)
EPI396191 A/Ohio/77/2012 (A/H3N2) segment 6 (NA) 2538.4 0.000000e+00 1398/1410 (99%)
EPI395876 A/swine/Ohio/12TOSU447/2012 (A/H3N2) segment 6 (NA) 2538.4 0.000000e+00 1398/1410 (99%)
EPI395868 A/swine/Ohio/12TOSU450/2012 (A/H3N2) segment 6 (NA) 2538.4 0.000000e+00 1398/1410 (99%)
EPI394925 A/Illinois/11/2012 (A/H3N2) segment 6 (NA) 2538.4 0.000000e+00 1398/1410 (99%)
EPI393701 A/Ohio/64/2012 (A/H3N2) segment 6 (NA) 2538.4 0.000000e+00 1398/1410 (99%)
EPI383539 A/swine/Indiana/A01203509/2012 (A/H3N2) segment 6 (NA) 2538.4 0.000000e+00 1398/1410 (99%)
EPI546918 A/swine/Indiana/13TOSU1054/2013 (A/H0) segment 6 (NA) 2532.9 0.000000e+00 1397/1410 (99%)
EPI546892 A/swine/Indiana/13TOSU1141/2013 (A/H0) segment 6 (NA) 2532.9 0.000000e+00 1397/1410 (99%)
EPI527842 A/swine/Indiana/13TOSU1047/2013 (A/H1N2) segment 6 (NA) 2532.9 0.000000e+00 1397/1410 (99%)
EPI527152 A/swine/Indiana/13TOSU1048/2013 (A/H1N2) segment 6 (NA) 2532.9 0.000000e+00 1397/1410 (99%)
EPI527135 A/swine/Indiana/13TOSU1058/2013 (A/H1N2) segment 6 (NA) 2532.9 0.000000e+00 1397/1410 (99%)
EPI527073 A/swine/Indiana/13TOSU1045/2013 (A/H1N2) segment 6 (NA) 2532.9 0.000000e+00 1397/1410 (99%)
EPI527050 A/swine/Indiana/13TOSU1060/2013 (A/H1N2) segment 6 (NA) 2532.9 0.000000e+00 1397/1410 (99%)
EPI527008 A/swine/Indiana/13TOSU1056/2013 (A/H1N2) segment 6 (NA) 2532.9 0.000000e+00 1397/1410 (99%)
EPI527002 A/swine/Indiana/13TOSU1049/2013 (A/H1N2) segment 6 (NA) 2532.9 0.000000e+00 1397/1410 (99%)
EPI526977 A/swine/Indiana/13TOSU1052/2013 (A/H1N2) segment 6 (NA) 2532.9 0.000000e+00 1397/1410 (99%)
EPI526940 A/swine/Indiana/13TOSU1044/2013 (A/H1N2) segment 6 (NA) 2532.9 0.000000e+00 1397/1410 (99%)
EPI526912 A/swine/Indiana/13TOSU1053/2013 (A/H1N2) segment 6 (NA) 2532.9 0.000000e+00 1397/1410 (99%)
EPI509736 A/swine/Iowa/13H075/2013 (A/H3N2) segment 6 (NA) 2532.9 0.000000e+00 1397/1410 (99%)
EPI492350 A/swine/Indiana/A00968364/2012 (A/H3N2) segment 6 (NA) 2532.9 0.000000e+00 1397/1410 (99%)
EPI468208 A/swine/Indiana/13TOSU490/2013 (A/H3N2) segment 6 (NA) 2532.9 0.000000e+00 1397/1410 (99%)
EPI468200 A/swine/Indiana/13TOSU482/2013 (A/H3N2) segment 6 (NA) 2532.9 0.000000e+00 1397/1410 (99%)
EPI465419 A/Indiana/17/2013 (A/H3N2) segment 6 (NA) 2532.9 0.000000e+00 1397/1410 (99%)
EPI446885 A/swine/Ohio/12TOSU409/2012 (A/H3N2) segment 6 (NA) 2532.9 0.000000e+00 1397/1410 (99%)
EPI446876 A/swine/Ohio/12TOSU439/2012 (A/H3N2) segment 6 (NA) 2532.9 0.000000e+00 1397/1410 (99%)
EPI446827 A/swine/Ohio/12TOSU338/2012 (A/H3N2) segment 6 (NA) 2532.9 0.000000e+00 1397/1410 (99%)
EPI446797 A/swine/Ohio/12TOSU333/2012 (A/H3N2) segment 6 (NA) 2532.9 0.000000e+00 1397/1410 (99%)
EPI443547 A/swine/Ohio/12TOSU318/2012 (A/H3N2) segment 6 (NA) 2532.9 0.000000e+00 1397/1410 (99%)
EPI443539 A/swine/Ohio/12TOSU176/2012 (A/H3N2) segment 6 (NA) 2532.9 0.000000e+00 1397/1410 (99%)
EPI443531 A/swine/Ohio/12TOSU129/2012 (A/H3N2) segment 6 (NA) 2532.9 0.000000e+00 1397/1410 (99%)
EPI443523 A/swine/Ohio/12TOSU308/2012 (A/H3N2) segment 6 (NA) 2532.9 0.000000e+00 1397/1410 (99%)
EPI443515 A/swine/Ohio/12TOSU138/2012 (A/H3N2) segment 6 (NA) 2532.9 0.000000e+00 1397/1410 (99%)
EPI443507 A/swine/Ohio/12TOSU175/2012 (A/H3N2) segment 6 (NA) 2532.9 0.000000e+00 1397/1410 (99%)
EPI443111 A/swine/Ohio/A01349495/2013 (A/H3N2) segment 6 (NA) 2532.9 0.000000e+00 1397/1410 (99%)
EPI443101 A/swine/Ohio/A01349302/2013 (A/H3N2) segment 6 (NA) 2532.9 0.000000e+00 1397/1410 (99%)
EPI443098 A/swine/Ohio/A01349305/2013 (A/H3N2) segment 6 (NA) 2532.9 0.000000e+00 1397/1410 (99%)
EPI433303 A/swine/Ohio/12TOSU363/2012 (A/H3N2) segment 6 (NA) 2532.9 0.000000e+00 1397/1410 (99%)
EPI433295 A/swine/Ohio/12TOSU370/2012 (A/H3N2) segment 6 (NA) 2532.9 0.000000e+00 1397/1410 (99%)
EPI426886 A/swine/Iowa/A01432271/2012 (A/H3N2) segment 6 (NA) 2532.9 0.000000e+00 1397/1410 (99%)
EPI414172 A/swine/Indiana/A00968398/2012 (A/H3N2) segment 6 (NA) 2532.9 0.000000e+00 1397/1410 (99%)
EPI404892 A/Iowa/16/2012 (A/H3N2) segment 6 (NA) 2532.9 0.000000e+00 1397/1410 (99%)
EPI401685 A/swine/Ohio/12TOSU484/2012 (A/H3N2) segment 6 (NA) 2532.9 0.000000e+00 1397/1410 (99%)
EPI401681 A/swine/Ohio/12TOSU483/2012 (A/H3N2) segment 6 (NA) 2532.9 0.000000e+00 1397/1410 (99%)
EPI400106 A/swine/Indiana/A00968308/2012 (A/H3N2) segment 6 (NA) 2532.9 0.000000e+00 1397/1410 (99%)
EPI400102 A/swine/Indiana/A00968397/2012 (A/H3N2) segment 6 (NA) 2532.9 0.000000e+00 1397/1410 (99%)
EPI400096 A/swine/Indiana/A00968390/2012 (A/H3N2) segment 6 (NA) 2532.9 0.000000e+00 1397/1410 (99%)
EPI398520 A/swine/Ohio/A01133464/2012 (A/H3N2) segment 6 (NA) 2532.9 0.000000e+00 1397/1410 (99%)
EPI398502 A/swine/Ohio/A01133466/2012 (A/H3N2) segment 6 (NA) 2532.9 0.000000e+00 1397/1410 (99%)
EPI398494 A/swine/Maryland/A01104048/2012 (A/H3N2) segment 6 (NA) 2532.9 0.000000e+00 1397/1410 (99%)
EPI398486 A/swine/Maryland/A01104040/2012 (A/H3N2) segment 6 (NA) 2532.9 0.000000e+00 1397/1410 (99%)
EPI398123 A/swine/North Carolina/A01203801/2012 (A/H3N2) segment 6 (NA) 2532.9 0.000000e+00 1397/1410 (99%)
EPI398034 A/Maryland/22/2012 (A/H3N2) segment 6 (NA) 2532.9 0.000000e+00 1397/1410 (99%)
EPI397931 A/Ohio/19/2012 (A/H3N2) segment 6 (NA) 2532.9 0.000000e+00 1397/1410 (99%)
EPI397918 A/Ohio/17/2012 (A/H3N2) segment 6 (NA) 2532.9 0.000000e+00 1397/1410 (99%)
EPI397750 A/Ohio/87/2012 (A/H3N2) segment 6 (NA) 2532.9 0.000000e+00 1397/1410 (99%)
EPI397661 A/Maryland/28/2012 (A/H3N2) segment 6 (NA) 2532.9 0.000000e+00 1397/1410 (99%)
EPI397627 A/Ohio/63/2012 (A/H3N2) segment 6 (NA) 2532.9 0.000000e+00 1397/1410 (99%)
EPI397625 A/Ohio/43/2012 (A/H3N2) segment 6 (NA) 2532.9 0.000000e+00 1397/1410 (99%)
EPI397624 A/Ohio/80/2012 (A/H3N2) segment 6 (NA) 2532.9 0.000000e+00 1397/1410 (99%)
EPI397621 A/Ohio/79/2012 (A/H3N2) segment 6 (NA) 2532.9 0.000000e+00 1397/1410 (99%)
EPI397620 A/Maryland/25/2012 (A/H3N2) segment 6 (NA) 2532.9 0.000000e+00 1397/1410 (99%)
EPI397547 A/Ohio/83/2012 (A/H3N2) segment 6 (NA) 2532.9 0.000000e+00 1397/1410 (99%)
EPI397539 A/Ohio/56/2012 (A/H3N2) segment 6 (NA) 2532.9 0.000000e+00 1397/1410 (99%)

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Wed Dec 31, 2014 7:52 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
EPI539081 A/swine/Illinois/A01502079/2014 (A/H3N2) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI539078 A/swine/Illinois/A01502053/2014 (A/H3N2) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI539075 A/swine/Illinois/A01502060/2014 (A/H3N2) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI539072 A/swine/Illinois/A01502049/2014 (A/H3N2) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI539069 A/swine/Illinois/A01501987/2014 (A/H3N2) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI539066 A/swine/Illinois/A01502005/2014 (A/H3N2) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI532470 A/swine/Illinois/A01536186/2014 (A/H3N2) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI532467 A/swine/Illinois/A01536079/2014 (A/H3N2) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI532464 A/swine/Illinois/A01536474/2014 (A/H3N2) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI531037 A/swine/Illinois/A01475279/2014 (A/H3N2) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI531028 A/swine/Illinois/A01475273/2014 (A/H3N2) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI505032 A/swine/Illinois/A01409735/2014 (A/H3N2) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI544813 A/swine/Illinois/A01503899/2014 (A/H3N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI545160 A/swine/Illinois/A00843206/2014 (A/H3N2) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI467962 A/swine/Minnesota/A01351603/2013 (A/H3N2) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI487336 A/swine/Minnesota/A01364816/2013 (A/H3N2) segment 7 (MP) 1792.4 0.000000e+00 978/982 (99%)
EPI547388 A/swine/Indiana/13TOSU1991/2013 (A/H0) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
EPI542550 A/swine/North Carolina/A01476072/2014 (A/H3N2) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
EPI542544 A/swine/North Carolina/A01476099/2014 (A/H3N2) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
EPI538919 A/swine/Iowa/A01501685/2014 (A/H3N2) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
EPI538666 A/swine/Iowa/A01410752/2014 (A/H3N2) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
EPI534949 A/swine/Iowa/A01501048/2014 (A/H3N2) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
EPI532375 A/swine/North Carolina/A01410688/2014 (A/H3N2) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
EPI530998 A/swine/Iowa/A01410600/2014 (A/H3N2) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
EPI528475 A/swine/Ohio/13TOSU0410/2013 (A/H3N2) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
EPI528427 A/swine/Indiana/13TOSU1042/2013 (A/H3N2) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
EPI527868 A/swine/Indiana/13TOSU1050/2013 (A/H3N2) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
EPI527099 A/swine/Indiana/13TOSU1319/2013 (A/H3N2) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
EPI527088 A/swine/Ohio/13TOSU0411/2013 (A/H3N2) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
EPI526885 A/swine/Indiana/13TOSU1043/2013 (A/H1N1) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
EPI509787 A/swine/Indiana/A01260445/2013 (A/H1N1) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
EPI509784 A/swine/Indiana/A01260443/2013 (A/H1N1) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
EPI509775 A/swine/Indiana/A01260426/2013 (A/H1N1) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
EPI507295 A/swine/Illinois/A00843193/2014 (A/H3N2) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
EPI505083 A/swine/Illinois/A01409611/2014 (A/H3N2) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
EPI505070 A/swine/Illinois/A01411232/2014 (A/H3N2) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
EPI505038 A/swine/Illinois/A01409717/2014 (A/H3N2) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
EPI502385 A/swine/Illinois/A01427136/2013 (A/H3N2) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
EPI499890 A/swine/Indiana/A01260398/2013 (A/H3N2) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
EPI492942 A/swine/Iowa/A01365015/2013 (A/H3N2) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
EPI485991 A/swine/Indiana/13TOSU1128/2013 (A/H3N2) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
EPI485983 A/swine/Indiana/13TOSU1122/2013 (A/H3N2) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
EPI482815 A/Indiana/21/2013 (A/H3N2) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
EPI482812 A/Indiana/11/2013 (A/H3N2) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
EPI476669 A/swine/Michigan/A01259074/2013 (A/H3N2) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
EPI472212 A/swine/Indiana/A01260313/2013 (A/H3N2) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
EPI472197 A/swine/Iowa/A01432817/2013 (A/H3N2) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
EPI468209 A/swine/Indiana/13TOSU490/2013 (A/H3N2) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
EPI468201 A/swine/Indiana/13TOSU482/2013 (A/H3N2) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
EPI465418 A/Indiana/17/2013 (A/H3N2) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
EPI465389 A/Indiana/09/2013 (A/H3N2) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
EPI465386 A/Indiana/10/2013 (A/H3N2) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
EPI465383 A/Indiana/07/2013 (A/H3N2) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
EPI463710 A/swine/Illinois/A01432795/2013 (A/H3N2) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
EPI460975 A/swine/Minnesota/A01350866/2013 (A/H3N2) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
EPI451205 A/swine/Alabama/A01104056/2012 (A/H0) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
EPI448836 A/swine/Kansas/13-105721a/2013 (A/H3N2) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
EPI447028 A/swine/Iowa/A01432604/2013 (A/H1N2) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
EPI443110 A/swine/Ohio/A01349495/2013 (A/H3N2) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
EPI443107 A/swine/Ohio/A01349485/2013 (A/H3N2) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
EPI443100 A/swine/Ohio/A01349302/2013 (A/H3N2) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
EPI443097 A/swine/Ohio/A01349305/2013 (A/H3N2) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
EPI441501 A/swine/Minnesota/A01349160/2013 (A/H3N2) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
EPI433280 A/swine/Minnesota/A01280462/2013 (A/H3N2) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
EPI427186 A/swine/Indiana/A01260163/2012 (A/H3N2) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
EPI426885 A/swine/Iowa/A01432271/2012 (A/H3N2) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
EPI424076 A/swine/Michigan/A01259003/2012 (A/H3N2) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
EPI414154 A/swine/Iowa/A01244302/2012 (A/H3N2) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
EPI406528 A/swine/Illinois/A01432127/2012 (A/H3N2) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
EPI406505 A/swine/Iowa/A01267939/2012 (A/H3N2) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
EPI404893 A/Iowa/16/2012 (A/H3N2) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
EPI499949 A/swine/Iowa/13H087/2013 (A/H3N2) segment 7 (MP) 1783.1 0.000000e+00 976/982 (99%)
EPI546902 A/swine/Indiana/13TOSU1982/2013 (A/H0) segment 7 (MP) 1781.3 0.000000e+00 976/982 (99%)
EPI545815 A/swine/North Carolina/A01476367/2014 (A/H3N2) segment 7 (MP) 1781.3 0.000000e+00 976/982 (99%)
EPI542565 A/swine/North Carolina/A01476078/2014 (A/H3N2) segment 7 (MP) 1781.3 0.000000e+00 976/982 (99%)
EPI542553 A/swine/North Carolina/A01476177/2014 (A/H3N2) segment 7 (MP) 1781.3 0.000000e+00 976/982 (99%)
EPI542532 A/swine/Minnesota/A01477050/2014 (A/H3N2) segment 7 (MP) 1781.3 0.000000e+00 976/982 (99%)
EPI542526 A/swine/North Carolina/A01477142/2014 (A/H3N2) segment 7 (MP) 1781.3 0.000000e+00 976/982 (99%)
EPI532378 A/swine/North Carolina/A01410687/2014 (A/H3N2) segment 7 (MP) 1781.3 0.000000e+00 976/982 (99%)
EPI531061 A/swine/North Carolina/A01410593/2014 (A/H3N2) segment 7 (MP) 1781.3 0.000000e+00 976/982 (99%)
EPI531031 A/swine/Illinois/A01475266/2014 (A/H3N2) segment 7 (MP) 1781.3 0.000000e+00 976/982 (99%)
EPI528443 A/swine/Ohio/13TOSU2194/2013 (A/H3N2) segment 7 (MP) 1781.3 0.000000e+00 976/982 (99%)
EPI526923 A/swine/Indiana/13TOSU1155/2013 (A/H3N2) segment 7 (MP) 1781.3 0.000000e+00 976/982 (99%)
EPI509772 A/swine/Indiana/A01260424/2013 (A/H1N1) segment 7 (MP) 1781.3 0.000000e+00 976/982 (99%)
EPI509751 A/swine/Iowa/13H068/2013 (A/H3N2) segment 7 (MP) 1781.3 0.000000e+00 976/982 (99%)
EPI509744 A/swine/Iowa/13H081/2013 (A/H3N2) segment 7 (MP) 1781.3 0.000000e+00 976/982 (99%)
EPI509737 A/swine/Iowa/13H075/2013 (A/H3N2) segment 7 (MP) 1781.3 0.000000e+00 976/982 (99%)
EPI509723 A/swine/Iowa/13H082/2013 (A/H3N2) segment 7 (MP) 1781.3 0.000000e+00 976/982 (99%)
EPI505077 A/swine/Illinois/A01409675/2014 (A/H3N2) segment 7 (MP) 1781.3 0.000000e+00 976/982 (99%)
EPI501536 A/swine/Minnesota/A01366050/2013 (A/H3N2) segment 7 (MP) 1781.3 0.000000e+00 976/982 (99%)
EPI499940 A/swine/Iowa/13H069/2013 (A/H3N2) segment 7 (MP) 1781.3 0.000000e+00 976/982 (99%)
EPI499924 A/swine/Iowa/13H094/2013 (A/H3N2) segment 7 (MP) 1781.3 0.000000e+00 976/982 (99%)
EPI493014 A/swine/Kansas/A01377090/2013 (A/H3N2) segment 7 (MP) 1781.3 0.000000e+00 976/982 (99%)
EPI492351 A/swine/Indiana/A00968364/2012 (A/H3N2) segment 7 (MP) 1781.3 0.000000e+00 976/982 (99%)
EPI485857 A/swine/Michigan/A01259075/2013 (A/H1N1) segment 7 (MP) 1781.3 0.000000e+00 976/982 (99%)
EPI472185 A/swine/Iowa/A01432840/2013 (A/H3N2) segment 7 (MP) 1781.3 0.000000e+00 976/982 (99%)
EPI467959 A/swine/Ohio/A01351573/2013 (A/H3N2) segment 7 (MP) 1781.3 0.000000e+00 976/982 (99%)
EPI466711 A/Illinois/03/2013 (A/H3N2) segment 7 (MP) 1781.3 0.000000e+00 976/982 (99%)
EPI465380 A/Indiana/05/2013 (A/H3N2) segment 7 (MP) 1781.3 0.000000e+00 976/982 (99%)
EPI464501 A/Indiana/04/2013 (A/H3N2) segment 7 (MP) 1781.3 0.000000e+00 976/982 (99%)

_________________
www.twitter.com/hniman


Top
 Profile  
 
Display posts from previous:  Sort by  
Post new topic Reply to topic  [ 5 posts ] 

All times are UTC - 5 hours [ DST ]


Who is online

Users browsing this forum: Google [Bot], Yahoo [Bot] and 62 guests


You cannot post new topics in this forum
You cannot reply to topics in this forum
You cannot edit your posts in this forum
You cannot delete your posts in this forum
You cannot post attachments in this forum

Search for:
Jump to:  
cron
Powered by phpBB® Forum Software © phpBB Group