Rhiza Labs FluTracker Forum

The place to discuss the flu
It is currently Mon Oct 16, 2017 7:45 pm

All times are UTC - 5 hours [ DST ]




Post new topic Reply to topic  [ 11 posts ]  Go to page 1, 2  Next
Author Message
PostPosted: Mon Dec 08, 2014 10:09 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
Paper describing H5N2 on Manitoba turkey farm in 2010 includes full sequences on two sets of sequences.

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Mon Dec 08, 2014 10:12 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
Avian Dis. 2014 Mar;58(1):1-7.
Characterization of a low pathogenic avian influenza H5N2 virus isolated from a turkey breeder flock in Manitoba, Canada.
Berhane Y, Joseph T, Kehler H, Hisanaga T, Embury-Hyatt C, Diederich S, McGreevy KH, Handel K, Cottam-Birt C, Pasick J.
Abstract
In November 2010, an outbreak of avian influenza (AI) due to the H5N2 subtype virus occurred in a turkey breeder farm in northern Manitoba, Canada. The only clinical signs observed were depression, decrease in food consumption, and loss of egg production. The hemagglutinin (HA) cleavage (HA(0)) site of the isolated H5N2 virus was PQRETR/GLF, consistent with low pathogenic AI viruses. The intravenous pathogenicity index of this virus was zero. Whole-genome sequencing of two isolates that originated from two different barns was performed, and both isolates had 100% identical protein sequence in PB2, HA, NP, M1, M2, NS1, and NS2. The remaining gene segments (PB1, PA, and NA) had a single amino-acid difference when compared with each other. The nucleotide and protein sequences of eight gene segments from both isolates showed 99 or greater identity with other AI viruses that have been circulating in free-living aquatic birds in Canada and the United States within the last 10 yr. Phylogenetic analysis of the HA and neuraminidase (NA) gene segments showed that these viruses are closely related to other H5 strains that have been isolated from Manitoba and other parts of Canada. Serologic testing of archived serum samples collected from these turkeys a week before the outbreak showed no evidence of AI infection. In addition, other farms that were located within 3 km radius from the infected farm and farms that had epidemiologic connection with the farm also tested negative for the presence of H5N2 AI virus or antibody. This indicates that the virus might have been introduced to the farm from wild aquatic birds only a short time before detection. Results of this study highlight the importance of early detection and the significance of ongoing Canada-wide surveillance of AI in domestic poultry as well as in wild aquatic birds/ducks.

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Mon Dec 08, 2014 10:16 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
LOCUS JX570819 1767 bp cRNA linear VRL 20-MAR-2014
DEFINITION Influenza A virus (A/turkey/MB/FAV11/2010(H5N2)) segment 4
hemagglutinin (HA) gene, complete cds.
ACCESSION JX570819
VERSION JX570819.1 GI:407361242
KEYWORDS .
SOURCE Influenza A virus (A/turkey/MB/FAV11/2010(H5N2))
ORGANISM Influenza A virus (A/turkey/MB/FAV11/2010(H5N2))
Viruses; ssRNA negative-strand viruses; Orthomyxoviridae;
Influenzavirus A.
REFERENCE 1 (bases 1 to 1767)
AUTHORS Berhane,Y., Joseph,T., Kehler,H., Hisanaga,T., Embury-Hyatt,C.,
Diederich,S., McGreevy,K.H., Handel,K., Cottam-Birt,C. and
Pasick,J.
TITLE Characterization of a low pathogenic avian influenza H5N2 virus
isolated from a turkey breeder flock in Manitoba, Canada
JOURNAL Avian Dis. 58 (1), 1-7 (2014)
PUBMED 24758106
REFERENCE 2 (bases 1 to 1767)
AUTHORS Berhane,Y., Tomy,J., Kehler,H., Hisanaga,T., Embury-Hyatt,C.,
Hooper-McGreevy,K., Cottam-Birt,C. and Pasick,J.
TITLE Direct Submission
JOURNAL Submitted (04-SEP-2012) National Centre for Foreign Animal Disease,
Canadian Food Inspection Agency, 1015 Arlington St., Winnipeg,
Manitoba R3E 3M4, Canada
COMMENT GenBank Accession Numbers JX570819-JX570826 represent sequences
from the 8 segments of Influenza A virus
(A/turkey/MB/FAV11/2010(H5N2)).

##Assembly-Data-START##
Assembly Method :: DNAstar LaserGene v. 9
Sequencing Technology :: Sanger dideoxy sequencing
##Assembly-Data-END##
FEATURES Location/Qualifiers
source 1..1767
/organism="Influenza A virus
(A/turkey/MB/FAV11/2010(H5N2))"
/mol_type="viral cRNA"
/strain="A/turkey/MB/FAV11/2010"
/serotype="H5N2"
/host="turkey"
/db_xref="taxon:1229838"
/segment="4"
/country="Canada: Manitoba"
/collection_date="25-Nov-2010"
/note="passage details: 1CE-2dpi"
gene 29..1723
/gene="HA"
CDS 29..1723
/gene="HA"
/function="receptor binding and fusion protein"
/codon_start=1
/product="hemagglutinin"
/protein_id="AFU10231.1"
/db_xref="GI:407361243"
/translation="MERIVIALAIISIVKGDQICIGYHANNSTEQVDTIMEKNVTVTH
AQDILEKEHNGKLCSLKGVRPLILKDCSVAGWLLGNPMCDEFLNVPEWSYIVEKDNPV
NGLCYPGDFSDYEELKHLMSSTNHFEKIQIIPRSSWSNHDASSGVSSACPYNGRSSFF
RNVVWLIKKNNAYPTIKRTYNNTNVEDLLIIWGIHHPNDAAEQTKLYQNSNTYVSVGT
STLNQRSIPEIATRPKVNGQSGRMEFFWTILKSNDAISFESNGNFIAPEYAYKIVKKG
DSAIMRSELEYGNCDTNCQTPLGAINSSMPFHNVHPLTIGECPKYVKSDKLVLATGPR
NVPQRETRGLFGAIAGFIEGGWQGMVDGWYGYHHSNEQGSGYAADKESTQKAIDGITN
KVNSIIDKMNTQFEVVGKEFNNLERRIENLNKKMEDGFLDVWTYNAELLVLMENERTL
DFHDSNVKNLYDKVRLQLRDNAKELGNGCFEFYHKCDNECMESVRNGTYDYPQYSEES
RLNREEIDGVKLESMGTYQILSIYSTVASSLALAIMIAGLSFWMCSNGSLQCRICI"
sig_peptide 29..76
/gene="HA"
mat_peptide 77..1054
/gene="HA"
/product="HA1"
mat_peptide 1055..1720
/gene="HA"
/product="HA2"
ORIGIN
1 agcaaaagca ggggtccaaa ctatgaaaat ggaaagaata gtgattgccc tcgcaataat
61 cagcattgtc aaaggtgacc aaatttgcat tggttaccat gcaaacaatt caacagagca
121 ggttgataca atcatggaaa agaatgtgac ggtcacacat gctcaagata tactggaaaa
181 agagcacaat gggaaacttt gcagtcttaa aggagtgagg cccctcatcc tgaaggattg
241 cagtgtagct ggatggcttc ttggaaaccc aatgtgtgat gaattcctga atgtaccaga
301 atggtcatac atcgtggaaa aagataatcc agtcaatggc ctgtgctatc caggagactt
361 cagcgactat gaagaactga agcatttaat gagtagcaca aaccattttg agaaaattca
421 gataatccct aggagttctt ggtccaatca tgacgcctca tcaggagtga gttcggcatg
481 cccatacaat ggtagatctt cctttttcag gaatgtagtg tggttgatca agaagaataa
541 tgcgtaccca acaataaaga ggacctataa caacaccaat gtagaagacc ttttaataat
601 atggggaata caccacccta atgatgcagc tgaacaaaca aaactctacc agaactcgaa
661 cacttatgtg tctgtaggaa catcaacact gaaccagaga tcaatcccag aaatagccac
721 tagacccaaa gtgaacggac aaagtggaag aatggaattt ttctggacaa tactgaagtc
781 gaacgatgca atcagctttg aaagtaatgg gaatttyata gctcctgaat atgcgtacaa
841 aattgtcaag aaaggagatt cagcaatcat gagaagtgaa ttggagtatg gtaactgtga
901 caccaactgt cagactccat tgggtgctat aaattccagt atgcccttcc acaatgttca
961 tcctcttacc attggggagt gccccaagta tgtaaaatcg gacaaactgg tccttgcaac
1021 aggaccaaga aacgtacccc aaagagaaac aagaggccta tttggtgcaa tagcaggatt
1081 catagaagga ggatggcaag gaatggttga cgggtggtac ggataccatc atagcaatga
1141 gcagggaagt ggatatgctg cagacaaaga atccacccag aaagcaatcg atgggatcac
1201 caataaagta aactcaatca ttgacaaaat gaacactcaa ttcgaagtag ttgggaaaga
1261 attcaacaac ctagaaagga gaatagaaaa tttgaataag aaaatggaag atgggttttt
1321 agatgtatgg acttacaatg cagaacttct cgtgctcatg gaaaacgaaa gaactctgga
1381 tttccatgat tcaaatgtca agaacctata cgataaggtc cgactccagc tgagagacaa
1441 tgcaaaagaa ttaggcaatg gatgcttcga attctaccac aaatgtgaca atgaatgcat
1501 ggaaagtgtg agaaatggaa cgtatgacta tccgcaatat tcagaagaat caagactgaa
1561 cagagaggaa atagacggag tcaagttgga atcaatgggc acctaccaga tattatcaat
1621 ctactcaaca gtggcgagtt ccctagcact ggcaatcatg atagctggtc tatctttttg
1681 gatgtgctcc aatggatcat tgcagtgcag aatttgcatc tagaattgtg agttcagatt
1741 ataattaaaa acacccttgt ttctact

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Mon Dec 08, 2014 10:18 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
EPI399363 A/turkey/MB/FAV11/2010 (A/H5N2) segment 4 (HA) 3127.5 0.000000e+00 1695/1695 (100%)
EPI399355 A/turkey/MB/FAV10/2010 (A/H5N2) segment 4 (HA) 3110.9 0.000000e+00 1691/1695 (99%)
EPI280822 A/duck/Minnesota/462960-2/2006 (A/H5N2) segment 4 (HA) 3038.9 0.000000e+00 1678/1695 (98%)
EPI280782 A/mallard/Minnesota/464334/2006 (A/H5N2) segment 4 (HA) 3027.8 0.000000e+00 1676/1695 (98%)
EPI331871 A/environment/Maryland/1154/2006 (A/H5N1) segment 4 (HA) 3022.2 0.000000e+00 1675/1695 (98%)
EPI331866 A/environment/Maryland/1165/2006 (A/H5N1) segment 4 (HA) 3022.2 0.000000e+00 1675/1695 (98%)
EPI286356 A/wild bird/Wisconsin/433163-2/2006 (A/H5N2) segment 4 (HA) 3022.2 0.000000e+00 1675/1695 (98%)
EPI331870 A/environment/Maryland/1156/2006 (A/H5N1) segment 4 (HA) 3016.7 0.000000e+00 1674/1695 (98%)
EPI307610 A/environment/Maryland/2318/2006 (A/H0) segment 4 (HA) 3016.7 0.000000e+00 1674/1695 (98%)
EPI280750 A/mallard/Michigan/466547-5/2006 (A/H5N2) segment 4 (HA) 3016.7 0.000000e+00 1674/1695 (98%)
EPI280606 A/mallard/Louisiana/476670-4/2007 (A/H5N2) segment 4 (HA) 3016.7 0.000000e+00 1674/1695 (98%)
EPI512455 A/mallard/Missouri/11OS4987/2011 (A/H5N2) segment 4 (HA) 3014.9 0.000000e+00 1675/1696 (98%)
EPI230658 A/environment/Maryland/1192/2006 (A/H5N1) segment 4 (HA) 3013.0 0.000000e+00 1673/1695 (98%)
EPI334359 A/American green-winged teal/Illinois/3443/2009 (A/H0) segment 4 (HA) 3011.2 0.000000e+00 1674/1696 (98%)
EPI331865 A/environment/Maryland/1170/2006 (A/H5N1) segment 4 (HA) 3011.2 0.000000e+00 1673/1695 (98%)
EPI280758 A/mallard/Michigan/466372-3/2006 (A/H5N2) segment 4 (HA) 3011.2 0.000000e+00 1673/1695 (98%)
EPI255769 A/turkey/New York/465977/2006 (A/H5N2) segment 4 (HA) 3011.2 0.000000e+00 1673/1695 (98%)
EPI227334 A/mallard/ON/499/2005 (A/H5N1) segment 4 (HA) 3011.2 0.000000e+00 1673/1695 (98%)
EPI227314 A/mallard/MB/458/2005 (A/H5) segment 4 (HA) 3011.2 0.000000e+00 1674/1696 (98%)
EPI76378 A/mallard/Maryland/182/2006 (A/H5N2) segment 4 (HA) 3011.2 0.000000e+00 1673/1695 (98%)
EPI510516 A/goose/MB/428/2006 (A/H5N2) segment 4 (HA) 3005.6 0.000000e+00 1672/1695 (98%)
EPI331873 A/environment/Maryland/1152/2006 (A/H5N1) segment 4 (HA) 3005.6 0.000000e+00 1672/1695 (98%)
EPI331869 A/environment/Maryland/1158/2006 (A/H5N1) segment 4 (HA) 3005.6 0.000000e+00 1672/1695 (98%)
EPI331864 A/environment/Maryland/1171/2006 (A/H5N1) segment 4 (HA) 3005.6 0.000000e+00 1672/1695 (98%)
EPI307602 A/environment/Maryland/1152/2006 (A/H0) segment 4 (HA) 3005.6 0.000000e+00 1672/1695 (98%)
EPI286409 A/duck/New York/484680/2007 (A/H5N2) segment 4 (HA) 3005.6 0.000000e+00 1672/1695 (98%)
EPI286368 A/environment/New York/466812-3/2007 (A/H5N2) segment 4 (HA) 3005.6 0.000000e+00 1672/1695 (98%)
EPI286326 A/environment/New York/483238/2007 (A/H5N2) segment 4 (HA) 3005.6 0.000000e+00 1672/1695 (98%)
EPI286325 A/duck/New York/470179/2006 (A/H5N2) segment 4 (HA) 3005.6 0.000000e+00 1672/1695 (98%)
EPI280726 A/mallard/Ohio/468158/2006 (A/H5N2) segment 4 (HA) 3005.6 0.000000e+00 1672/1695 (98%)
EPI280590 A/northern pintail/Florida/480645-5/2007 (A/H5N2) segment 4 (HA) 3005.6 0.000000e+00 1672/1695 (98%)
EPI280454 A/duck/Ohio/470655/2007 (A/H5N2) segment 4 (HA) 3005.6 0.000000e+00 1672/1695 (98%)
EPI255553 A/environment/New York/484056/2007 (A/H5N2) segment 4 (HA) 3005.6 0.000000e+00 1672/1695 (98%)
EPI255545 A/environment/New York/481173/2007 (A/H5N2) segment 4 (HA) 3005.6 0.000000e+00 1672/1695 (98%)
EPI255537 A/environment/New York/466788/2006 (A/H5N2) segment 4 (HA) 3005.6 0.000000e+00 1672/1695 (98%)
EPI255529 A/environment/New York/190723/2007 (A/H5N2) segment 4 (HA) 3005.6 0.000000e+00 1672/1695 (98%)
EPI255497 A/duck/New York/484057/2007 (A/H5N2) segment 4 (HA) 3005.6 0.000000e+00 1672/1695 (98%)
EPI255489 A/duck/New York/481172/2007 (A/H5N2) segment 4 (HA) 3005.6 0.000000e+00 1672/1695 (98%)
EPI255457 A/duck/New York/465571/2006 (A/H5N2) segment 4 (HA) 3005.6 0.000000e+00 1672/1695 (98%)
EPI118648 A/northern pintail/FL/598/2007 (A/H5N2) segment 4 (HA) 3005.6 0.000000e+00 1672/1695 (98%)
EPI118590 A/black duck/NC/674-694/2006 (A/H5N1) segment 4 (HA) 3005.6 0.000000e+00 1672/1695 (98%)
EPI331874 A/environment/Maryland/1149/2006 (A/H5N1) segment 4 (HA) 3000.1 0.000000e+00 1671/1695 (98%)
EPI286337 A/mallard/Illinois/464067-5/2006 (A/H5N2) segment 4 (HA) 3000.1 0.000000e+00 1671/1695 (98%)
EPI286327 A/duck/New York/483239/2007 (A/H5N2) segment 4 (HA) 3000.1 0.000000e+00 1671/1695 (98%)
EPI280646 A/Canada goose/Texas/475000-3/2006 (A/H5N2) segment 4 (HA) 3000.1 0.000000e+00 1671/1695 (98%)
EPI280614 A/waterfowl/Colorado/476466-3/2007 (A/H5N2) segment 4 (HA) 3000.1 0.000000e+00 1671/1695 (98%)
EPI280502 A/waterfowl/Colorado/457952-2/2006 (A/H5N2) segment 4 (HA) 3000.1 0.000000e+00 1671/1695 (98%)
EPI255473 A/duck/New York/466787/2006 (A/H5N2) segment 4 (HA) 3000.1 0.000000e+00 1671/1695 (98%)
EPI255465 A/duck/New York/465976/2006 (A/H5N2) segment 4 (HA) 3000.1 0.000000e+00 1671/1695 (98%)
EPI255427 A/avian/New York/466812/2006 (A/H5N2) segment 4 (HA) 3000.1 0.000000e+00 1671/1695 (98%)
EPI183945 A/duck/New York/492652/2007 (A/H5N2) segment 4 (HA) 3000.1 0.000000e+00 1671/1695 (98%)
EPI173523 A/mallard/Maryland/897/2004 (A/H5N2) segment 4 (HA) 3000.1 0.000000e+00 1671/1695 (98%)
EPI164466 A/mute swan/Michigan/451072/2006 (A/H5N1) segment 4 (HA) 3000.1 0.000000e+00 1671/1695 (98%)
EPI331867 A/environment/Maryland/1162/2006 (A/H5N1) segment 4 (HA) 2994.5 0.000000e+00 1670/1695 (98%)
EPI280470 A/wild bird/Minnesota/460613/2006 (A/H5N2) segment 4 (HA) 2994.5 0.000000e+00 1670/1695 (98%)
EPI255561 A/environment/New York/484678/2007 (A/H5N2) segment 4 (HA) 2994.5 0.000000e+00 1670/1695 (98%)
EPI255505 A/duck/New York/489761/2007 (A/H5N2) segment 4 (HA) 2994.5 0.000000e+00 1671/1696 (98%)
EPI255481 A/duck/New York/469961/2006 (A/H5N2) segment 4 (HA) 2994.5 0.000000e+00 1671/1696 (98%)
EPI227339 A/mallard/Quebec/16334/2005 (A/H5N3) segment 4 (HA) 2994.5 0.000000e+00 1670/1695 (98%)
EPI225161 A/mallard/Pennsylvania/454069-12/2006 (A/H5N4) segment 4 (HA) 2994.5 0.000000e+00 1670/1695 (98%)
EPI222710 A/turkey/Virginia/505477-17/2007 (A/H5N1) segment 4 (HA) 2994.5 0.000000e+00 1670/1695 (98%)
EPI141396 A/environment/Maryland/1189/2006 (A/H5N1) segment 4 (HA) 2994.5 0.000000e+00 1670/1695 (98%)
EPI118594 A/mute swan/MI/451072-2/2006 (A/H5N1) segment 4 (HA) 2994.5 0.000000e+00 1670/1695 (98%)
EPI116162 A/mallard/ON/499/2005 (A/H5N1) segment 4 (HA) 2994.5 0.000000e+00 1670/1695 (98%)
EPI331872 A/environment/Maryland/1153/2006 (A/H5N1) segment 4 (HA) 2989.0 0.000000e+00 1669/1695 (98%)
EPI331868 A/environment/Maryland/1159/2006 (A/H5N1) segment 4 (HA) 2989.0 0.000000e+00 1669/1695 (98%)
EPI286344 A/green winged teal/Delaware/468157-6/2006 (A/H5N2) segment 4 (HA) 2989.0 0.000000e+00 1669/1695 (98%)
EPI286335 A/duck/Michigan/463796-7/2006 (A/H5N2) segment 4 (HA) 2989.0 0.000000e+00 1669/1695 (98%)
EPI280774 A/mallard/Indiana/465297-2/2006 (A/H5N2) segment 4 (HA) 2989.0 0.000000e+00 1669/1695 (98%)
EPI280718 A/mallard/Ohio/468159-4/2006 (A/H5N2) segment 4 (HA) 2989.0 0.000000e+00 1669/1695 (98%)
EPI280686 A/mallard/Kentucky/472048-2/2006 (A/H5N2) segment 4 (HA) 2989.0 0.000000e+00 1669/1695 (98%)
EPI280494 A/green winged teal/Delaware/458672-5/2006 (A/H5N2) segment 4 (HA) 2989.0 0.000000e+00 1669/1695 (98%)
EPI280438 A/duck/New York/504371/2007 (A/H5N2) segment 4 (HA) 2989.0 0.000000e+00 1669/1695 (98%)
EPI255521 A/duck/New York/494165/2007 (A/H5N2) segment 4 (HA) 2989.0 0.000000e+00 1669/1695 (98%)
EPI255513 A/duck/New York/490722/2007 (A/H5N2) segment 4 (HA) 2989.0 0.000000e+00 1669/1695 (98%)
EPI225153 A/mallard/PA/454069-9/2006 (A/H5N1) segment 4 (HA) 2989.0 0.000000e+00 1669/1695 (98%)
EPI171085 A/environment/New York/11653-1/2005 (A/H5N2) segment 4 (HA) 2989.0 0.000000e+00 1669/1695 (98%)
EPI118592 A/duck/PA/454069/2005 (A/H5N1) segment 4 (HA) 2989.0 0.000000e+00 1669/1695 (98%)
EPI115021 A/mallard/ON/499/2005 (A/H5N1) segment 4 (HA) 2989.0 0.000000e+00 1669/1695 (98%)
EPI280814 A/green winged teal/Iowa/463990-3/2006 (A/H5N2) segment 4 (HA) 2983.5 0.000000e+00 1668/1695 (98%)
EPI280630 A/waterfowl/Colorado/476466/2007 (A/H5N2) segment 4 (HA) 2983.5 0.000000e+00 1668/1695 (98%)
EPI280462 A/duck/New York/504372/2007 (A/H5N2) segment 4 (HA) 2983.5 0.000000e+00 1668/1695 (98%)
EPI230706 A/mallard/Maryland/802/2007 (A/H5N1) segment 4 (HA) 2983.5 0.000000e+00 1668/1695 (98%)
EPI225324 A/northern pintail/Illinois/464067-4/2006 (A/H5N9) segment 4 (HA) 2983.5 0.000000e+00 1668/1695 (98%)
EPI222702 A/turkey/VA/505477-18/2007 (A/H5N1) segment 4 (HA) 2983.5 0.000000e+00 1668/1695 (98%)
EPI315612 A/mallard/Maryland/792/2007 (A/H5N9) segment 4 (HA) 2977.9 0.000000e+00 1667/1695 (98%)
EPI286351 A/Canada goose/Wisconsin/474847-4/2006 (A/H5N2) segment 4 (HA) 2977.9 0.000000e+00 1667/1695 (98%)
EPI280710 A/green winged teal/Ohio/468160/2006 (A/H5N2) segment 4 (HA) 2977.9 0.000000e+00 1667/1695 (98%)
EPI280638 A/Canada goose/New York/475813-2/2007 (A/H5N2) segment 4 (HA) 2977.9 0.000000e+00 1667/1695 (98%)
EPI280486 A/wild bird/Minnesota/459254-5/2006 (A/H5N2) segment 4 (HA) 2977.9 0.000000e+00 1667/1695 (98%)
EPI286349 A/mallard/Arkansas/473507-13/2006 (A/H5N2) segment 4 (HA) 2972.4 0.000000e+00 1666/1695 (98%)
EPI280806 A/American wigeon/Iowa/463993/2006 (A/H5N2) segment 4 (HA) 2972.4 0.000000e+00 1666/1695 (98%)
EPI280766 A/avian/Missouri/465593-7/2006 (A/H5N2) segment 4 (HA) 2972.4 0.000000e+00 1666/1695 (98%)
EPI280662 A/mallard/Arkansas/473507-1/2006 (A/H5N2) segment 4 (HA) 2972.4 0.000000e+00 1666/1695 (98%)
EPI286336 A/northern pintail/Iowa/463992/2006 (A/H5N2) segment 4 (HA) 2966.8 0.000000e+00 1665/1695 (98%)
EPI286321 A/duck/New York/440410/2006 (A/H5N2) segment 4 (HA) 2966.8 0.000000e+00 1665/1695 (98%)
EPI280854 A/waterfowl/Minnesota/459675/2006 (A/H5N2) segment 4 (HA) 2966.8 0.000000e+00 1665/1695 (98%)
EPI280798 A/American wigeon/Iowa/463998/2006 (A/H5N2) segment 4 (HA) 2966.8 0.000000e+00 1665/1695 (98%)
EPI280622 A/waterfowl/Colorado/476466-2/2007 (A/H5N2) segment 4 (HA) 2966.8 0.000000e+00 1665/1695 (98%)
EPI334113 A/environment/Indiana/3596/2009 (A/H5N2) segment 4 (HA) 2961.3 0.000000e+00 1664/1695 (98%)

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Mon Dec 08, 2014 10:20 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
EPI399365 A/turkey/MB/FAV11/2010 (A/H5N2) segment 6 (NA) 2604.9 0.000000e+00 1410/1410 (100%)
EPI399357 A/turkey/MB/FAV10/2010 (A/H5N2) segment 6 (NA) 2599.4 0.000000e+00 1409/1410 (99%)
EPI333718 A/northern shoveler/Missouri/298/2009 (A/H9N2) segment 6 (NA) 2577.2 0.000000e+00 1405/1410 (99%)
EPI449853 A/northern pintail/Minnesota/AI09-3254/2009 (A/H6N2) segment 6 (NA) 2566.1 0.000000e+00 1403/1410 (99%)
EPI328730 A/mallard/California/6469/2008 (A/H6N2) segment 6 (NA) 2566.1 0.000000e+00 1403/1410 (99%)
EPI280784 A/mallard/Minnesota/464334/2006 (A/H5N2) segment 6 (NA) 2566.1 0.000000e+00 1403/1410 (99%)
EPI328696 A/mallard/California/8457/2008 (A/H6N2) segment 6 (NA) 2560.6 0.000000e+00 1402/1410 (99%)
EPI449968 A/mallard/Minnesota/AI09-4324/2009 (A/H0) segment 6 (NA) 2555.0 0.000000e+00 1401/1410 (99%)
EPI449917 A/mallard/Minnesota/AI09-3819/2009 (A/H0) segment 6 (NA) 2555.0 0.000000e+00 1401/1410 (99%)
EPI333790 A/mallard/Illinois/4162/2009 (A/H11N2) segment 6 (NA) 2555.0 0.000000e+00 1401/1410 (99%)
EPI334357 A/American green-winged teal/Illinois/3443/2009 (A/H0) segment 6 (NA) 2549.5 0.000000e+00 1400/1410 (99%)
EPI280824 A/duck/Minnesota/462960-2/2006 (A/H5N2) segment 6 (NA) 2549.5 0.000000e+00 1400/1410 (99%)
EPI419344 A/mallard/Illinois/10OS4130/2010 (A/H11N2) segment 6 (NA) 2544.0 0.000000e+00 1399/1410 (99%)
EPI280648 A/Canada goose/Texas/475000-3/2006 (A/H5N2) segment 6 (NA) 2544.0 0.000000e+00 1399/1410 (99%)
EPI280608 A/mallard/Louisiana/476670-4/2007 (A/H5N2) segment 6 (NA) 2544.0 0.000000e+00 1399/1410 (99%)
EPI280456 A/duck/Ohio/470655/2007 (A/H5N2) segment 6 (NA) 2544.0 0.000000e+00 1399/1410 (99%)
EPI512883 A/mallard/Wisconsin/11OS4204/2011 (A/H0) segment 6 (NA) 2532.9 0.000000e+00 1397/1410 (99%)
EPI512457 A/mallard/Missouri/11OS4987/2011 (A/H5N2) segment 6 (NA) 2532.9 0.000000e+00 1397/1410 (99%)
EPI510518 A/goose/MB/428/2006 (A/H5N2) segment 6 (NA) 2532.9 0.000000e+00 1397/1410 (99%)
EPI442446 A/emperor goose/Alaska/44300-287/2007 (A/H1N2) segment 6 (NA) 2532.9 0.000000e+00 1397/1410 (99%)
EPI280592 A/northern pintail/Florida/480645-5/2007 (A/H5N2) segment 6 (NA) 2532.9 0.000000e+00 1397/1410 (99%)
EPI455974 A/mallard/Minnesota/Sg-01005/2008 (A/H0) segment 6 (NA) 2527.3 0.000000e+00 1396/1410 (99%)
EPI449939 A/mallard/Minnesota/AI09-4022/2009 (A/H3N2) segment 6 (NA) 2527.3 0.000000e+00 1396/1410 (99%)
EPI449674 A/green-winged teal/Minnesota/Sg-01065/2008 (A/H6N2) segment 6 (NA) 2527.3 0.000000e+00 1396/1410 (99%)
EPI449526 A/mallard/Minnesota/Sg-00860/2008 (A/H0) segment 6 (NA) 2527.3 0.000000e+00 1396/1410 (99%)
EPI419365 A/American green-winged teal/Illinois/10OS3662/2010 (A/H11N2) segment 6 (NA) 2527.3 0.000000e+00 1396/1410 (99%)
EPI418627 A/mallard/Illinois/10OS3243/2010 (A/H0) segment 6 (NA) 2527.3 0.000000e+00 1396/1410 (99%)
EPI333838 A/blue-winged teal/Wisconsin/2818/2009 (A/H0) segment 6 (NA) 2527.3 0.000000e+00 1396/1410 (99%)
EPI512514 A/mallard/Wisconsin/11OS3177/2011 (A/H0) segment 6 (NA) 2521.8 0.000000e+00 1395/1410 (98%)
EPI449597 A/mallard/Minnesota/Sg-01018/2008 (A/H6N2) segment 6 (NA) 2521.8 0.000000e+00 1395/1410 (98%)
EPI449566 A/mallard/Minnesota/Sg-00949/2008 (A/H3N2) segment 6 (NA) 2521.8 0.000000e+00 1395/1410 (98%)
EPI449544 A/mallard/Minnesota/Sg-00902/2008 (A/H0) segment 6 (NA) 2521.8 0.000000e+00 1395/1410 (98%)
EPI449510 A/green-winged teal/Minnesota/Sg-00841/2008 (A/H0) segment 6 (NA) 2521.8 0.000000e+00 1395/1410 (98%)
EPI449495 A/mallard/Minnesota/Sg-00836/2008 (A/H0) segment 6 (NA) 2521.8 0.000000e+00 1395/1410 (98%)
EPI419358 A/mallard/Illinois/10OS3659/2010 (A/H11N2) segment 6 (NA) 2521.8 0.000000e+00 1395/1410 (98%)
EPI418650 A/northern pintail/Illinois/10OS3257/2010 (A/H0) segment 6 (NA) 2521.8 0.000000e+00 1395/1410 (98%)
EPI334379 A/mallard/Illinois/3048/2009 (A/H11N2) segment 6 (NA) 2521.8 0.000000e+00 1395/1410 (98%)
EPI334344 A/American black duck/Wisconsin/2542/2009 (A/H4N2) segment 6 (NA) 2521.8 0.000000e+00 1395/1410 (98%)
EPI334163 A/American green-winged teal/Illinois/3053/2009 (A/H0) segment 6 (NA) 2521.8 0.000000e+00 1395/1410 (98%)
EPI334022 A/mallard/Wisconsin/2549/2009 (A/H3N2) segment 6 (NA) 2521.8 0.000000e+00 1395/1410 (98%)
EPI333918 A/northern shoveler/Wisconsin/2508/2009 (A/H4N2) segment 6 (NA) 2521.8 0.000000e+00 1395/1410 (98%)
EPI333910 A/blue-winged teal/Wisconsin/2509/2009 (A/H1N2) segment 6 (NA) 2521.8 0.000000e+00 1395/1410 (98%)
EPI333862 A/blue-winged teal/Wisconsin/2720/2009 (A/H3N2) segment 6 (NA) 2521.8 0.000000e+00 1395/1410 (98%)
EPI419351 A/mallard/Illinois/10OS4179/2010 (A/H11N2) segment 6 (NA) 2516.3 0.000000e+00 1394/1410 (98%)
EPI413352 A/environment/Ohio/08OS1296/2008 (A/H0) segment 6 (NA) 2516.3 0.000000e+00 1394/1410 (98%)
EPI334006 A/mallard/Wisconsin/2575/2009 (A/H3N2) segment 6 (NA) 2516.3 0.000000e+00 1394/1410 (98%)
EPI333894 A/American green-winged teal/Wisconsin/2530/2009 (A/H6N2) segment 6 (NA) 2516.3 0.000000e+00 1394/1410 (98%)
EPI299557 A/environment/Indiana/08OS3524/2008 (A/H1N2) segment 6 (NA) 2516.3 0.000000e+00 1394/1410 (98%)
EPI299493 A/American black duck/Illinois/08OS2688/2008 (A/H5N2) segment 6 (NA) 2516.3 0.000000e+00 1394/1410 (98%)
EPI449302 A/mallard/Minnesota/Sg-00768/2008 (A/H6N2) segment 6 (NA) 2510.7 0.000000e+00 1393/1410 (98%)
EPI449230 A/mallard/Minnesota/Sg-00981/2008 (A/H0) segment 6 (NA) 2510.7 0.000000e+00 1393/1410 (98%)
EPI334310 A/blue-winged teal/Wisconsin/2713/2009 (A/H4N2) segment 6 (NA) 2510.7 0.000000e+00 1393/1410 (98%)
EPI334172 A/mallard/Illinois/3974/2009 (A/H5N2) segment 6 (NA) 2510.7 0.000000e+00 1393/1410 (98%)
EPI333878 A/blue-winged teal/Wisconsin/2665/2009 (A/H4N2) segment 6 (NA) 2510.7 0.000000e+00 1393/1410 (98%)
EPI333854 A/northern pintail/Wisconsin/2737/2009 (A/H3N2) segment 6 (NA) 2510.7 0.000000e+00 1393/1410 (98%)
EPI449632 A/mallard/Minnesota/Sg-01034/2008 (A/H11N2) segment 6 (NA) 2505.2 0.000000e+00 1392/1410 (98%)
EPI418866 A/mallard/Wisconsin/10OS2659/2010 (A/H4N2) segment 6 (NA) 2505.2 0.000000e+00 1392/1410 (98%)
EPI413342 A/environment/Ohio/08OS1292/2008 (A/H0) segment 6 (NA) 2505.2 0.000000e+00 1392/1410 (98%)
EPI403157 A/ruddy turnstone/Delaware Bay/173/2007 (A/H6N2) segment 6 (NA) 2505.2 0.000000e+00 1393/1411 (98%)
EPI419269 A/mallard/Iowa/10OS2692/2010 (A/H4N2) segment 6 (NA) 2499.6 0.000000e+00 1391/1410 (98%)
EPI334387 A/American green-winged teal/Illinois/2975/2009 (A/H0) segment 6 (NA) 2499.6 0.000000e+00 1391/1410 (98%)
EPI333870 A/mallard/Wisconsin/2719/2009 (A/H4N2) segment 6 (NA) 2499.6 0.000000e+00 1391/1410 (98%)
EPI234274 A/blue-winged teal/Minnesota/Sg-00798/2008 (A/H4N2) segment 6 (NA) 2495.9 0.000000e+00 1381/1396 (98%)
EPI238723 A/blue-winged teal/Minnesota/Sg-00452/2008 (A/H4N2) segment 6 (NA) 2488.6 0.000000e+00 1381/1398 (98%)
EPI512861 A/northern pintail/Wisconsin/11OS3295/2011 (A/H4N2) segment 6 (NA) 2483.0 0.000000e+00 1388/1410 (98%)
EPI512449 A/mallard/Wisconsin/11OS3256/2011 (A/H0) segment 6 (NA) 2483.0 0.000000e+00 1388/1410 (98%)
EPI450119 A/mallard/Minnesota/AI08-3881/2008 (A/H2N2) segment 6 (NA) 2483.0 0.000000e+00 1389/1411 (98%)
EPI234281 A/mallard/Minnesota/Sg-00810/2008 (A/H6N2) segment 6 (NA) 2483.0 0.000000e+00 1374/1389 (98%)
EPI18625 A/unknown/NY/118547-11/2001 (A/H5N2) segment 6 (NA) 2483.0 0.000000e+00 1388/1410 (98%)
EPI449618 A/American wigeon/Louisiana/Sg-01032/2008 (A/H6N2) segment 6 (NA) 2477.5 0.000000e+00 1387/1410 (98%)
EPI18623 A/Duck/NJ/117228-7/2001 (A/H5N2) segment 6 (NA) 2477.5 0.000000e+00 1387/1410 (98%)
EPI18619 A/unknown/NY/98899-6/01 (A/H5N2) segment 6 (NA) 2477.5 0.000000e+00 1387/1410 (98%)
EPI234207 A/environment/New Jersey/Sg-00422/2004 (A/H2N2) segment 6 (NA) 2473.8 0.000000e+00 1379/1399 (98%)
EPI512912 A/mallard/Wisconsin/11OS3490/2011 (A/H0) segment 6 (NA) 2471.9 0.000000e+00 1386/1410 (98%)
EPI512890 A/mallard/Wisconsin/11OS4238/2011 (A/H3N2) segment 6 (NA) 2471.9 0.000000e+00 1386/1410 (98%)
EPI512559 A/mallard/Wisconsin/11OS3157/2011 (A/H3N2) segment 6 (NA) 2471.9 0.000000e+00 1386/1410 (98%)
EPI512493 A/mallard/Wisconsin/11OS3161/2011 (A/H3N2) segment 6 (NA) 2471.9 0.000000e+00 1386/1410 (98%)
EPI512486 A/mallard/Wisconsin/11OS3159/2011 (A/H3N2) segment 6 (NA) 2471.9 0.000000e+00 1386/1410 (98%)
EPI512479 A/mallard/Wisconsin/11OS3158/2011 (A/H3N2) segment 6 (NA) 2471.9 0.000000e+00 1386/1410 (98%)
EPI455825 A/ruddy turnstone/New Jersey/Sg-00555/2008 (A/H3N2) segment 6 (NA) 2471.9 0.000000e+00 1386/1410 (98%)
EPI455811 A/ruddy turnstone/New Jersey/Sg-00548/2008 (A/H10N2) segment 6 (NA) 2471.9 0.000000e+00 1386/1410 (98%)
EPI455669 A/ruddy turnstone/Delaware/Sg-00469/2008 (A/H3N2) segment 6 (NA) 2471.9 0.000000e+00 1386/1410 (98%)
EPI455605 A/ruddy turnstone/New Jersey/Sg-00553/2008 (A/H0) segment 6 (NA) 2471.9 0.000000e+00 1386/1410 (98%)
EPI455427 A/ruddy turnstone/New Jersey/Sg-00523/2008 (A/H3N2) segment 6 (NA) 2471.9 0.000000e+00 1386/1410 (98%)
EPI455406 A/ruddy turnstone/New Jersey/Sg-00520/2008 (A/H3N2) segment 6 (NA) 2471.9 0.000000e+00 1386/1410 (98%)
EPI455399 A/ruddy turnstone/New Jersey/Sg-00519/2008 (A/H3N2) segment 6 (NA) 2471.9 0.000000e+00 1386/1410 (98%)
EPI455370 A/ruddy turnstone/New Jersey/Sg-00513/2008 (A/H3N2) segment 6 (NA) 2471.9 0.000000e+00 1386/1410 (98%)
EPI343018 A/shorebird/Delaware Bay/485/2008 (A/H3N2) segment 6 (NA) 2471.9 0.000000e+00 1386/1410 (98%)
EPI280760 A/mallard/Michigan/466372-3/2006 (A/H5N2) segment 6 (NA) 2471.9 0.000000e+00 1386/1410 (98%)
EPI234266 A/mallard/Minnesota/Sg-00778/2008 (A/H6N2) segment 6 (NA) 2471.9 0.000000e+00 1368/1383 (98%)
EPI234209 A/avian/New York/Sg-00424/2004 (A/H2N2) segment 6 (NA) 2471.9 0.000000e+00 1378/1398 (98%)
EPI512904 A/mallard/Wisconsin/11OS3482/2011 (A/H3N2) segment 6 (NA) 2466.4 0.000000e+00 1385/1410 (98%)
EPI512801 A/mallard/Wisconsin/11OS3305/2011 (A/H3N2) segment 6 (NA) 2466.4 0.000000e+00 1385/1410 (98%)
EPI512794 A/blue-winged teal/Wisconsin/11OS3303/2011 (A/H3N2) segment 6 (NA) 2466.4 0.000000e+00 1385/1410 (98%)
EPI512787 A/blue-winged teal/Wisconsin/11OS3301/2011 (A/H3N2) segment 6 (NA) 2466.4 0.000000e+00 1385/1410 (98%)
EPI470987 A/shorebird/Delaware Bay/286/2003 (A/H9N2) segment 6 (NA) 2466.4 0.000000e+00 1385/1410 (98%)
EPI470978 A/shorebird/Delaware Bay/163/2003 (A/H9N2) segment 6 (NA) 2466.4 0.000000e+00 1385/1410 (98%)
EPI470937 A/shorebird/Delaware Bay/293/2003 (A/H9N2) segment 6 (NA) 2466.4 0.000000e+00 1385/1410 (98%)
EPI455867 A/ruddy turnstone/New Jersey/Sg-00567/2008 (A/H11N2) segment 6 (NA) 2466.4 0.000000e+00 1385/1410 (98%)
EPI455783 A/ruddy turnstone/New Jersey/Sg-00518/2008 (A/H3N2) segment 6 (NA) 2466.4 0.000000e+00 1385/1410 (98%)

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Mon Dec 08, 2014 10:22 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
EPI399364 A/turkey/MB/FAV11/2010 (A/H5N2) segment 7 (MP) 1814.5 0.000000e+00 982/982 (100%)
EPI399356 A/turkey/MB/FAV10/2010 (A/H5N2) segment 7 (MP) 1814.5 0.000000e+00 982/982 (100%)
EPI512867 A/northern pintail/Wisconsin/11OS3299/2011 (A/H4N6) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI512860 A/northern pintail/Wisconsin/11OS3295/2011 (A/H4N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI512761 A/blue-winged teal/Wisconsin/11OS3020/2011 (A/H1N1) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI512565 A/mallard/Wisconsin/11OS3158/2011 (A/H3N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI512558 A/mallard/Wisconsin/11OS3157/2011 (A/H3N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI512530 A/gadwall/Mississippi/11OS6084/2011 (A/H11N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI512523 A/northern shoveler/Mississippi/11OS6077/2011 (A/H11N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI512889 A/mallard/Wisconsin/11OS4238/2011 (A/H3N2) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI512663 A/mallard/Wisconsin/11OS3467/2011 (A/H0) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI512499 A/mallard/Wisconsin/11OS3170/2011 (A/H6N1) segment 7 (MP) 1792.4 0.000000e+00 978/982 (99%)
EPI333751 A/mallard/Missouri/132/2009 (A/H2N3) segment 7 (MP) 1792.4 0.000000e+00 978/982 (99%)
EPI513104 A/mallard/Wisconsin/11OS4492/2011 (A/H4N2) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
EPI512513 A/mallard/Wisconsin/11OS3177/2011 (A/H0) segment 7 (MP) 1775.8 0.000000e+00 975/982 (99%)
EPI343782 A/mallard/Alberta/160/2001 (A/H3N8) segment 7 (MP) 1759.1 0.000000e+00 972/982 (98%)
EPI87197 A/mallard/Alberta/156/2001 (A/H3N8) segment 7 (MP) 1759.1 0.000000e+00 972/982 (98%)
EPI343758 A/redhead/Alberta/192/2002 (A/H3N6) segment 7 (MP) 1753.6 0.000000e+00 971/982 (98%)
EPI343129 A/mallard/Alberta/284/2007 (A/H0) segment 7 (MP) 1753.6 0.000000e+00 971/982 (98%)
EPI438121 A/mallard/Alberta/57/2004 (A/H10N7) segment 7 (MP) 1748.1 0.000000e+00 970/982 (98%)
EPI438114 A/mallard/Alberta/56/2004 (A/H10N7) segment 7 (MP) 1748.1 0.000000e+00 970/982 (98%)
EPI435712 A/mallard/Alberta/68/2004 (A/H10N7) segment 7 (MP) 1748.1 0.000000e+00 970/982 (98%)
EPI435703 A/mallard/Alberta/67/2004 (A/H10N7) segment 7 (MP) 1748.1 0.000000e+00 970/982 (98%)
EPI435696 A/mallard/Alberta/66/2004 (A/H10N7) segment 7 (MP) 1748.1 0.000000e+00 970/982 (98%)
EPI435689 A/mallard/Alberta/65/2004 (A/H10N7) segment 7 (MP) 1748.1 0.000000e+00 970/982 (98%)
EPI435682 A/mallard/Alberta/62/2004 (A/H10N7) segment 7 (MP) 1748.1 0.000000e+00 970/982 (98%)
EPI87805 A/blue-winged teal/Alberta/293/2003 (A/H4N6) segment 7 (MP) 1748.1 0.000000e+00 970/982 (98%)
EPI402959 A/mallard/Alberta/125/1999 (A/H11N6) segment 7 (MP) 1742.5 0.000000e+00 969/982 (98%)
EPI344145 A/mallard/Alberta/167/1998 (A/H3N8) segment 7 (MP) 1742.5 0.000000e+00 969/982 (98%)
EPI344137 A/mallard/Alberta/169/1998 (A/H3N8) segment 7 (MP) 1742.5 0.000000e+00 969/982 (98%)
EPI343442 A/mallard/Alberta/212/2006 (A/H3N8) segment 7 (MP) 1742.5 0.000000e+00 969/982 (98%)
EPI241719 A/mallard/Alberta/11513/2005 (A/H0) segment 7 (MP) 1742.5 0.000000e+00 969/982 (98%)
EPI221415 A/American green-winged teal/Interior Alaska/3/2007 (A/H3N8) segment 7 (MP) 1742.5 0.000000e+00 969/982 (98%)
EPI88692 A/mallard/Alberta/125/1999 (A/H11N6) segment 7 (MP) 1742.5 0.000000e+00 969/982 (98%)
EPI475401 A/pintail/Alberta/68/2005 (A/H1N1) segment 7 (MP) 1737.0 0.000000e+00 968/982 (98%)
EPI468373 A/pintail/Alberta/69/2005 (A/H1N1) segment 7 (MP) 1737.0 0.000000e+00 968/982 (98%)
EPI437062 A/northern pintail/Interior Alaska/9BM12153R0/2009 (A/H4N8) segment 7 (MP) 1737.0 0.000000e+00 968/982 (98%)
EPI435789 A/pintail/Alberta/69/2005 (A/H1N1) segment 7 (MP) 1737.0 0.000000e+00 968/982 (98%)
EPI283598 A/surface water/Minnesota/W07-2241/2007 (A/H3N8) segment 7 (MP) 1737.0 0.000000e+00 968/982 (98%)
EPI227242 A/mallard/Alberta/11527/2005 (A/H3N8) segment 7 (MP) 1737.0 0.000000e+00 968/982 (98%)
EPI178698 A/mallard/Interior Alaska/7/2007 (A/H3N8) segment 7 (MP) 1737.0 0.000000e+00 968/982 (98%)
EPI178674 A/northern shoveler/Interior Alaska/4/2007 (A/H3N8) segment 7 (MP) 1737.0 0.000000e+00 968/982 (98%)
EPI442502 A/American green-winged teal/Alaska/44493-527/2009 (A/H3N8) segment 7 (MP) 1731.4 0.000000e+00 967/982 (98%)
EPI345168 A/mallard/Alberta/38/2001 (A/H4N6) segment 7 (MP) 1731.4 0.000000e+00 967/982 (98%)
EPI343790 A/mallard/Alberta/35/2001 (A/H4N6) segment 7 (MP) 1731.4 0.000000e+00 967/982 (98%)
EPI343686 A/mallard/Alberta/226/2004 (A/H4N6) segment 7 (MP) 1731.4 0.000000e+00 967/982 (98%)
EPI343670 A/mallard/Alberta/251/2004 (A/H4N6) segment 7 (MP) 1731.4 0.000000e+00 967/982 (98%)
EPI332978 A/common scoter/Maryland/299/2005 (A/H0) segment 7 (MP) 1731.4 0.000000e+00 967/982 (98%)
EPI300040 A/mallard/Interior Alaska/8BM3519/2008 (A/H12N5) segment 7 (MP) 1731.4 0.000000e+00 967/982 (98%)
EPI299679 A/northern pintail/Interior Alaska/8BM1995R1/2008 (A/H12N5) segment 7 (MP) 1731.4 0.000000e+00 967/982 (98%)
EPI299227 A/mallard/Interior Alaska/8MP0792R1/2008 (A/H12N5) segment 7 (MP) 1731.4 0.000000e+00 967/982 (98%)
EPI299115 A/northern pintail/Interior Alaska/8BM2974/2008 (A/H12N5) segment 7 (MP) 1731.4 0.000000e+00 967/982 (98%)
EPI299107 A/mallard/Interior Alaska/8BM2967/2008 (A/H12N5) segment 7 (MP) 1731.4 0.000000e+00 967/982 (98%)
EPI299099 A/northern pintail/Interior Alaska/8BM2528R1/2008 (A/H3N8) segment 7 (MP) 1731.4 0.000000e+00 967/982 (98%)
EPI299035 A/duck/Interior Alaska/7MP1598/2007 (A/H3N8) segment 7 (MP) 1731.4 0.000000e+00 967/982 (98%)
EPI296996 A/mallard/Interior Alaska/7MP1094/2007 (A/H3N8) segment 7 (MP) 1731.4 0.000000e+00 967/982 (98%)
EPI292479 A/American green-winged teal/Oregon/44336-183/2007 (A/H3N8) segment 7 (MP) 1731.4 0.000000e+00 967/982 (98%)
EPI286234 A/Northern shoveler/Washington/467923/2006 (A/H5N2) segment 7 (MP) 1731.4 0.000000e+00 967/982 (98%)
EPI238898 A/mallard/Minnesota/153/1998 (A/H9N2) segment 7 (MP) 1731.4 0.000000e+00 967/982 (98%)
EPI236130 A/mallard/Ohio/657/2002 (A/H4N6) segment 7 (MP) 1731.4 0.000000e+00 967/982 (98%)
EPI86348 A/mallard/Alberta/209/2003 (A/H10N7) segment 7 (MP) 1731.4 0.000000e+00 967/982 (98%)
EPI468618 A/mallard/Alberta/201/1998 (A/H1N1) segment 7 (MP) 1725.9 0.000000e+00 966/982 (98%)
EPI454938 A/ruddy turnstone/New Jersey/AI06-582/2006 (A/H6N7) segment 7 (MP) 1725.9 0.000000e+00 966/982 (98%)
EPI453038 A/American green-winged teal/Interior Alaska/9BM12318R0/2009 (A/H3N8) segment 7 (MP) 1725.9 0.000000e+00 966/982 (98%)
EPI442510 A/emperor goose/Alaska/44045-125/2006 (A/H4N6) segment 7 (MP) 1725.9 0.000000e+00 966/982 (98%)
EPI327274 A/mallard/Alberta/11393/2005 (A/H1N1) segment 7 (MP) 1725.9 0.000000e+00 966/982 (98%)
EPI300003 A/mallard/Interior Alaska/8BM3092/2008 (A/H12N5) segment 7 (MP) 1725.9 0.000000e+00 966/982 (98%)
EPI299339 A/mallard/Interior Alaska/7MP0901R1/2007 (A/H4N6) segment 7 (MP) 1725.9 0.000000e+00 966/982 (98%)
EPI299019 A/duck/Interior Alaska/7MP1570/2007 (A/H4N6) segment 7 (MP) 1725.9 0.000000e+00 966/982 (98%)
EPI298947 A/northern pintail/Interior Alaska/7MP0345BR2/2007 (A/H3N8) segment 7 (MP) 1725.9 0.000000e+00 966/982 (98%)
EPI298723 A/mallard/Interior Alaska/6MP0956R1/2006 (A/H4N6) segment 7 (MP) 1725.9 0.000000e+00 966/982 (98%)
EPI296964 A/northern pintail/Interior Alaska/7MP1644/2007 (A/H4N6) segment 7 (MP) 1725.9 0.000000e+00 966/982 (98%)
EPI296875 A/mallard/Interior Alaska/7MP2230/2007 (A/H1N6) segment 7 (MP) 1725.9 0.000000e+00 966/982 (98%)
EPI236165 A/mallard/Ohio/686/2002 (A/H4N2) segment 7 (MP) 1725.9 0.000000e+00 966/982 (98%)
EPI222441 A/northern shoveler/Interior Alaska/7MP1601/2007 (A/H4N6) segment 7 (MP) 1725.9 0.000000e+00 966/982 (98%)
EPI222336 A/northern pintail/Alaska/7MP0508/2007 (A/H3N8) segment 7 (MP) 1725.9 0.000000e+00 966/982 (98%)
EPI222244 A/mallard/Interior Alaska/5/2007 (A/H4N6) segment 7 (MP) 1725.9 0.000000e+00 966/982 (98%)
EPI222212 A/mallard/Interior Alaska/3/2007 (A/H4N6) segment 7 (MP) 1725.9 0.000000e+00 966/982 (98%)
EPI190687 A/northern shoveler/Alaska/7MP1113/2007 (A/H4N6) segment 7 (MP) 1725.9 0.000000e+00 966/982 (98%)
EPI183983 A/ruddy turnstone/Delaware/752/2006 (A/H7N7) segment 7 (MP) 1725.9 0.000000e+00 966/982 (98%)
EPI178642 A/northern shoveler/Interior Alaska/3/2007 (A/H3N8) segment 7 (MP) 1725.9 0.000000e+00 966/982 (98%)
EPI178611 A/northern shoveler/Interior Alaska/2/2007 (A/H3N8) segment 7 (MP) 1725.9 0.000000e+00 966/982 (98%)
EPI86722 A/mallard/ALB/201/1998 (A/H1N1) segment 7 (MP) 1725.9 0.000000e+00 966/982 (98%)
EPI86314 A/pintail/Alberta/49/2003 (A/H9N5) segment 7 (MP) 1725.9 0.000000e+00 966/982 (98%)
EPI86135 A/mallard/ALB/206/1996 (A/H6N8) segment 7 (MP) 1725.9 0.000000e+00 966/982 (98%)
EPI85458 A/mallard/Alberta/149/2002 (A/H2N4) segment 7 (MP) 1725.9 0.000000e+00 966/982 (98%)
EPI81346 A/mallard/MN/7/98 (A/H11N2) segment 7 (MP) 1725.9 0.000000e+00 966/982 (98%)
EPI454860 A/American black duck/North Carolina/1321373/2004 (A/H3N2) segment 7 (MP) 1720.4 0.000000e+00 965/982 (98%)
EPI442526 A/emperor goose/Alaska/44063-049/2006 (A/H4N6) segment 7 (MP) 1720.4 0.000000e+00 965/982 (98%)
EPI437603 A/pintail/Alberta/140/1996 (A/H1N1) segment 7 (MP) 1720.4 0.000000e+00 965/982 (98%)
EPI404343 A/American black duck/New Brunswick/02658/2007 (A/H0) segment 7 (MP) 1720.4 0.000000e+00 965/982 (98%)
EPI334182 A/mallard/Illinois/2956/2009 (A/H0) segment 7 (MP) 1720.4 0.000000e+00 965/982 (98%)
EPI300249 A/mallard/Interior Alaska/6MP0724R1/2006 (A/H0N6) segment 7 (MP) 1720.4 0.000000e+00 965/982 (98%)
EPI299791 A/mallard/Interior Alaska/6MP0983R1/2006 (A/H3N8) segment 7 (MP) 1720.4 0.000000e+00 965/982 (98%)
EPI299075 A/green-winged teal/Interior Alaska/7MP1672R1/2007 (A/H0) segment 7 (MP) 1720.4 0.000000e+00 965/982 (98%)
EPI298939 A/mallard/Interior Alaska/7MP1771R1/2007 (A/H4N6) segment 7 (MP) 1720.4 0.000000e+00 965/982 (98%)
EPI298931 A/mallard/Interior Alaska/6MP0984/2006 (A/H7N3) segment 7 (MP) 1720.4 0.000000e+00 965/982 (98%)
EPI298675 A/mallard/Interior Alaska/6MP0952/2006 (A/H3N6) segment 7 (MP) 1720.4 0.000000e+00 965/982 (98%)
EPI298587 A/green-winged teal/Interior Alaska/6MP1312/2006 (A/H3N8) segment 7 (MP) 1720.4 0.000000e+00 965/982 (98%)
EPI298507 A/mallard/Interior Alaska/6MP0745/2006 (A/H4N6) segment 7 (MP) 1720.4 0.000000e+00 965/982 (98%)

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Mon Dec 08, 2014 10:25 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
EPI399370 A/turkey/MB/FAV11/2010 (A/H5N2) segment 1 (PB2) 4211.5 0.000000e+00 2280/2280 (100%)
EPI399362 A/turkey/MB/FAV10/2010 (A/H5N2) segment 1 (PB2) 4211.5 0.000000e+00 2280/2280 (100%)
EPI450093 A/red-necked grebe/Minnesota/AI10-2531/2010 (A/H0) segment 1 (PB2) 4156.1 0.000000e+00 2270/2280 (99%)
EPI450085 A/red-necked grebe/Minnesota/AI10-2530/2010 (A/H0) segment 1 (PB2) 4156.1 0.000000e+00 2270/2280 (99%)
EPI433785 A/blue-winged teal/Nova Scotia/00067/2010 (A/H0) segment 1 (PB2) 4150.5 0.000000e+00 2269/2280 (99%)
EPI450077 A/red-necked grebe/Minnesota/AI10-2529/2010 (A/H0) segment 1 (PB2) 4145.0 0.000000e+00 2268/2280 (99%)
EPI178787 A/northern shoveler/California/HKWF2031/2008 (A/H7N3) segment 1 (PB2) 4117.3 0.000000e+00 2263/2280 (99%)
EPI343223 A/mallard/Alberta/115/2007 (A/H0) segment 1 (PB2) 4012.0 0.000000e+00 2244/2280 (98%)
EPI241713 A/mallard/Alberta/11513/2005 (A/H0) segment 1 (PB2) 4012.0 0.000000e+00 2244/2280 (98%)
EPI435829 A/mallard/Alberta/80/2006 (A/H1N3) segment 1 (PB2) 4006.5 0.000000e+00 2243/2280 (98%)
EPI343326 A/mallard/Alberta/258/2006 (A/H4N6) segment 1 (PB2) 4006.5 0.000000e+00 2243/2280 (98%)
EPI343302 A/mallard/Alberta/297/2006 (A/H4N6) segment 1 (PB2) 4006.5 0.000000e+00 2243/2280 (98%)
EPI296769 A/mallard/Alberta/76/2006 (A/H1N3) segment 1 (PB2) 4006.5 0.000000e+00 2243/2280 (98%)
EPI290598 A/northern shoveler/Washington/44249-645/2006 (A/H5N2) segment 1 (PB2) 4006.5 0.000000e+00 2243/2280 (98%)
EPI160319 A/northern shoveler/California/HKWF1325/2007 (A/H8N4) segment 1 (PB2) 4006.5 0.000000e+00 2243/2280 (98%)
EPI450116 A/mallard/Minnesota/AI08-3437/2008 (A/H2N3) segment 1 (PB2) 4001.0 0.000000e+00 2242/2280 (98%)
EPI449313 A/mallard/Minnesota/Sg-00782/2008 (A/H2N3) segment 1 (PB2) 4001.0 0.000000e+00 2242/2280 (98%)
EPI343354 A/mallard/Alberta/246/2006 (A/H4N6) segment 1 (PB2) 4001.0 0.000000e+00 2242/2280 (98%)
EPI343261 A/mallard/Alberta/106/2007 (A/H0) segment 1 (PB2) 4001.0 0.000000e+00 2242/2280 (98%)
EPI343236 A/mallard/Alberta/114/2007 (A/H4N6) segment 1 (PB2) 4001.0 0.000000e+00 2242/2280 (98%)
EPI343156 A/mallard/Alberta/156/2007 (A/H0) segment 1 (PB2) 4001.0 0.000000e+00 2242/2280 (98%)
EPI343120 A/mallard/Alberta/284/2007 (A/H0) segment 1 (PB2) 4001.0 0.000000e+00 2242/2280 (98%)
EPI343005 A/mallard/Alberta/121/2008 (A/H4N6) segment 1 (PB2) 4001.0 0.000000e+00 2242/2280 (98%)
EPI342997 A/mallard/Alberta/270/2008 (A/H4N6) segment 1 (PB2) 4001.0 0.000000e+00 2242/2280 (98%)
EPI343346 A/mallard/Alberta/254/2006 (A/H4N6) segment 1 (PB2) 3995.4 0.000000e+00 2241/2280 (98%)
EPI343148 A/mallard/Alberta/160/2007 (A/H4N6) segment 1 (PB2) 3995.4 0.000000e+00 2241/2280 (98%)
EPI290718 A/northern shoveler/Washington/44249-752/2006 (A/H7N3) segment 1 (PB2) 3995.4 0.000000e+00 2241/2280 (98%)
EPI290710 A/northern shoveler/Washington/44249-749/2006 (A/H7N3) segment 1 (PB2) 3995.4 0.000000e+00 2241/2280 (98%)
EPI154821 A/bufflehead/California/HKWF205/2007 (A/H4N8) segment 1 (PB2) 3995.4 0.000000e+00 2241/2280 (98%)
EPI448532 A/mallard/Minnesota/AI06-1003/2006 (A/H2N5) segment 1 (PB2) 3989.9 0.000000e+00 2240/2280 (98%)
EPI435843 A/mallard/Alberta/152/2006 (A/H1N3) segment 1 (PB2) 3989.9 0.000000e+00 2240/2280 (98%)
EPI334017 A/mallard/Wisconsin/2549/2009 (A/H3N2) segment 1 (PB2) 3989.9 0.000000e+00 2240/2280 (98%)
EPI292325 A/northern shoveler/Washington/44249-783/2006 (A/H7N3) segment 1 (PB2) 3989.9 0.000000e+00 2240/2280 (98%)
EPI449274 A/blue-winged teal/North Dakota/Sg-00740/2008 (A/H3N8) segment 1 (PB2) 3984.3 0.000000e+00 2239/2280 (98%)
EPI435885 A/mallard/Alberta/289/2007 (A/H10N7) segment 1 (PB2) 3984.3 0.000000e+00 2239/2280 (98%)
EPI435878 A/blue-winged teal/Alberta/271/2007 (A/H10N7) segment 1 (PB2) 3984.3 0.000000e+00 2239/2280 (98%)
EPI435871 A/mallard/Alberta/182/2007 (A/H10N7) segment 1 (PB2) 3984.3 0.000000e+00 2239/2280 (98%)
EPI328223 A/mallard/California/8834/2008 (A/H5N9) segment 1 (PB2) 3984.3 0.000000e+00 2239/2280 (98%)
EPI328692 A/mallard/California/8457/2008 (A/H6N2) segment 1 (PB2) 3978.8 0.000000e+00 2238/2280 (98%)
EPI345130 A/mallard/Alberta/112/2007 (A/H0) segment 1 (PB2) 3973.3 0.000000e+00 2237/2280 (98%)
EPI343253 A/mallard/Alberta/107/2007 (A/H3N8) segment 1 (PB2) 3973.3 0.000000e+00 2237/2280 (98%)
EPI343215 A/mallard/Alberta/116/2007 (A/H3N8) segment 1 (PB2) 3973.3 0.000000e+00 2237/2280 (98%)
EPI343207 A/mallard/Alberta/122/2007 (A/H3N8) segment 1 (PB2) 3973.3 0.000000e+00 2237/2280 (98%)
EPI343199 A/unknown/Alberta/126/2007 (A/H3N8) segment 1 (PB2) 3973.3 0.000000e+00 2237/2280 (98%)
EPI343191 A/mallard/Alberta/130/2007 (A/H3N8) segment 1 (PB2) 3973.3 0.000000e+00 2237/2280 (98%)
EPI328592 A/northern shoveler/California/9140/2008 (A/H1N9) segment 1 (PB2) 3973.3 0.000000e+00 2237/2280 (98%)
EPI298082 A/blue-winged teal/Texas/Sg-00157/2007 (A/H4N6) segment 1 (PB2) 3973.3 0.000000e+00 2237/2280 (98%)
EPI328239 A/mallard/California/8212/2008 (A/H6N1) segment 1 (PB2) 3967.7 0.000000e+00 2236/2280 (98%)
EPI263217 A/mallard/Minnesota/Sg-00046/2007 (A/H4N6) segment 1 (PB2) 3967.7 0.000000e+00 2236/2280 (98%)
EPI188777 A/blue-winged teal/North Dakota/Sg-00712/2008 (A/H4N6) segment 1 (PB2) 3964.0 0.000000e+00 2224/2263 (98%)
EPI435919 A/mallard/Alberta/569/2008 (A/H1N1) segment 1 (PB2) 3962.2 0.000000e+00 2235/2280 (98%)
EPI328634 A/mallard/California/11100/2008 (A/H11N2) segment 1 (PB2) 3962.2 0.000000e+00 2235/2280 (98%)
EPI290900 A/western grebe/Washington/20569-004/2007 (A/H1N2) segment 1 (PB2) 3956.6 0.000000e+00 2234/2280 (97%)
EPI188785 A/blue-winged teal/North Dakota/Sg-00714/2008 (A/H3N8) segment 1 (PB2) 3956.6 0.000000e+00 2222/2262 (98%)
EPI451948 A/northern pintail/Interior Alaska/10BM09015R0/2010 (A/H7N6) segment 1 (PB2) 3951.1 0.000000e+00 2234/2281 (97%)
EPI230735 A/northern shoveler/California/JN587/2006 (A/H10N3) segment 1 (PB2) 3951.1 0.000000e+00 2234/2281 (97%)
EPI221457 A/American wigeon/California/HKWF295/2007 (A/H6N5) segment 1 (PB2) 3951.1 0.000000e+00 2233/2280 (97%)
EPI188797 A/blue-winged teal/North Dakota/Sg-00717/2008 (A/H4N6) segment 1 (PB2) 3947.4 0.000000e+00 2221/2263 (98%)
EPI452517 A/northern pintail/Interior Alaska/10BM11380R0/2010 (A/H10N6) segment 1 (PB2) 3945.6 0.000000e+00 2233/2281 (97%)
EPI334279 A/American black duck/Illinois/3854/2009 (A/H11N9) segment 1 (PB2) 3945.6 0.000000e+00 2232/2280 (97%)
EPI331985 A/blue-winged teal/Guatemala/CIP049-04/2010 (A/H8N4) segment 1 (PB2) 3945.6 0.000000e+00 2233/2281 (97%)
EPI289701 A/mallard/Alaska/44050-056/2006 (A/H12N5) segment 1 (PB2) 3945.6 0.000000e+00 2232/2280 (97%)
EPI280701 A/northern pintail/California/469993/2006 (A/H5N2) segment 1 (PB2) 3945.6 0.000000e+00 2232/2280 (97%)
EPI164461 A/mallard duck/Minnesota/Sg-00110/2007 (A/H11N9) segment 1 (PB2) 3945.6 0.000000e+00 2216/2256 (98%)
EPI177968 A/northern pintail/California/44249-053/2006 (A/H5N2) segment 1 (PB2) 3943.7 0.000000e+00 2207/2243 (98%)
EPI468444 A/green winged teal/Louisiana/Sg-00090/2007 (A/H1N1) segment 1 (PB2) 3940.0 0.000000e+00 2231/2280 (97%)
EPI418964 A/American green-winged teal/Wisconsin/10OS3127/2010 (A/H5N2) segment 1 (PB2) 3940.0 0.000000e+00 2232/2281 (97%)
EPI418477 A/mallard/Illinois/10OS3245/2010 (A/H0) segment 1 (PB2) 3940.0 0.000000e+00 2231/2280 (97%)
EPI343334 A/mallard/Alberta/256/2006 (A/H0) segment 1 (PB2) 3940.0 0.000000e+00 2232/2281 (97%)
EPI299354 A/American green-winged teal/Mississippi/09OS046/2009 (A/H7N7) segment 1 (PB2) 3940.0 0.000000e+00 2231/2280 (97%)
EPI442098 A/brant/Alaska/44339-464/2007 (A/H1N2) segment 1 (PB2) 3934.5 0.000000e+00 2220/2265 (98%)
EPI435128 A/mallard/New Brunswick/00854/2010 (A/H4N6) segment 1 (PB2) 3934.5 0.000000e+00 2230/2280 (97%)
EPI334001 A/mallard/Wisconsin/2575/2009 (A/H3N2) segment 1 (PB2) 3934.5 0.000000e+00 2230/2280 (97%)
EPI328375 A/environment/California/7293/2008 (A/H5N3) segment 1 (PB2) 3934.5 0.000000e+00 2230/2280 (97%)
EPI299458 A/northern shoveler/Mississippi/09OS643/2009 (A/H7N7) segment 1 (PB2) 3934.5 0.000000e+00 2230/2280 (97%)
EPI292701 A/northern shoveler/California/44363-082/2007 (A/H11N9) segment 1 (PB2) 3934.5 0.000000e+00 2230/2280 (97%)
EPI290678 A/northern shoveler/Washington/44249-664/2006 (A/H7N3) segment 1 (PB2) 3934.5 0.000000e+00 2230/2280 (97%)
EPI263385 A/ring-necked duck/Minnesota/Sg-00068/2007 (A/H10N7) segment 1 (PB2) 3934.5 0.000000e+00 2230/2280 (97%)
EPI263361 A/mallard/Minnesota/Sg-00065/2007 (A/H10N7) segment 1 (PB2) 3934.5 0.000000e+00 2230/2280 (97%)
EPI263297 A/mallard/Minnesota/Sg-00057/2007 (A/H10N7) segment 1 (PB2) 3934.5 0.000000e+00 2230/2280 (97%)
EPI263289 A/mallard/Minnesota/Sg-00056/2007 (A/H10N7) segment 1 (PB2) 3934.5 0.000000e+00 2230/2280 (97%)
EPI220511 A/env/California/7600/2008 (A/H5N3) segment 1 (PB2) 3934.5 0.000000e+00 2230/2280 (97%)
EPI220440 A/env/California/7261/2008 (A/H5N3) segment 1 (PB2) 3934.5 0.000000e+00 2230/2280 (97%)
EPI220432 A/env/California/7258/2008 (A/H5N3) segment 1 (PB2) 3934.5 0.000000e+00 2230/2280 (97%)
EPI220424 A/env/California/7255/2008 (A/H5N3) segment 1 (PB2) 3934.5 0.000000e+00 2230/2280 (97%)
EPI449991 A/blue-winged teal/Texas/AI09-4463/2009 (A/H4N8) segment 1 (PB2) 3932.6 0.000000e+00 2229/2279 (97%)
EPI166081 A/mallard duck/Minnesota/Sg-00113/2007 (A/H1N9) segment 1 (PB2) 3930.8 0.000000e+00 2210/2251 (98%)
EPI449685 A/ring-necked duck/Minnesota/Sg-01066/2008 (A/H12N8) segment 1 (PB2) 3928.9 0.000000e+00 2229/2280 (97%)
EPI442132 A/brant/Alaska/44339-481/2007 (A/H1N2) segment 1 (PB2) 3928.9 0.000000e+00 2217/2262 (98%)
EPI418947 A/blue-winged teal/Wisconsin/10OS3092/2010 (A/H3N6) segment 1 (PB2) 3928.9 0.000000e+00 2229/2280 (97%)
EPI418758 A/environment/Indiana/10OS1511/2010 (A/H4N8) segment 1 (PB2) 3928.9 0.000000e+00 2231/2282 (97%)
EPI418524 A/American green-winged teal/Wisconsin/10OS3093/2010 (A/H0) segment 1 (PB2) 3928.9 0.000000e+00 2229/2280 (97%)
EPI414407 A/northern pintail/Interior Alaska/10BM02539R0/2010 (A/H7N3) segment 1 (PB2) 3928.9 0.000000e+00 2230/2281 (97%)
EPI334313 A/mallard/Wisconsin/2653/2009 (A/H4N6) segment 1 (PB2) 3928.9 0.000000e+00 2229/2280 (97%)
EPI328367 A/environment/California/7334/2008 (A/H5N3) segment 1 (PB2) 3928.9 0.000000e+00 2229/2280 (97%)
EPI327959 A/green-winged teal/California/8326/2008 (A/H1N2) segment 1 (PB2) 3928.9 0.000000e+00 2229/2280 (97%)
EPI302635 A/mallard/Minnesota/Sg-00195/2007 (A/H10N3) segment 1 (PB2) 3928.9 0.000000e+00 2229/2280 (97%)
EPI221505 A/American wigeon/California/HKWF450/2007 (A/H4N7) segment 1 (PB2) 3928.9 0.000000e+00 2230/2281 (97%)
EPI220503 A/env/California/7341/2008 (A/H5N3) segment 1 (PB2) 3928.9 0.000000e+00 2229/2280 (97%)
EPI220456 A/env/California/7264/2008 (A/H5N3) segment 1 (PB2) 3928.9 0.000000e+00 2229/2280 (97%)

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Mon Dec 08, 2014 10:27 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
EPI399369 A/turkey/MB/FAV11/2010 (A/H5N2) segment 2 (PB1) 4193.0 0.000000e+00 2270/2270 (100%)
EPI399361 A/turkey/MB/FAV10/2010 (A/H5N2) segment 2 (PB1) 4187.5 0.000000e+00 2269/2270 (99%)
EPI418811 A/American green-winged teal/Illinois/10OS3589/2010 (A/H6N2) segment 2 (PB1) 4082.2 0.000000e+00 2250/2270 (99%)
EPI333842 A/American green-winged teal/Wisconsin/2743/2009 (A/H1N1) segment 2 (PB1) 4060.1 0.000000e+00 2246/2270 (98%)
EPI188128 A/mallard/Minnesota/Sg-00447/2008 (A/H1N1) segment 2 (PB1) 4039.7 0.000000e+00 2233/2256 (98%)
EPI468581 A/mallard/Minnesota/AI07-3100/2007 (A/H1N1) segment 2 (PB1) 4037.9 0.000000e+00 2242/2270 (98%)
EPI298248 A/green-winged teal/Louisiana/Sg-00092/2007 (A/H3N8) segment 2 (PB1) 4037.9 0.000000e+00 2242/2270 (98%)
EPI263186 A/blue-winged teal/Texas/Sg-00080/2007 (A/H4N6) segment 2 (PB1) 4037.9 0.000000e+00 2242/2270 (98%)
EPI298320 A/mallard/Minnesota/Sg-00220/2007 (A/H6N1) segment 2 (PB1) 4032.4 0.000000e+00 2241/2270 (98%)
EPI298232 A/mallard/Minnesota/Sg-00223/2007 (A/H6N1) segment 2 (PB1) 4032.4 0.000000e+00 2241/2270 (98%)
EPI298041 A/mallard/Minnesota/Sg-00104/2007 (A/H6N1) segment 2 (PB1) 4032.4 0.000000e+00 2241/2270 (98%)
EPI456502 A/mallard/Minnesota/AI09-1669/2009 (A/H10N3) segment 2 (PB1) 4026.8 0.000000e+00 2240/2270 (98%)
EPI456495 A/mallard/Minnesota/AI09-1666/2009 (A/H10N3) segment 2 (PB1) 4026.8 0.000000e+00 2240/2270 (98%)
EPI449521 A/mallard/Minnesota/Sg-00847/2008 (A/H0) segment 2 (PB1) 4026.8 0.000000e+00 2240/2270 (98%)
EPI345131 A/mallard/Alberta/112/2007 (A/H0) segment 2 (PB1) 4026.8 0.000000e+00 2240/2270 (98%)
EPI298201 A/mallard/Minnesota/Sg-00214/2007 (A/H6N1) segment 2 (PB1) 4025.0 0.000000e+00 2240/2270 (98%)
EPI154730 A/green-winged teal/Louisiana/Sg-00092/2007 (A/H3N8) segment 2 (PB1) 4023.1 0.000000e+00 2234/2262 (98%)
EPI442215 A/brant/Alaska/44332-536/2007 (A/H11N9) segment 2 (PB1) 4021.3 0.000000e+00 2239/2270 (98%)
EPI391946 A/blue-winged teal/New Brunswick/03756/2009 (A/H4N2) segment 2 (PB1) 4021.3 0.000000e+00 2239/2270 (98%)
EPI290891 A/rock dove/Oregon/20547-004/2007 (A/H1N2) segment 2 (PB1) 4021.3 0.000000e+00 2239/2270 (98%)
EPI290883 A/rock dove/Oregon/20547-003/2007 (A/H1N2) segment 2 (PB1) 4021.3 0.000000e+00 2239/2270 (98%)
EPI290811 A/mallard/Washington/44338-362/2007 (A/H11N9) segment 2 (PB1) 4021.3 0.000000e+00 2239/2270 (98%)
EPI159633 A/blue-winged teal/Texas/Sg-00080/2007 (A/H4N6) segment 2 (PB1) 4021.3 0.000000e+00 2233/2261 (98%)
EPI298121 A/mallard/Minnesota/Sg-00167/2007 (A/H6N1) segment 2 (PB1) 4019.4 0.000000e+00 2234/2263 (98%)
EPI187874 A/mallard duck/Minnesota/Sg-00104/2007 (A/H6N1) segment 2 (PB1) 4017.6 0.000000e+00 2233/2262 (98%)
EPI166245 A/mallard/Minnesota/Sg-00223/2007 (A/H6N1) segment 2 (PB1) 4017.6 0.000000e+00 2233/2262 (98%)
EPI166221 A/mallard/Minnesota/Sg-00214/2007 (A/H6N1) segment 2 (PB1) 4017.6 0.000000e+00 2233/2262 (98%)
EPI166149 A/mallard/Minnesota/Sg-00182/2007 (A/H6N1) segment 2 (PB1) 4017.6 0.000000e+00 2233/2262 (98%)
EPI166116 A/mallard/Minnesota/Sg-00167/2007 (A/H6N8) segment 2 (PB1) 4017.6 0.000000e+00 2233/2262 (98%)
EPI449768 A/mallard/Minnesota/AI09-2509/2009 (A/H6N1) segment 2 (PB1) 4015.7 0.000000e+00 2238/2270 (98%)
EPI449621 A/American wigeon/Louisiana/Sg-01032/2008 (A/H6N2) segment 2 (PB1) 4015.7 0.000000e+00 2238/2270 (98%)
EPI442213 A/brant/Alaska/44332-426/2007 (A/H10N2) segment 2 (PB1) 4015.7 0.000000e+00 2238/2270 (98%)
EPI435918 A/mallard/Alberta/569/2008 (A/H1N1) segment 2 (PB1) 4015.7 0.000000e+00 2238/2270 (98%)
EPI342990 A/mallard/Alberta/507/2008 (A/H3N8) segment 2 (PB1) 4015.7 0.000000e+00 2238/2270 (98%)
EPI166236 A/mallard/Minnesota/Sg-00220/2007 (A/H6N1) segment 2 (PB1) 4015.7 0.000000e+00 2232/2261 (98%)
EPI166122 A/mallard/Minnesota/Sg-00170/2007 (A/H6N1) segment 2 (PB1) 4015.7 0.000000e+00 2232/2261 (98%)
EPI442220 A/emperor goose/Alaska/44300-287/2007 (A/H1N2) segment 2 (PB1) 4010.2 0.000000e+00 2237/2270 (98%)
EPI343245 A/mallard/Alberta/108/2007 (A/H0) segment 2 (PB1) 4010.2 0.000000e+00 2237/2270 (98%)
EPI449411 A/mallard/Minnesota/Sg-00672/2008 (A/H3N8) segment 2 (PB1) 4004.7 0.000000e+00 2236/2270 (98%)
EPI449319 A/blue-winged teal/Minnesota/Sg-00787/2008 (A/H3N8) segment 2 (PB1) 4004.7 0.000000e+00 2236/2270 (98%)
EPI334059 A/mallard/Wisconsin/1538/2009 (A/H4N6) segment 2 (PB1) 4004.7 0.000000e+00 2236/2270 (98%)
EPI333574 A/mallard/Mississippi/442/2010 (A/H1N1) segment 2 (PB1) 4004.7 0.000000e+00 2236/2270 (98%)
EPI299587 A/blue-winged teal/Texas/Sg-00087/2007 (A/H0) segment 2 (PB1) 4004.7 0.000000e+00 2236/2270 (98%)
EPI449417 A/mallard/Minnesota/Sg-00674/2008 (A/H3N8) segment 2 (PB1) 3999.1 0.000000e+00 2235/2270 (98%)
EPI436058 A/shorebird/Delaware Bay/351/2009 (A/H1N9) segment 2 (PB1) 3999.1 0.000000e+00 2235/2270 (98%)
EPI159684 A/mallard duck/Minnesota/Sg-00117/2007 (A/H3N8) segment 2 (PB1) 3995.4 0.000000e+00 2229/2262 (98%)
EPI159674 A/mallard duck/Minnesota/Sg-00108/2007 (A/H1N3) segment 2 (PB1) 3995.4 0.000000e+00 2229/2262 (98%)
EPI513014 A/northern pintail/Wisconsin/11OS4111/2011 (A/H6N2) segment 2 (PB1) 3993.6 0.000000e+00 2234/2270 (98%)
EPI456389 A/ruddy turnstone/New Jersey/AI09-1211/2009 (A/H1N9) segment 2 (PB1) 3993.6 0.000000e+00 2234/2270 (98%)
EPI456361 A/ruddy turnstone/New Jersey/AI09-1082/2009 (A/H1N9) segment 2 (PB1) 3993.6 0.000000e+00 2234/2270 (98%)
EPI456191 A/ruddy turnstone/New Jersey/AI09-618/2009 (A/H1N9) segment 2 (PB1) 3993.6 0.000000e+00 2234/2270 (98%)
EPI449705 A/mallard/Minnesota/AI09-1678/2009 (A/H1N1) segment 2 (PB1) 3993.6 0.000000e+00 2234/2270 (98%)
EPI419052 A/mallard/Wisconsin/10OS2918/2010 (A/H4N6) segment 2 (PB1) 3993.6 0.000000e+00 2234/2270 (98%)
EPI419045 A/mallard/Wisconsin/10OS2917/2010 (A/H4N6) segment 2 (PB1) 3993.6 0.000000e+00 2234/2270 (98%)
EPI387160 A/mallard/California/1438/2010 (A/H2N3) segment 2 (PB1) 3993.6 0.000000e+00 2234/2270 (98%)
EPI333866 A/mallard/Wisconsin/2719/2009 (A/H4N2) segment 2 (PB1) 3993.6 0.000000e+00 2234/2270 (98%)
EPI299377 A/mallard/Wisconsin/08OS2271/2008 (A/H11N9) segment 2 (PB1) 3989.9 0.000000e+00 2233/2270 (98%)
EPI164438 A/blue-winged teal/Texas/Sg-00087/2007 (A/H4N1) segment 2 (PB1) 3989.9 0.000000e+00 2228/2262 (98%)
EPI449912 A/blue-winged Teal/Minnesota/AI09-3786/2009 (A/H4N6) segment 2 (PB1) 3988.0 0.000000e+00 2233/2270 (98%)
EPI449712 A/mallard/Minnesota/AI09-1684/2009 (A/H1N1) segment 2 (PB1) 3988.0 0.000000e+00 2233/2270 (98%)
EPI327704 A/mallard/California/5351/2009 (A/H1N1) segment 2 (PB1) 3988.0 0.000000e+00 2233/2270 (98%)
EPI327632 A/mallard/California/1188/2010 (A/H4N6) segment 2 (PB1) 3988.0 0.000000e+00 2233/2270 (98%)
EPI456516 A/mallard/Minnesota/AI09-1864/2009 (A/H10N5) segment 2 (PB1) 3982.5 0.000000e+00 2232/2270 (98%)
EPI456509 A/mallard/Minnesota/AI09-1851/2009 (A/H10N5) segment 2 (PB1) 3982.5 0.000000e+00 2232/2270 (98%)
EPI456488 A/ruddy turnstone/New Jersey/AI09-1381/2009 (A/H1N9) segment 2 (PB1) 3982.5 0.000000e+00 2232/2270 (98%)
EPI449935 A/blue-winged Teal/North Dakota/AI09-3881/2009 (A/H4N6) segment 2 (PB1) 3982.5 0.000000e+00 2232/2270 (98%)
EPI449312 A/mallard/Minnesota/Sg-00782/2008 (A/H2N3) segment 2 (PB1) 3982.5 0.000000e+00 2233/2271 (98%)
EPI398706 A/mallard/California/1154/2010 (A/H4N6) segment 2 (PB1) 3982.5 0.000000e+00 2232/2270 (98%)
EPI327664 A/mallard/California/1154/2010 (A/H0) segment 2 (PB1) 3982.5 0.000000e+00 2232/2270 (98%)
EPI435154 A/mallard/New Brunswick/00854/2010 (A/H4N6) segment 2 (PB1) 3977.0 0.000000e+00 2231/2270 (98%)
EPI419231 A/northern shoveler/Missouri/10OS4718/2010 (A/H10N7) segment 2 (PB1) 3977.0 0.000000e+00 2231/2270 (98%)
EPI387174 A/mallard/California/1523/2010 (A/H4N6) segment 2 (PB1) 3977.0 0.000000e+00 2231/2270 (98%)
EPI327656 A/mallard/California/1156/2010 (A/H4N6) segment 2 (PB1) 3977.0 0.000000e+00 2231/2270 (98%)
EPI327648 A/mallard/California/1210/2010 (A/H4N6) segment 2 (PB1) 3977.0 0.000000e+00 2231/2270 (98%)
EPI299369 A/mallard/Wisconsin/08OS2261/2008 (A/H4N6) segment 2 (PB1) 3977.0 0.000000e+00 2231/2270 (98%)
EPI450115 A/mallard/Minnesota/AI08-3437/2008 (A/H2N3) segment 2 (PB1) 3971.4 0.000000e+00 2231/2271 (98%)
EPI448677 A/blue-winged teal/North Dakota/Sg-00740/2008 (A/H3N8) segment 2 (PB1) 3971.4 0.000000e+00 2230/2270 (98%)
EPI420265 A/cinnamon teal/California/225/2011 (A/H11N9) segment 2 (PB1) 3971.4 0.000000e+00 2230/2270 (98%)
EPI333650 A/mallard/Mississippi/329/2010 (A/H10N7) segment 2 (PB1) 3971.4 0.000000e+00 2230/2270 (98%)
EPI327624 A/mallard/California/1289/2010 (A/H4N6) segment 2 (PB1) 3971.4 0.000000e+00 2232/2272 (98%)
EPI299481 A/gadwall/Wisconsin/08OS2296/2008 (A/H6N2) segment 2 (PB1) 3971.4 0.000000e+00 2230/2270 (98%)
EPI299441 A/northern shoveler/Mississippi/09OS168/2009 (A/H10N6) segment 2 (PB1) 3971.4 0.000000e+00 2230/2270 (98%)
EPI188786 A/blue-winged teal/North Dakota/Sg-00714/2008 (A/H3N8) segment 2 (PB1) 3971.4 0.000000e+00 2230/2270 (98%)
EPI188778 A/blue-winged teal/North Dakota/Sg-00712/2008 (A/H4N6) segment 2 (PB1) 3971.4 0.000000e+00 2230/2270 (98%)
EPI512541 A/gadwall/Mississippi/11OS6085/2011 (A/H6N1) segment 2 (PB1) 3965.9 0.000000e+00 2229/2270 (98%)
EPI334286 A/blue-winged teal/Wisconsin/2753/2009 (A/H4N6) segment 2 (PB1) 3965.9 0.000000e+00 2230/2271 (98%)
EPI333898 A/mallard/Wisconsin/2530/2009 (A/H4N2) segment 2 (PB1) 3965.9 0.000000e+00 2229/2270 (98%)
EPI333714 A/northern shoveler/Missouri/298/2009 (A/H9N2) segment 2 (PB1) 3965.9 0.000000e+00 2230/2271 (98%)
EPI333591 A/mallard/Mississippi/407/2010 (A/H0) segment 2 (PB1) 3965.9 0.000000e+00 2229/2270 (98%)
EPI285809 A/mallard/NV/449567-5/2006 (A/H5N2) segment 2 (PB1) 3965.9 0.000000e+00 2229/2270 (98%)
EPI280556 A/mallard/Nevada/449567-3/2006 (A/H5N2) segment 2 (PB1) 3965.9 0.000000e+00 2229/2270 (98%)
EPI188774 A/blue-winged teal/North Dakota/Sg-00711/2008 (A/H4N8) segment 2 (PB1) 3965.9 0.000000e+00 2229/2270 (98%)
EPI435073 A/wood duck/Nova Scotia/00738/2010 (A/H3N8) segment 2 (PB1) 3960.3 0.000000e+00 2228/2270 (98%)
EPI435056 A/American black duck/Prince Edward Island/00673/2010 (A/H3N8) segment 2 (PB1) 3960.3 0.000000e+00 2228/2270 (98%)
EPI413808 A/mallard/Ohio/11OS2001/2011 (A/H1N1) segment 2 (PB1) 3960.3 0.000000e+00 2228/2270 (98%)
EPI413629 A/mallard/Ohio/11OS1992/2011 (A/H3N8) segment 2 (PB1) 3960.3 0.000000e+00 2228/2270 (98%)
EPI413566 A/mallard/Ohio/11OS2142/2011 (A/H3N1) segment 2 (PB1) 3960.3 0.000000e+00 2228/2270 (98%)
EPI413504 A/mallard/Ohio/11OS1998/2011 (A/H1N1) segment 2 (PB1) 3960.3 0.000000e+00 2228/2270 (98%)
EPI413293 A/mallard/Ohio/11OS2045/2011 (A/H0) segment 2 (PB1) 3960.3 0.000000e+00 2229/2271 (98%)
EPI387278 A/mallard/California/1297/2010 (A/H4N6) segment 2 (PB1) 3960.3 0.000000e+00 2228/2270 (98%)

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Mon Dec 08, 2014 10:29 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
EPI399368 A/turkey/MB/FAV11/2010 (A/H5N2) segment 3 (PA) 3993.6 0.000000e+00 2162/2162 (100%)
EPI399360 A/turkey/MB/FAV10/2010 (A/H5N2) segment 3 (PA) 3982.5 0.000000e+00 2160/2162 (99%)
EPI334280 A/American black duck/Illinois/3854/2009 (A/H11N9) segment 3 (PA) 3882.8 0.000000e+00 2142/2162 (99%)
EPI188185 A/northern pintail/South Dakota/Sg-00461/2008 (A/H3N8) segment 3 (PA) 3871.7 0.000000e+00 2140/2162 (98%)
EPI369981 A/mallard/Alberta/297/2007 (A/H2N9) segment 3 (PA) 3838.5 0.000000e+00 2134/2162 (98%)
EPI468316 A/red headed duck/Minnesota/Sg-00123/2007 (A/H1N1) segment 3 (PA) 3812.6 0.000000e+00 2128/2160 (98%)
EPI447792 A/American wigeon/Minnesota/Sg-01067/2008 (A/H3N8) segment 3 (PA) 3810.8 0.000000e+00 2129/2162 (98%)
EPI188791 A/blue-winged teal/North Dakota/Sg-00715/2008 (A/H4N6) segment 3 (PA) 3810.8 0.000000e+00 2129/2162 (98%)
EPI298064 A/red-headed duck/Minnesota/Sg-00123/2007 (A/H1N1) segment 3 (PA) 3808.9 0.000000e+00 2126/2158 (98%)
EPI59885 A/mallard/Ohio/1851/2005 (A/H11N1) segment 3 (PA) 3808.9 0.000000e+00 2126/2158 (98%)
EPI447594 A/mallard/Minnesota/Sg-00928/2008 (A/H0) segment 3 (PA) 3805.2 0.000000e+00 2128/2162 (98%)
EPI447527 A/mallard/Minnesota/Sg-00837/2008 (A/H6N1) segment 3 (PA) 3805.2 0.000000e+00 2128/2162 (98%)
EPI188771 A/blue-winged teal/North Dakota/Sg-00708/2008 (A/H4N6) segment 3 (PA) 3805.2 0.000000e+00 2128/2162 (98%)
EPI188751 A/blue-winged teal/North Dakota/Sg-00702/2008 (A/H4N6) segment 3 (PA) 3805.2 0.000000e+00 2128/2162 (98%)
EPI447506 A/mallard/Minnesota/SG-00927/2008 (A/H6N1) segment 3 (PA) 3799.7 0.000000e+00 2127/2162 (98%)
EPI188763 A/blue-winged teal/North Dakota/Sg-00705/2008 (A/H4N6) segment 3 (PA) 3799.7 0.000000e+00 2127/2162 (98%)
EPI188204 A/mallard/Minnesota/Sg-00467/2008 (A/H6N1) segment 3 (PA) 3799.7 0.000000e+00 2127/2162 (98%)
EPI188020 A/blue-winged teal/Minnesota/Sg-00225/2006 (A/H6N5) segment 3 (PA) 3799.7 0.000000e+00 2127/2162 (98%)
EPI333651 A/mallard/Mississippi/329/2010 (A/H10N7) segment 3 (PA) 3794.1 0.000000e+00 2126/2162 (98%)
EPI299504 A/mallard/Illinois/08OS2711/2008 (A/H10N7) segment 3 (PA) 3794.1 0.000000e+00 2126/2162 (98%)
EPI299400 A/mallard/Illinois/08OS2710/2008 (A/H10N7) segment 3 (PA) 3790.4 0.000000e+00 2125/2162 (98%)
EPI454319 A/mallard/Minnesota/Sg-00630/2008 (A/H10N7) segment 3 (PA) 3788.6 0.000000e+00 2125/2162 (98%)
EPI418697 A/blue-winged teal/Illinois/10OS1563/2010 (A/H4N6) segment 3 (PA) 3788.6 0.000000e+00 2125/2162 (98%)
EPI418690 A/blue-winged teal/Illinois/10OS1561/2010 (A/H4N6) segment 3 (PA) 3788.6 0.000000e+00 2125/2162 (98%)
EPI299512 A/American green-winged teal/Illinois/08OS2713/2008 (A/H10N7) segment 3 (PA) 3788.6 0.000000e+00 2125/2162 (98%)
EPI188472 A/mallard/Minnesota/Sg-00630/2008 (A/H10N7) segment 3 (PA) 3788.6 0.000000e+00 2125/2162 (98%)
EPI450155 A/mallard/Minnesota/AI06-1003/2006 (A/H2N5) segment 3 (PA) 3783.1 0.000000e+00 2124/2162 (98%)
EPI447569 A/blue-winged teal/North Dakota/Sg-00740/2008 (A/H3N8) segment 3 (PA) 3783.1 0.000000e+00 2124/2162 (98%)
EPI419472 A/blue-winged teal/Illinois/10OS2988/2010 (A/H4N6) segment 3 (PA) 3783.1 0.000000e+00 2124/2162 (98%)
EPI299520 A/mallard/Wisconsin/08OS2841/2008 (A/H2N3) segment 3 (PA) 3781.2 0.000000e+00 2121/2158 (98%)
EPI454296 A/red knot/New Jersey/Sg-00483/2008 (A/H12N5) segment 3 (PA) 3777.5 0.000000e+00 2123/2162 (98%)
EPI435777 A/mallard/Alberta/155/2009 (A/H1N9) segment 3 (PA) 3777.5 0.000000e+00 2124/2163 (98%)
EPI222510 A/redheaded duck/Minnesota/Sg-00123/2007 (A/H1N1) segment 3 (PA) 3777.5 0.000000e+00 2109/2141 (98%)
EPI175451 A/red knot/New Jersey/Sg-00483/2008 (A/H12N5) segment 3 (PA) 3777.5 0.000000e+00 2123/2162 (98%)
EPI188787 A/blue-winged teal/North Dakota/Sg-00714/2008 (A/H3N8) segment 3 (PA) 3772.0 0.000000e+00 2122/2162 (98%)
EPI188779 A/blue-winged teal/North Dakota/Sg-00712/2008 (A/H4N6) segment 3 (PA) 3772.0 0.000000e+00 2122/2162 (98%)
EPI419589 A/blue-winged teal/Missouri/10MO0011/2010 (A/H3N6) segment 3 (PA) 3766.4 0.000000e+00 2121/2162 (98%)
EPI454413 A/mallard/Minnesota/AI09-1864/2009 (A/H10N5) segment 3 (PA) 3760.9 0.000000e+00 2120/2162 (98%)
EPI454412 A/mallard/Minnesota/AI09-1851/2009 (A/H10N5) segment 3 (PA) 3760.9 0.000000e+00 2120/2162 (98%)
EPI447871 A/blue-winged Teal/North Dakota/AI09-3642/2009 (A/H3N1) segment 3 (PA) 3760.9 0.000000e+00 2120/2162 (98%)
EPI334244 A/mallard/Missouri/350/2009 (A/H11N9) segment 3 (PA) 3760.9 0.000000e+00 2120/2162 (98%)
EPI299360 A/northern shoveler/Mississippi/09OS589/2009 (A/H4N6) segment 3 (PA) 3760.9 0.000000e+00 2120/2162 (98%)
EPI59847 A/green-winged teal/Ohio/1747/2005 (A/H11N2) segment 3 (PA) 3760.9 0.000000e+00 2120/2162 (98%)
EPI333611 A/northern shoveler/Mississippi/397/2010 (A/H1N3) segment 3 (PA) 3755.4 0.000000e+00 2119/2162 (98%)
EPI167459 A/Muscovy duck/New York/62095-1/2006 (A/H5N2) segment 3 (PA) 3751.7 0.000000e+00 2119/2163 (97%)
EPI419680 A/mallard/Missouri/10MO0334/2010 (A/H0) segment 3 (PA) 3749.8 0.000000e+00 2118/2162 (97%)
EPI327466 A/unknown/New York/59316/2006 (A/H5N2) segment 3 (PA) 3749.8 0.000000e+00 2119/2163 (97%)
EPI285880 A/duck/New York/440409/2006 (A/H5N2) segment 3 (PA) 3749.8 0.000000e+00 2119/2163 (97%)
EPI285879 A/chicken/New York/439236/2006 (A/H5N2) segment 3 (PA) 3749.8 0.000000e+00 2119/2163 (97%)
EPI447816 A/mallard/Minnesota/AI09-1854/2009 (A/H8N4) segment 3 (PA) 3744.3 0.000000e+00 2117/2162 (97%)
EPI447814 A/mallard/Minnesota/AI09-1833/2009 (A/H8N4) segment 3 (PA) 3744.3 0.000000e+00 2117/2162 (97%)
EPI420264 A/cinnamon teal/California/225/2011 (A/H11N9) segment 3 (PA) 3744.3 0.000000e+00 2117/2162 (97%)
EPI334301 A/blue-winged teal/Wisconsin/2741/2009 (A/H4N6) segment 3 (PA) 3744.3 0.000000e+00 2117/2162 (97%)
EPI334142 A/American green-winged teal/Illinois/2479/2009 (A/H2N3) segment 3 (PA) 3744.3 0.000000e+00 2117/2162 (97%)
EPI285881 A/duck/New York/440410/2006 (A/H5N2) segment 3 (PA) 3744.3 0.000000e+00 2118/2163 (97%)
EPI285878 A/avian/New Jersey/437109/2006 (A/H5N2) segment 3 (PA) 3744.3 0.000000e+00 2118/2163 (97%)
EPI255448 A/duck/New York/445743/2006 (A/H5N2) segment 3 (PA) 3744.3 0.000000e+00 2118/2163 (97%)
EPI255434 A/chicken/New York/439235/2006 (A/H5N2) segment 3 (PA) 3744.3 0.000000e+00 2118/2163 (97%)
EPI177180 A/unknown/New York/78436/2006 (A/H5N2) segment 3 (PA) 3744.3 0.000000e+00 2118/2163 (97%)
EPI447883 A/mallard/Minnesota/AI09-3821/2009 (A/H4N6) segment 3 (PA) 3738.7 0.000000e+00 2116/2162 (97%)
EPI447818 A/mallard/Minnesota/AI09-1867/2009 (A/H8N4) segment 3 (PA) 3738.7 0.000000e+00 2116/2162 (97%)
EPI436175 A/mallard/Interior Alaska/10BM04564R1/2010 (A/H7N3) segment 3 (PA) 3738.7 0.000000e+00 2116/2162 (97%)
EPI413307 A/mallard/Ohio/11OS2138/2011 (A/H0) segment 3 (PA) 3738.7 0.000000e+00 2116/2162 (97%)
EPI371035 A/mallard/Alberta/289/2009 (A/H2N9) segment 3 (PA) 3738.7 0.000000e+00 2116/2162 (97%)
EPI327611 A/green-winged teal/California/11273/2008 (A/H2N9) segment 3 (PA) 3738.7 0.000000e+00 2116/2162 (97%)
EPI376096 A/environment/California/7451/2010 (A/H7N3) segment 3 (PA) 3733.2 0.000000e+00 2113/2159 (97%)
EPI280571 A/duck/Pennsylvania/446080-7/2006 (A/H5N2) segment 3 (PA) 3733.2 0.000000e+00 2116/2163 (97%)
EPI419066 A/American green-winged teal/Wisconsin/10OS2955/2010 (A/H5N2) segment 3 (PA) 3727.7 0.000000e+00 2114/2162 (97%)
EPI334369 A/mallard/Illinois/3051/2009 (A/H11N3) segment 3 (PA) 3727.7 0.000000e+00 2114/2162 (97%)
EPI285924 A/mallard/NV/450206-2/2006 (A/H5N2) segment 3 (PA) 3727.7 0.000000e+00 2114/2162 (97%)
EPI285923 A/mallard/NV/450206/2006 (A/H5N2) segment 3 (PA) 3727.7 0.000000e+00 2114/2162 (97%)
EPI285882 A/chicken/Pennsylvania/446080-7/2006 (A/H5N2) segment 3 (PA) 3727.7 0.000000e+00 2115/2163 (97%)
EPI290580 A/northern pintail/Oregon/44249-559/2006 (A/H3N8) segment 3 (PA) 3722.1 0.000000e+00 2113/2162 (97%)
EPI280579 A/duck/Pennsylvania/446080-6/2006 (A/H5N2) segment 3 (PA) 3722.1 0.000000e+00 2114/2163 (97%)
EPI225113 A/duck/Pennsylvania/414682/2006 (A/H6) segment 3 (PA) 3722.1 0.000000e+00 2114/2163 (97%)
EPI52174 A/snow goose/Maryland/353/2005 (A/H6N1) segment 3 (PA) 3722.1 0.000000e+00 2114/2163 (97%)
EPI511526 A/mallard/Mississippi/12OS443/2012 (A/H10N1) segment 3 (PA) 3716.6 0.000000e+00 2112/2162 (97%)
EPI419128 A/mallard/Mississippi/10OS4494/2010 (A/H1N1) segment 3 (PA) 3716.6 0.000000e+00 2112/2162 (97%)
EPI290596 A/northern shoveler/Washington/44249-645/2006 (A/H5N2) segment 3 (PA) 3716.6 0.000000e+00 2112/2162 (97%)
EPI280843 A/mallard/Oregon/461067-2/2006 (A/H5N2) segment 3 (PA) 3716.6 0.000000e+00 2112/2162 (97%)
EPI280699 A/northern pintail/California/469993/2006 (A/H5N2) segment 3 (PA) 3716.6 0.000000e+00 2112/2162 (97%)
EPI413469 A/mallard/Ohio/11OS2048/2011 (A/H1N1) segment 3 (PA) 3711.0 0.000000e+00 2111/2162 (97%)
EPI413292 A/mallard/Ohio/11OS2045/2011 (A/H0) segment 3 (PA) 3711.0 0.000000e+00 2111/2162 (97%)
EPI285903 A/Northern shoveler/Washington/467923/2006 (A/H5N2) segment 3 (PA) 3711.0 0.000000e+00 2111/2162 (97%)
EPI166156 A/mallard/Minnesota/Sg-00187/2007 (A/H11N2) segment 3 (PA) 3711.0 0.000000e+00 2097/2141 (97%)
EPI511394 A/American black duck/Wisconsin/11OS3016/2011 (A/H1N1) segment 3 (PA) 3705.5 0.000000e+00 2110/2162 (97%)
EPI511356 A/mallard/Illinois/11OS5564/2011 (A/H1N8) segment 3 (PA) 3705.5 0.000000e+00 2110/2162 (97%)
EPI413828 A/mallard/Ohio/11OS2095/2011 (A/H4N1) segment 3 (PA) 3705.5 0.000000e+00 2110/2162 (97%)
EPI413686 A/mallard/Ohio/11OS2200/2011 (A/H0) segment 3 (PA) 3705.5 0.000000e+00 2110/2162 (97%)
EPI413657 A/mallard/Ohio/11OS2202/2011 (A/H4N8) segment 3 (PA) 3705.5 0.000000e+00 2110/2162 (97%)
EPI413544 A/mallard/Ohio/11OS2224/2011 (A/H1N1) segment 3 (PA) 3705.5 0.000000e+00 2110/2162 (97%)
EPI413524 A/mallard/Ohio/11OS1991/2011 (A/H1N1) segment 3 (PA) 3705.5 0.000000e+00 2110/2162 (97%)
EPI413517 A/mallard/Ohio/11OS2232/2011 (A/H1N1) segment 3 (PA) 3705.5 0.000000e+00 2110/2162 (97%)
EPI413496 A/mallard/Ohio/11OS2128/2011 (A/H1N1) segment 3 (PA) 3705.5 0.000000e+00 2110/2162 (97%)
EPI413489 A/mallard/Ohio/11OS1993/2011 (A/H1N1) segment 3 (PA) 3705.5 0.000000e+00 2110/2162 (97%)
EPI413476 A/mallard/Ohio/11OS2221/2011 (A/H1N1) segment 3 (PA) 3705.5 0.000000e+00 2110/2162 (97%)
EPI413441 A/mallard/Ohio/11OS1966/2011 (A/H10N3) segment 3 (PA) 3705.5 0.000000e+00 2110/2162 (97%)
EPI307591 A/ring-necked duck/Michigan/588/2006 (A/H0) segment 3 (PA) 3705.5 0.000000e+00 2110/2162 (97%)
EPI300295 A/mallard/Interior Alaska/8BM2273/2008 (A/H0N4) segment 3 (PA) 3705.5 0.000000e+00 2110/2162 (97%)
EPI300083 A/northern pintail/Interior Alaska/8BM2082/2008 (A/H8N4) segment 3 (PA) 3705.5 0.000000e+00 2110/2162 (97%)

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Mon Dec 08, 2014 10:33 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
EPI399366 A/turkey/MB/FAV11/2010 (A/H5N2) segment 5 (NP) 2765.6 0.000000e+00 1497/1497 (100%)
EPI399358 A/turkey/MB/FAV10/2010 (A/H5N2) segment 5 (NP) 2765.6 0.000000e+00 1497/1497 (100%)
EPI449918 A/mallard/Minnesota/AI09-3819/2009 (A/H0) segment 5 (NP) 2721.2 0.000000e+00 1489/1497 (99%)
EPI334118 A/mallard/Illinois/3747/2009 (A/H6N1) segment 5 (NP) 2721.2 0.000000e+00 1489/1497 (99%)
EPI486112 A/lesser scaup/California/3087/2010 (A/H0) segment 5 (NP) 2715.7 0.000000e+00 1488/1497 (99%)
EPI449854 A/northern pintail/Minnesota/AI09-3254/2009 (A/H6N2) segment 5 (NP) 2715.7 0.000000e+00 1488/1497 (99%)
EPI419311 A/northern shoveler/Illinois/10OS4360/2010 (A/H0) segment 5 (NP) 2715.7 0.000000e+00 1488/1497 (99%)
EPI418960 A/American green-winged teal/Wisconsin/10OS3127/2010 (A/H5N2) segment 5 (NP) 2715.7 0.000000e+00 1488/1497 (99%)
EPI327859 A/mallard/California/6768/2009 (A/H1N1) segment 5 (NP) 2715.7 0.000000e+00 1488/1497 (99%)
EPI334203 A/northern shoveler/Mississippi/236/2010 (A/H10N7) segment 5 (NP) 2710.2 0.000000e+00 1487/1497 (99%)
EPI333733 A/northern shovelerMissouri/196/2009 (A/H10N3) segment 5 (NP) 2710.2 0.000000e+00 1487/1497 (99%)
EPI333613 A/northern shoveler/Mississippi/397/2010 (A/H1N3) segment 5 (NP) 2710.2 0.000000e+00 1487/1497 (99%)
EPI448675 A/blue-winged teal/North Dakota/Sg-00740/2008 (A/H3N8) segment 5 (NP) 2704.6 0.000000e+00 1486/1497 (99%)
EPI419463 A/blue-winged teal/Iowa/10OS2649/2010 (A/H3N6) segment 5 (NP) 2704.6 0.000000e+00 1486/1497 (99%)
EPI413412 A/mallard/Ohio/10OS1319/2010 (A/H4N6) segment 5 (NP) 2704.6 0.000000e+00 1486/1497 (99%)
EPI299486 A/mallard/Illinois/08OS2315/2008 (A/H4N6) segment 5 (NP) 2704.6 0.000000e+00 1486/1497 (99%)
EPI419296 A/mallard/Iowa/10OS2752/2010 (A/H11N9) segment 5 (NP) 2699.1 0.000000e+00 1485/1497 (99%)
EPI419250 A/northern shoveler/Missouri/10OS4750/2010 (A/H7N3) segment 5 (NP) 2699.1 0.000000e+00 1485/1497 (99%)
EPI419191 A/American green-winged teal/Missouri/10OS4622/2010 (A/H12N4) segment 5 (NP) 2699.1 0.000000e+00 1485/1497 (99%)
EPI418846 A/mallard/Wisconsin/10OS4193/2010 (A/H11N9) segment 5 (NP) 2699.1 0.000000e+00 1485/1497 (99%)
EPI403274 A/northern pintail/Alberta/3/2009 (A/H0) segment 5 (NP) 2699.1 0.000000e+00 1485/1497 (99%)
EPI512137 A/northern pintail/Mississippi/12OS420/2012 (A/H0) segment 5 (NP) 2693.5 0.000000e+00 1484/1497 (99%)
EPI448634 A/mallard/Minnesota/Sg-00686/2008 (A/H8N4) segment 5 (NP) 2693.5 0.000000e+00 1484/1497 (99%)
EPI448620 A/mallard/Minnesota/SG-00680/2008 (A/H0) segment 5 (NP) 2693.5 0.000000e+00 1484/1497 (99%)
EPI448573 A/mallard/Minnesota/Sg-00571/2008 (A/H0) segment 5 (NP) 2693.5 0.000000e+00 1484/1497 (99%)
EPI419614 A/blue-winged teal/Missouri/10MO030/2010 (A/H4N6) segment 5 (NP) 2693.5 0.000000e+00 1484/1497 (99%)
EPI419477 A/northern shoveler/Arkansas/11OS386/2011 (A/H9N2) segment 5 (NP) 2693.5 0.000000e+00 1484/1497 (99%)
EPI419205 A/mallard/Missouri/10OS4670/2010 (A/H9N2) segment 5 (NP) 2693.5 0.000000e+00 1484/1497 (99%)
EPI418644 A/mallard/Illinois/10OS3249/2010 (A/H11N2) segment 5 (NP) 2693.5 0.000000e+00 1484/1497 (99%)
EPI333997 A/mallard/Wisconsin/2576/2009 (A/H5N1) segment 5 (NP) 2693.5 0.000000e+00 1484/1497 (99%)
EPI333585 A/mallard/Mississippi/413/2010 (A/H1N1) segment 5 (NP) 2693.5 0.000000e+00 1484/1497 (99%)
EPI299558 A/environment/Indiana/08OS3524/2008 (A/H1N2) segment 5 (NP) 2693.5 0.000000e+00 1484/1497 (99%)
EPI449443 A/mallard/Minnesota/Sg-00701/2008 (A/H8N4) segment 5 (NP) 2688.0 0.000000e+00 1483/1497 (99%)
EPI419677 A/mallard/Missouri/10MO0334/2010 (A/H0) segment 5 (NP) 2688.0 0.000000e+00 1483/1497 (99%)
EPI419119 A/mallard/Mississippi/10OS4593/2010 (A/H1N2) segment 5 (NP) 2688.0 0.000000e+00 1483/1497 (99%)
EPI414403 A/northern pintail/Interior Alaska/10BM02539R0/2010 (A/H7N3) segment 5 (NP) 2688.0 0.000000e+00 1483/1497 (99%)
EPI513072 A/American green-winged teal/Wisconsin/11OS3580/2011 (A/H12N2) segment 5 (NP) 2682.5 0.000000e+00 1482/1497 (98%)
EPI450098 A/mallard/Minnesota/AI10-2762/2010 (A/H11N9) segment 5 (NP) 2682.5 0.000000e+00 1482/1497 (98%)
EPI450052 A/mallard/Minnesota/AI10-2217/2010 (A/H12N5) segment 5 (NP) 2682.5 0.000000e+00 1482/1497 (98%)
EPI449422 A/mallard/Minnesota/Sg-00682/2008 (A/H8N4) segment 5 (NP) 2682.5 0.000000e+00 1482/1497 (98%)
EPI448627 A/mallard/Minnesota/SG-00684/2008 (A/H8N4) segment 5 (NP) 2682.5 0.000000e+00 1482/1497 (98%)
EPI448565 A/mallard/Minnesota/Sg-00570/2008 (A/H8N4) segment 5 (NP) 2682.5 0.000000e+00 1482/1497 (98%)
EPI435385 A/mallard/New Brunswick/00992/2010 (A/H0) segment 5 (NP) 2682.5 0.000000e+00 1482/1497 (98%)
EPI435376 A/American black duck/New Brunswick/00991/2010 (A/H4N6) segment 5 (NP) 2682.5 0.000000e+00 1482/1497 (98%)
EPI435368 A/American black duck/New Brunswick/00988/2010 (A/H0) segment 5 (NP) 2682.5 0.000000e+00 1482/1497 (98%)
EPI435360 A/American black duck/New Brunswick/00987/2010 (A/H0) segment 5 (NP) 2682.5 0.000000e+00 1482/1497 (98%)
EPI435353 A/American black duck/New Brunswick/00986/2010 (A/H4N6) segment 5 (NP) 2682.5 0.000000e+00 1482/1497 (98%)
EPI433688 A/American black duck/New Brunswick/00989/2010 (A/H0) segment 5 (NP) 2682.5 0.000000e+00 1482/1497 (98%)
EPI420196 A/green-winged teal/California/96/2012 (A/H1N1) segment 5 (NP) 2682.5 0.000000e+00 1483/1498 (98%)
EPI419521 A/American green-winged teal/Mississippi/11OS255/2011 (A/H7N7) segment 5 (NP) 2682.5 0.000000e+00 1482/1497 (98%)
EPI419211 A/northern shoveler/Missouri/10OS4673/2010 (A/H14N6) segment 5 (NP) 2682.5 0.000000e+00 1482/1497 (98%)
EPI435151 A/mallard/New Brunswick/00854/2010 (A/H4N6) segment 5 (NP) 2676.9 0.000000e+00 1481/1497 (98%)
EPI419550 A/American green-winged teal/Mississippi/11OS259/2011 (A/H0) segment 5 (NP) 2676.9 0.000000e+00 1481/1497 (98%)
EPI419514 A/American green-winged teal/Mississippi/11OS250/2011 (A/H7N3) segment 5 (NP) 2676.9 0.000000e+00 1481/1497 (98%)
EPI419414 A/mallard/Iowa/10OS2426/2010 (A/H3N8) segment 5 (NP) 2676.9 0.000000e+00 1481/1497 (98%)
EPI419198 A/northern shoveler/Missouri/10OS4632/2010 (A/H7N7) segment 5 (NP) 2676.9 0.000000e+00 1481/1497 (98%)
EPI418591 A/northern shoveler/Arkansas/11OS171/2011 (A/H0) segment 5 (NP) 2676.9 0.000000e+00 1481/1497 (98%)
EPI387220 A/American wigeon/California/3180/2010 (A/H5N2) segment 5 (NP) 2676.9 0.000000e+00 1481/1497 (98%)
EPI334385 A/American green-winged teal/Illinois/2975/2009 (A/H0) segment 5 (NP) 2676.9 0.000000e+00 1481/1497 (98%)
EPI513106 A/mallard/Wisconsin/11OS4492/2011 (A/H4N2) segment 5 (NP) 2671.4 0.000000e+00 1480/1497 (98%)
EPI512204 A/American green-winged teal/Mississippi/12OS397/2012 (A/H7N7) segment 5 (NP) 2671.4 0.000000e+00 1480/1497 (98%)
EPI449574 A/green-winged teal/Minnesota/Sg-00991/2008 (A/H3N8) segment 5 (NP) 2671.4 0.000000e+00 1480/1497 (98%)
EPI435325 A/mallard/New Brunswick/00960/2010 (A/H0) segment 5 (NP) 2671.4 0.000000e+00 1480/1497 (98%)
EPI435314 A/American black duck/New Brunswick/00954/2010 (A/H0) segment 5 (NP) 2671.4 0.000000e+00 1480/1497 (98%)
EPI435268 A/American black duck/New Brunswick/00946/2010 (A/H0) segment 5 (NP) 2671.4 0.000000e+00 1480/1497 (98%)
EPI435202 A/American black duck/New Brunswick/00886/2010 (A/H4N9) segment 5 (NP) 2671.4 0.000000e+00 1480/1497 (98%)
EPI435195 A/American black duck/New Brunswick/00880/2010 (A/H0) segment 5 (NP) 2671.4 0.000000e+00 1480/1497 (98%)
EPI435187 A/mallard/New Brunswick/00879/2010 (A/H4N9) segment 5 (NP) 2671.4 0.000000e+00 1480/1497 (98%)
EPI435172 A/American black duck/New Brunswick/00878/2010 (A/H4N9) segment 5 (NP) 2671.4 0.000000e+00 1480/1497 (98%)
EPI435165 A/American black duck/New Brunswick/00876/2010 (A/H0) segment 5 (NP) 2671.4 0.000000e+00 1480/1497 (98%)
EPI433683 A/American black duck/New Brunswick/00955/2010 (A/H4N8) segment 5 (NP) 2671.4 0.000000e+00 1480/1497 (98%)
EPI433677 A/American black duck/New Brunswick/00949/2010 (A/H4N6) segment 5 (NP) 2671.4 0.000000e+00 1480/1497 (98%)
EPI420177 A/green-winged teal/California/2940/2011 (A/H1N1) segment 5 (NP) 2671.4 0.000000e+00 1480/1497 (98%)
EPI419559 A/mallard/Mississippi/11OS34/2011 (A/H1N3) segment 5 (NP) 2671.4 0.000000e+00 1480/1497 (98%)
EPI418681 A/American green-winged teal/Illinois/10OS1551/2010 (A/H4N6) segment 5 (NP) 2671.4 0.000000e+00 1480/1497 (98%)
EPI413460 A/mallard/Ohio/11OS2213/2011 (A/H11N2) segment 5 (NP) 2671.4 0.000000e+00 1480/1497 (98%)
EPI512935 A/blue-winged teal/Illinois/11OS4176/2011 (A/H11N9) segment 5 (NP) 2665.8 0.000000e+00 1479/1497 (98%)
EPI512913 A/mallard/Wisconsin/11OS3490/2011 (A/H0) segment 5 (NP) 2665.8 0.000000e+00 1479/1497 (98%)
EPI512674 A/mallard/Wisconsin/11OS3468/2011 (A/H2N3) segment 5 (NP) 2665.8 0.000000e+00 1479/1497 (98%)
EPI512384 A/northern pintail/Illinois/11OS4764/2011 (A/H0) segment 5 (NP) 2665.8 0.000000e+00 1479/1497 (98%)
EPI486738 A/mallard/California/3152/2012 (A/H2N3) segment 5 (NP) 2665.8 0.000000e+00 1479/1497 (98%)
EPI486717 A/mallard/California/3118/2012 (A/H2N3) segment 5 (NP) 2665.8 0.000000e+00 1479/1497 (98%)
EPI486676 A/mallard/California/3046/2012 (A/H2N3) segment 5 (NP) 2665.8 0.000000e+00 1479/1497 (98%)
EPI442413 A/northern pintail/Alaska/44500-066/2009 (A/H8N4) segment 5 (NP) 2665.8 0.000000e+00 1479/1497 (98%)
EPI419621 A/mallard/Missouri/10MO053/2010 (A/H7N4) segment 5 (NP) 2665.8 0.000000e+00 1479/1497 (98%)
EPI418779 A/American green-winged teal/Illinois/10OS3343/2010 (A/H2N3) segment 5 (NP) 2665.8 0.000000e+00 1479/1497 (98%)
EPI413334 A/mallard/Ohio/11OS2237/2011 (A/H0) segment 5 (NP) 2665.8 0.000000e+00 1479/1497 (98%)
EPI513100 A/mallard/Wisconsin/11OS4489/2011 (A/H8N4) segment 5 (NP) 2660.3 0.000000e+00 1478/1497 (98%)
EPI512295 A/mallard/Arkansas/12OS140/2012 (A/H11N3) segment 5 (NP) 2660.3 0.000000e+00 1478/1497 (98%)
EPI476245 A/blue-winged teal/Canada/3231/2011 (A/H4N8) segment 5 (NP) 2660.3 0.000000e+00 1478/1497 (98%)
EPI436521 A/northern pintail/Interior Alaska/10BM05034R0/2010 (A/H3N6) segment 5 (NP) 2660.3 0.000000e+00 1478/1497 (98%)
EPI413692 A/mallard/Ohio/11OS1982/2011 (A/H0) segment 5 (NP) 2660.3 0.000000e+00 1478/1497 (98%)
EPI333594 A/mallard/Mississippi/407/2010 (A/H0) segment 5 (NP) 2660.3 0.000000e+00 1478/1497 (98%)
EPI526297 A/American green-winged teal/Wisconsin/13OS3462/2013 (A/H3N8) segment 5 (NP) 2654.8 0.000000e+00 1477/1497 (98%)
EPI513033 A/mallard/Illinois/11OS5564/2011 (A/H1N8) segment 5 (NP) 2654.8 0.000000e+00 1477/1497 (98%)
EPI512325 A/long-tailed duck/Wisconsin/11OS4520/2011 (A/H6N9) segment 5 (NP) 2654.8 0.000000e+00 1477/1497 (98%)
EPI512144 A/mallard/Mississippi/12OS443/2012 (A/H10N1) segment 5 (NP) 2654.8 0.000000e+00 1477/1497 (98%)
EPI486358 A/mallard/California/2956/2012 (A/H10N7) segment 5 (NP) 2654.8 0.000000e+00 1477/1497 (98%)
EPI486340 A/mallard/California/2954/2012 (A/H10N7) segment 5 (NP) 2654.8 0.000000e+00 1477/1497 (98%)
EPI435142 A/green-winged teal/Prince Edward Island/00841/2010 (A/H3N8) segment 5 (NP) 2654.8 0.000000e+00 1477/1497 (98%)

_________________
www.twitter.com/hniman


Top
 Profile  
 
Display posts from previous:  Sort by  
Post new topic Reply to topic  [ 11 posts ]  Go to page 1, 2  Next

All times are UTC - 5 hours [ DST ]


Who is online

Users browsing this forum: Google [Bot], Yahoo [Bot] and 62 guests


You cannot post new topics in this forum
You cannot reply to topics in this forum
You cannot edit your posts in this forum
You cannot delete your posts in this forum
You cannot post attachments in this forum

Search for:
Jump to:  
cron
Powered by phpBB® Forum Software © phpBB Group