Rhiza Labs FluTracker Forum

The place to discuss the flu
It is currently Wed Oct 18, 2017 3:42 am

All times are UTC - 5 hours [ DST ]




Post new topic Reply to topic  [ 11 posts ]  Go to page 1, 2  Next
Author Message
PostPosted: Sat Dec 06, 2014 10:49 pm 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
The confirmation of H5 in a fifth farm in Fraser Valley raises additional concerns on the lineage of the H5N2. This issue has not been addressed by Canada, eeven though they have now received samples from at least 4 sources and have determined that the serotype is H5N2.

Canada has never reported high path H5N2 in wild birds or poultry. Since the fifth farm, like the relationship between the first and second, had no linkage to the other farms, it is likely that the infections are due to wild birds carrying high path H5N2.

Although high path H5N2 has never been reported in wild birds in Canada, it has been reported in wild birds in China and the H5 has been the Fujian lineage (clade 2.3.4), raising concerns that the H5N2 in Fraser Valley is this Asian strain.

Distinguishing Asian H5 from North American H5 is done by comparing sequences, which can be done in seconds, and by now Winnipeg undoubtedly has enough sequence data to make that determination, but they have been alarmingly silent.

If this H5N2 was North American, Winnipeg would have offered assurances that the lineage in Fraser Valley is similar to the low path that has been responsible for prior outbreaks.

The silence from Winnipeg is deafening, and raises serious concerns that the H5N2 in Fraser Valley is Asian in origin.

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Sat Dec 06, 2014 10:56 pm 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
Fujian H5N2 In China in 2014 OIE reports'

Follow-up report No.3
Report reference: , Reference OIE : 16061, Report Date : 24/10/2014, Country : China (People's Rep. of)
Report Summary
Name of sender of the report Dr Zhang Zhongqui Telephone (86-10) 591 928 28
Position Director General Fax (86-10) 591 928 45
Address No.11, Nongzhanguan Nanli
Chaoyang District
Beijing, 100125
Beijing
Email chinadelegate@agri.gov.cn
Date submitted to OIE 24/10/2014
Animal type Terrestrial Date of report 24/10/2014
Disease Highly pathogenic avian influenza Date of start of the event 21/12/2013
Causal Agent Highly pathogenic avian influenza virus Date of pre-confirmation of the
event
21/12/2013
Serotype(s) H5N2 Diagnosis Clinical, Laboratory (basic), Laboratory (advanced)
Reason New strain of a listed disease Clinical signs Yes
Country or zone the whole country
Number of reported outbreaks submitted= 10, Draft= 0
Outbreak details
Province Number of outbreaks City County Unit Type Location Latitude Longitude Start Date End Date:
HEBEI-other report -
submitted
- Baoding Jiaozhuang Farm Zhuzhuang village 38.84 115.54 21/12/2013 13/01/2014
Species Measuring units Susceptible Cases Deaths Destroyed Slaughtered
Birds Animals 130494 4000 4000 126494 0
Affected Population
Province Number of outbreaks City County Unit Type Location Latitude Longitude Start Date End Date:
SHANDONG-other
report - submitted
- Qingdao Farm Hongdao Economic
Development Zone
36.2 120.26 16/01/2014
Species Measuring units Susceptible Cases Deaths Destroyed Slaughtered
Birds Animals 18857 5 0 18857 0
Affected Population Five specimens from one breeder farm were tested H5N2 positive according to the national surveillance plan. No dead birds were found.
Province Number of outbreaks City County Unit Type Location Latitude Longitude Start Date End Date:
LIAONING- (this report -
submitted)
- Panjin Not applicable Wetland of Liao river 41.12 122.08 12/09/2014 15/09/2014
Species Measuring units Susceptible Cases Deaths Destroyed Slaughtered
Birds Animals ... 1 0 0 0
Affected Population One environment sample was collected according to national surveillance plan and tested positive.
Province Number of outbreaks City County Unit Type Location Latitude Longitude Start Date End Date:
HUBEI- (this report -
submitted)
- Wuhan Not applicable Zhonghuan live bird
market
30.66 114.3 12/09/2014 15/09/2014
Species Measuring units Susceptible Cases Deaths Destroyed Slaughtered
Birds Animals ... 1 0 0 0
Affected Population One duck sample was collected according to national surveillance plan and tested positive.
Province Number of outbreaks City County Unit Type Location Latitude Longitude Start Date End Date:
NINGXIA- (this report -
submitted)
- Yinchuan Farm Luhua village 38.61 106.21 12/09/2014 15/09/2014
Species Measuring units Susceptible Cases Deaths Destroyed Slaughtered
Province Number of outbreaks City County Unit Type Location Latitude Longitude Start Date End Date:
Species Measuring units Susceptible Cases Deaths Destroyed Slaughtered
Birds Animals 3920 4 0 3920 0
Affected Population 4 chicken samples were collected according to national surveillance plan and tested positive.
Province Number of outbreaks City County Unit Type Location Latitude Longitude Start Date End Date:
HUBEI- (this report -
submitted)
- Huangshi Yangxin Not applicable Wang lake 29.85 115.33 12/09/2014 15/09/2014
Species Measuring units Susceptible Cases Deaths Destroyed Slaughtered
Birds Animals ... 1 0 0 0
Affected Population One environment sample was collected according to national surveillance plan and tested positive.
Province Number of outbreaks City County Unit Type Location Latitude Longitude Start Date End Date:
TIBET- (this report -
submitted)
- Lasa Not applicable Yaowangshan market 29.65 91.11 12/09/2014 15/09/2014
Species Measuring units Susceptible Cases Deaths Destroyed Slaughtered
Birds Animals ... 1 0 0 0
Affected Population One chicken sample was collected according to national surveillance plan and tested positive.
Province Number of outbreaks City County Unit Type Location Latitude Longitude Start Date End Date:
GUANGXI- (this report -
submitted)
- Baise Jingxi Not applicable Agriculture trade market 23.14 106.31 12/09/2014 15/09/2014
Species Measuring units Susceptible Cases Deaths Destroyed Slaughtered
Birds Animals 1 1 0 0 0
Affected Population One duck sample was collected according to national surveillance plan and tested positive.
Province Number of outbreaks City County Unit Type Location Latitude Longitude Start Date End Date:
HEILONGJIANG- (this
report - submitted)
- Suihua Farm Zhaodong 47.4 131.46 12/09/2014 15/09/2014
Species Measuring units Susceptible Cases Deaths Destroyed Slaughtered
Birds Animals 2333 2 0 2333 0
Affected Population 2 chicken samples were collected according to national surveillance plan and tested positive.
Province Number of outbreaks City County Unit Type Location Latitude Longitude Start Date End Date:
HUBEI- (this report -
submitted)
- Ezhou Not applicable Mingtang Market 30.39 114.88 12/09/2014 15/09/2014
Species Measuring units Susceptible Cases Deaths Destroyed Slaughtered
Birds Animals ... 1 0 0 0
Affected Population One chicken sample was collected according to national surveillance plan and tested positive.
Outbreak summary: Total outbreaks = 10 (Submitted)
Species Susceptible Cases Deaths Destroyed Slaughtered
Birds 155605 4017 4000 151604 0
Epidemiology
Epidemiological comments
Source of the outbreak(s) or origin of infection
• Unknown or inconclusive
Measures applied
Applied To be applied
Follow-up report No.: 3, Report reference: , OIE Ref: 16061, Report Date: 24/10/2014, Country: China (People's Rep. of)
Printed on: Fri Oct 24 18:41:14 CEST 2014 Page 2/4Applied To be applied
• stamping out
• disinfection of infected premises/establishment(s)
• no planned control measures
Animals treated Vaccination Prohibited
No No
Diagnostic test results
Laboratory Type Name of Laboratory Species Test Type Date Results Provided Result
OIE’s Reference Laboratory Harbin veterinary research
institute, Chinese academy of
agricultural sciences
Birds virus isolation 15/09/2014 Positive
OIE’s Reference Laboratory Harbin veterinary research
institute, Chinese academy of
agricultural sciences
Birds reverse transcription -
polymerase chain reaction
(RT-PCR)
15/09/2014 Positive
Future Reporting
The event is continuing. Weekly follow-up reports will be submitted

http://www.oie.int/wahis_2/public%5C..% ... 184114.pdf

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Sun Dec 07, 2014 12:18 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
Map of 2014 H5N2 in China

https://mapsengine.google.com/map/edit? ... 882wmvEuck

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Sun Dec 07, 2014 1:27 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
Commentary

http://www.recombinomics.com/News/12071 ... lence.html

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Mon Dec 08, 2014 9:22 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
2009 H5N2 description on Feb 3 (first report on Jan 24)

The CFIA National Centre for Foreign Animal Diseases (NCFAD) has now isolated a Notifiable Avian Influenza Virus (AIV) from the index farm. The AIV isolate was confirmed as H5N2. The closest match in Genbank for the N gene is A/American green-winged teal/California/HKWF406/2007(H5N2), accession number: CY033446. The closest match in Genbank for the H gene is A/American green-winged teal/California/HKWF609/2007(H5N2), accession number: CY033444, as reported in the immediate notification. Based on gene sequencing results, the virus was determined to be of low virulence. The NCFAD will now proceed with the determination of the IVPI index. Note by the OIE Animal Health Information Department: H5 and H7 avian influenza in its low pathogenic form in poultry is a notifiable disease as per Chapter 10.4. on avian influenza of the Terrestrial Animal Health Code (2008).

CFIA National Center for Foreign Animal Diseases (National laboratory) Birds gene sequencing 02/02/2009 Positive
CFIA National Center for Foreign Animal Diseases (National laboratory) Birds intravenous pathogenicity index (IVPI) test 02/02/2009 Pending
CFIA National Center for Foreign Animal Diseases (National laboratory)

http://www.oie.int/wahis_2/public/wahid ... ortid=7761

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Mon Dec 08, 2014 9:36 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
Avian Dis. 2014 Mar;58(1):1-7.
Characterization of a low pathogenic avian influenza H5N2 virus isolated from a turkey breeder flock in Manitoba, Canada.
Berhane Y, Joseph T, Kehler H, Hisanaga T, Embury-Hyatt C, Diederich S, McGreevy KH, Handel K, Cottam-Birt C, Pasick J.
Abstract
In November 2010, an outbreak of avian influenza (AI) due to the H5N2 subtype virus occurred in a turkey breeder farm in northern Manitoba, Canada. The only clinical signs observed were depression, decrease in food consumption, and loss of egg production. The hemagglutinin (HA) cleavage (HA(0)) site of the isolated H5N2 virus was PQRETR/GLF, consistent with low pathogenic AI viruses. The intravenous pathogenicity index of this virus was zero. Whole-genome sequencing of two isolates that originated from two different barns was performed, and both isolates had 100% identical protein sequence in PB2, HA, NP, M1, M2, NS1, and NS2. The remaining gene segments (PB1, PA, and NA) had a single amino-acid difference when compared with each other. The nucleotide and protein sequences of eight gene segments from both isolates showed 99 or greater identity with other AI viruses that have been circulating in free-living aquatic birds in Canada and the United States within the last 10 yr. Phylogenetic analysis of the HA and neuraminidase (NA) gene segments showed that these viruses are closely related to other H5 strains that have been isolated from Manitoba and other parts of Canada. Serologic testing of archived serum samples collected from these turkeys a week before the outbreak showed no evidence of AI infection. In addition, other farms that were located within 3 km radius from the infected farm and farms that had epidemiologic connection with the farm also tested negative for the presence of H5N2 AI virus or antibody. This indicates that the virus might have been introduced to the farm from wild aquatic birds only a short time before detection. Results of this study highlight the importance of early detection and the significance of ongoing Canada-wide surveillance of AI in domestic poultry as well as in wild aquatic birds/ducks.

PMID: 24758106 [PubMed - indexed for MEDLINE]
http://www.ncbi.nlm.nih.gov/pubmed/24758106

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Mon Dec 08, 2014 9:40 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
niman wrote:
Avian Dis. 2014 Mar;58(1):1-7.
Characterization of a low pathogenic avian influenza H5N2 virus isolated from a turkey breeder flock in Manitoba, Canada.
Berhane Y, Joseph T, Kehler H, Hisanaga T, Embury-Hyatt C, Diederich S, McGreevy KH, Handel K, Cottam-Birt C, Pasick J.
Abstract
In November 2010, an outbreak of avian influenza (AI) due to the H5N2 subtype virus occurred in a turkey breeder farm in northern Manitoba, Canada. The only clinical signs observed were depression, decrease in food consumption, and loss of egg production. The hemagglutinin (HA) cleavage (HA(0)) site of the isolated H5N2 virus was PQRETR/GLF, consistent with low pathogenic AI viruses. The intravenous pathogenicity index of this virus was zero. Whole-genome sequencing of two isolates that originated from two different barns was performed, and both isolates had 100% identical protein sequence in PB2, HA, NP, M1, M2, NS1, and NS2. The remaining gene segments (PB1, PA, and NA) had a single amino-acid difference when compared with each other. The nucleotide and protein sequences of eight gene segments from both isolates showed 99 or greater identity with other AI viruses that have been circulating in free-living aquatic birds in Canada and the United States within the last 10 yr. Phylogenetic analysis of the HA and neuraminidase (NA) gene segments showed that these viruses are closely related to other H5 strains that have been isolated from Manitoba and other parts of Canada. Serologic testing of archived serum samples collected from these turkeys a week before the outbreak showed no evidence of AI infection. In addition, other farms that were located within 3 km radius from the infected farm and farms that had epidemiologic connection with the farm also tested negative for the presence of H5N2 AI virus or antibody. This indicates that the virus might have been introduced to the farm from wild aquatic birds only a short time before detection. Results of this study highlight the importance of early detection and the significance of ongoing Canada-wide surveillance of AI in domestic poultry as well as in wild aquatic birds/ducks.

PMID: 24758106 [PubMed - indexed for MEDLINE]
http://www.ncbi.nlm.nih.gov/pubmed/24758106

This is the first outbreak of Notifiable Avian Influenza (NAI) detected in the province of Manitoba. The farm has been quarantined by the Canadian Food Inspection Agency (CFIA) and investigation will be conducted in compliance with the Canada's Notifiable Avian Influenza Hazard Specific Plan. A stamping out policy will be applied. Preliminary results from the National Center for Foreign Animal Diseases in Winnipeg indicate the presence of a H5N2 subtype avian influenza virus (PCR). Sequence analysis of the PCR products indicates that the cleavage site is consistent with low pathogenic avian influenza virus H5. Closest matches (99% identity) in Genbank are to North American H5N2 viruses from wild birds. Virus isolation is underway and additional testing is to come, including the intravenous pathogenicity index test. NAI surveillance has been in place in domestic poultry in Canada for many years and this outbreak is limited to the province of Manitoba. Note by the OIE Animal Health Information Department: H5 and H7 avian influenza in its low pathogenic form in poultry is a notifiable disease as per Chapter 10.4. on avian influenza of the Terrestrial Animal Health Code (2010).

Manitoba Agriculture, Food and Rural Initiatives Veterinary Diagnostic Services (Local laboratory) Birds polymerase chain reaction (PCR) 23/11/2010 Positive
CFIA - National Center for Foreign Animal Diseases (National laboratory) Birds nucleotide sequencing 24/11/2010 Positive
CFIA - National Center for Foreign Animal Diseases (National laboratory) Birds real-time PCR 24/11/2010 Positive
http://www.oie.int/wahis_2/public/wahid ... ortid=9973

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Mon Dec 08, 2014 9:43 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
niman wrote:


Manitoba Agriculture, Food and Rural Initiatives Veterinary Diagnostic Services (Local laboratory) Birds polymerase chain reaction (PCR) 23/11/2010 Positive
CFIA - National Center for Foreign Animal Diseases (National laboratory) Birds nucleotide sequencing 24/11/2010 Positive
CFIA - National Center for Foreign Animal Diseases (National laboratory) Birds real-time PCR 24/11/2010 Positive
http://www.oie.int/wahis_2/public/wahid ... ortid=9973

Note that the National lab had the sequence 1 day after the report by the local lab.

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Mon Dec 08, 2014 9:56 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
LOCUS JX570811 1733 bp cRNA linear VRL 20-MAR-2014
DEFINITION Influenza A virus (A/turkey/MB/FAV10/2010(H5N2)) segment 4
hemagglutinin (HA) gene, complete cds.
ACCESSION JX570811
VERSION JX570811.1 GI:407361261
KEYWORDS .
SOURCE Influenza A virus (A/turkey/MB/FAV10/2010(H5N2))
ORGANISM Influenza A virus (A/turkey/MB/FAV10/2010(H5N2))
Viruses; ssRNA negative-strand viruses; Orthomyxoviridae;
Influenzavirus A.
REFERENCE 1 (bases 1 to 1733)
AUTHORS Berhane,Y., Joseph,T., Kehler,H., Hisanaga,T., Embury-Hyatt,C.,
Diederich,S., McGreevy,K.H., Handel,K., Cottam-Birt,C. and
Pasick,J.
TITLE Characterization of a low pathogenic avian influenza H5N2 virus
isolated from a turkey breeder flock in Manitoba, Canada
JOURNAL Avian Dis. 58 (1), 1-7 (2014)
PUBMED 24758106
REFERENCE 2 (bases 1 to 1733)
AUTHORS Berhane,Y., Tomy,J., Kehler,H., Hisanaga,T., Embury-Hyatt,C.,
Hooper-McGreevy,K., Cottam-Birt,C. and Pasick,J.
TITLE Direct Submission
JOURNAL Submitted (04-SEP-2012) National Centre for Foreign Animal Disease,
Canadian Food Inspection Agency, 1015 Arlington St., Winnipeg,
Manitoba R3E 3M4, Canada
COMMENT GenBank Accession Numbers JX570811-JX570818 represent sequences
from the 8 segments of Influenza A virus
(A/turkey/MB/FAV10/2010(H5N2)).

##Assembly-Data-START##
Assembly Method :: DNAstar LaserGene v. 9
Sequencing Technology :: Sanger dideoxy sequencing
##Assembly-Data-END##
FEATURES Location/Qualifiers
source 1..1733
/organism="Influenza A virus
(A/turkey/MB/FAV10/2010(H5N2))"
/mol_type="viral cRNA"
/strain="A/turkey/MB/FAV10/2010"
/serotype="H5N2"
/host="turkey"
/db_xref="taxon:1229837"
/segment="4"
/country="Canada: Manitoba"
/collection_date="26-Nov-2010"
/note="passage details: 1CE-2dpi"
gene 15..1709
/gene="HA"
CDS 15..1709
/gene="HA"
/function="receptor binding and fusion protein"
/codon_start=1
/product="hemagglutinin"
/protein_id="AFU10242.1"
/db_xref="GI:407361262"
/translation="MERIVIALAIISIVKGDQICIGYHANNSTEQVDTIMEKNVTVTH
AQDILEKEHNGKLCSLKGVRPLILKDCSVAGWLLGNPMCDEFLNVPEWSYIVEKDNPV
NGLCYPGDFSDYEELKHLMSSTNHFEKIQIIPRSSWSNHDASSGVSSACPYNGRSSFF
RNVVWLIKKNNAYPTIKRTYNNTNVEDLLIIWGIHHPNDAAEQTKLYQNSNTYVSVGT
STLNQRSIPEIATRPKVNGQSGRMEFFWTILKSNDAISFESNGNFIAPEYAYKIVKKG
DSAIMRSELEYGNCDTNCQTPLGAINSSMPFHNVHPLTIGECPKYVKSDKLVLATGLR
NVPQRETRGLFGAIAGFIEGGWQGMVDGWYGYHHSNEQGSGYAADKESTQKAIDGITN
KVNSIIDKMNTQFEAVGKEFNNLERRIEILNKKMEDGFLDVWTYNAELLVLMENERTL
DFHDSNVKNLYDKVRLQLRDNAKELGNGCFEFYHKCDNECMESVRNGTYDYPQYSEES
RLNREEIDGVKLESMGTYQILSIYSTVASSLALAIMIAGLSFWMCSNGSLQCRICI"
sig_peptide 15..62
/gene="HA"
mat_peptide 63..1040
/gene="HA"
/product="HA1"
mat_peptide 1041..1706
/gene="HA"
/product="HA2"
ORIGIN
1 tccaaactat gaaaatggaa agaatagtga ttgccctcgc aataatcagc attgtcaaag
61 gtgaccaaat ttgcattggt taccatgcaa acaattcaac agagcaggtt gatacaatca
121 tggaaaagaa tgtgacggtc acacatgctc aagatatact ggaaaaagag cacaatggga
181 aactttgcag tcttaaagga gtgaggcccc tcatcctgaa ggattgcagt gtagctggat
241 ggcttcttgg aaacccaatg tgtgatgaat tcctgaatgt accagaatgg tcatacatcg
301 tggaaaaaga taatccagtc aatggcctgt gctatccagg agacttcagc gactatgaag
361 aactgaagca tttaatgagt agcacaaacc attttgagaa aattcagata atccctagga
421 gttcttggtc caatcatgac gcctcatcag gagtgagttc ggcatgccca tacaatggta
481 gatcttcctt tttcaggaat gtagtgtggt tgatcaagaa gaataatgcg tacccaacaa
541 taaagaggac ctataacaac accaatgtag aagacctttt aataatatgg ggaatacacc
601 accctaatga tgcagctgaa caaacaaaac tctaccagaa ctcgaacact tatgtgtctg
661 taggaacatc aacactgaac cagagatcaa tcccagaaat agccactaga cccaaagtga
721 acggacaaag tggaagaatg gaatttttct ggacaatact gaagtcgaac gatgcaatca
781 gctttgaaag taatgggaat tttatagctc ctgaatatgc gtacaaaatt gtcaagaaag
841 gagattcagc aatcatgaga agtgaattgg agtatggtaa ctgtgacacc aactgtcaga
901 ctccattggg tgctataaat tccagtatgc ccttccacaa tgttcatcct cttaccattg
961 gggagtgccc caagtatgta aaatcggaca aactggtcct tgcaacagga ctaagaaacg
1021 taccccaaag agaaacaaga ggcctatttg gtgcaatagc aggattcata gaaggaggat
1081 ggcaaggaat ggttgacggg tggtacggat accatcatag caatgagcag ggaagtggat
1141 atgctgcaga caaagaatcc acccagaaag caatcgatgg gatcaccaat aaagtaaact
1201 caatcattga caaaatgaac actcaattcg aagcagttgg gaaagaattc aacaacctag
1261 aaaggagaat agaaattttg aataagaaaa tggaagatgg gtttttagat gtatggactt
1321 acaatgcaga acttctcgtg ctcatggaaa acgaaagaac tctggatttc catgattcaa
1381 atgtcaagaa cctatacgat aaggtccgac tccagctgag agacaatgca aaagaattag
1441 gcaatggatg cttcgaattc taccacaaat gtgacaatga atgcatggaa agtgtgagaa
1501 atggaacgta tgactatccg caatattcag aagaatcaag actgaacaga gaggaaatag
1561 acggagtcaa gttggaatca atgggcacct accagatatt atcaatctac tcaacagtgg
1621 cgagttccct agcactggca atcatgatag ctggtctatc tttttggatg tgctccaatg
1681 gatcattgca gtgcagaatt tgcatctaga attgtgagtt cagattataa tta

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Mon Dec 08, 2014 9:57 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
EPI399355 A/turkey/MB/FAV10/2010 (A/H5N2) segment 4 (HA) 3131.2 0.000000e+00 1695/1695 (100%)
EPI399363 A/turkey/MB/FAV11/2010 (A/H5N2) segment 4 (HA) 3110.9 0.000000e+00 1691/1695 (99%)
EPI280822 A/duck/Minnesota/462960-2/2006 (A/H5N2) segment 4 (HA) 3037.0 0.000000e+00 1679/1696 (98%)
EPI280782 A/mallard/Minnesota/464334/2006 (A/H5N2) segment 4 (HA) 3037.0 0.000000e+00 1678/1695 (98%)
EPI331871 A/environment/Maryland/1154/2006 (A/H5N1) segment 4 (HA) 3031.5 0.000000e+00 1677/1695 (98%)
EPI331866 A/environment/Maryland/1165/2006 (A/H5N1) segment 4 (HA) 3031.5 0.000000e+00 1677/1695 (98%)
EPI286356 A/wild bird/Wisconsin/433163-2/2006 (A/H5N2) segment 4 (HA) 3031.5 0.000000e+00 1677/1695 (98%)
EPI512455 A/mallard/Missouri/11OS4987/2011 (A/H5N2) segment 4 (HA) 3025.9 0.000000e+00 1676/1695 (98%)
EPI331870 A/environment/Maryland/1156/2006 (A/H5N1) segment 4 (HA) 3025.9 0.000000e+00 1676/1695 (98%)
EPI307610 A/environment/Maryland/2318/2006 (A/H0) segment 4 (HA) 3025.9 0.000000e+00 1676/1695 (98%)
EPI280750 A/mallard/Michigan/466547-5/2006 (A/H5N2) segment 4 (HA) 3025.9 0.000000e+00 1676/1695 (98%)
EPI280606 A/mallard/Louisiana/476670-4/2007 (A/H5N2) segment 4 (HA) 3025.9 0.000000e+00 1676/1695 (98%)
EPI230658 A/environment/Maryland/1192/2006 (A/H5N1) segment 4 (HA) 3022.2 0.000000e+00 1675/1695 (98%)
EPI334359 A/American green-winged teal/Illinois/3443/2009 (A/H0) segment 4 (HA) 3020.4 0.000000e+00 1676/1696 (98%)
EPI331865 A/environment/Maryland/1170/2006 (A/H5N1) segment 4 (HA) 3020.4 0.000000e+00 1675/1695 (98%)
EPI280758 A/mallard/Michigan/466372-3/2006 (A/H5N2) segment 4 (HA) 3020.4 0.000000e+00 1675/1695 (98%)
EPI227334 A/mallard/ON/499/2005 (A/H5N1) segment 4 (HA) 3020.4 0.000000e+00 1675/1695 (98%)
EPI227314 A/mallard/MB/458/2005 (A/H5) segment 4 (HA) 3020.4 0.000000e+00 1676/1696 (98%)
EPI76378 A/mallard/Maryland/182/2006 (A/H5N2) segment 4 (HA) 3020.4 0.000000e+00 1675/1695 (98%)
EPI510516 A/goose/MB/428/2006 (A/H5N2) segment 4 (HA) 3014.9 0.000000e+00 1674/1695 (98%)
EPI331873 A/environment/Maryland/1152/2006 (A/H5N1) segment 4 (HA) 3014.9 0.000000e+00 1674/1695 (98%)
EPI331869 A/environment/Maryland/1158/2006 (A/H5N1) segment 4 (HA) 3014.9 0.000000e+00 1674/1695 (98%)
EPI331864 A/environment/Maryland/1171/2006 (A/H5N1) segment 4 (HA) 3014.9 0.000000e+00 1674/1695 (98%)
EPI307602 A/environment/Maryland/1152/2006 (A/H0) segment 4 (HA) 3014.9 0.000000e+00 1675/1696 (98%)
EPI286409 A/duck/New York/484680/2007 (A/H5N2) segment 4 (HA) 3014.9 0.000000e+00 1674/1695 (98%)
EPI286368 A/environment/New York/466812-3/2007 (A/H5N2) segment 4 (HA) 3014.9 0.000000e+00 1674/1695 (98%)
EPI286326 A/environment/New York/483238/2007 (A/H5N2) segment 4 (HA) 3014.9 0.000000e+00 1674/1695 (98%)
EPI286325 A/duck/New York/470179/2006 (A/H5N2) segment 4 (HA) 3014.9 0.000000e+00 1674/1695 (98%)
EPI280590 A/northern pintail/Florida/480645-5/2007 (A/H5N2) segment 4 (HA) 3014.9 0.000000e+00 1674/1695 (98%)
EPI280454 A/duck/Ohio/470655/2007 (A/H5N2) segment 4 (HA) 3014.9 0.000000e+00 1675/1696 (98%)
EPI255553 A/environment/New York/484056/2007 (A/H5N2) segment 4 (HA) 3014.9 0.000000e+00 1674/1695 (98%)
EPI255545 A/environment/New York/481173/2007 (A/H5N2) segment 4 (HA) 3014.9 0.000000e+00 1674/1695 (98%)
EPI255537 A/environment/New York/466788/2006 (A/H5N2) segment 4 (HA) 3014.9 0.000000e+00 1674/1695 (98%)
EPI255529 A/environment/New York/190723/2007 (A/H5N2) segment 4 (HA) 3014.9 0.000000e+00 1674/1695 (98%)
EPI255497 A/duck/New York/484057/2007 (A/H5N2) segment 4 (HA) 3014.9 0.000000e+00 1674/1695 (98%)
EPI255489 A/duck/New York/481172/2007 (A/H5N2) segment 4 (HA) 3014.9 0.000000e+00 1674/1695 (98%)
EPI118648 A/northern pintail/FL/598/2007 (A/H5N2) segment 4 (HA) 3014.9 0.000000e+00 1674/1695 (98%)
EPI118590 A/black duck/NC/674-694/2006 (A/H5N1) segment 4 (HA) 3014.9 0.000000e+00 1674/1695 (98%)
EPI331874 A/environment/Maryland/1149/2006 (A/H5N1) segment 4 (HA) 3009.3 0.000000e+00 1673/1695 (98%)
EPI286337 A/mallard/Illinois/464067-5/2006 (A/H5N2) segment 4 (HA) 3009.3 0.000000e+00 1673/1695 (98%)
EPI286327 A/duck/New York/483239/2007 (A/H5N2) segment 4 (HA) 3009.3 0.000000e+00 1673/1695 (98%)
EPI280646 A/Canada goose/Texas/475000-3/2006 (A/H5N2) segment 4 (HA) 3009.3 0.000000e+00 1673/1695 (98%)
EPI255769 A/turkey/New York/465977/2006 (A/H5N2) segment 4 (HA) 3009.3 0.000000e+00 1673/1695 (98%)
EPI255473 A/duck/New York/466787/2006 (A/H5N2) segment 4 (HA) 3009.3 0.000000e+00 1673/1695 (98%)
EPI255465 A/duck/New York/465976/2006 (A/H5N2) segment 4 (HA) 3009.3 0.000000e+00 1673/1695 (98%)
EPI255427 A/avian/New York/466812/2006 (A/H5N2) segment 4 (HA) 3009.3 0.000000e+00 1673/1695 (98%)
EPI183945 A/duck/New York/492652/2007 (A/H5N2) segment 4 (HA) 3009.3 0.000000e+00 1673/1695 (98%)
EPI173523 A/mallard/Maryland/897/2004 (A/H5N2) segment 4 (HA) 3009.3 0.000000e+00 1673/1695 (98%)
EPI164466 A/mute swan/Michigan/451072/2006 (A/H5N1) segment 4 (HA) 3009.3 0.000000e+00 1673/1695 (98%)
EPI331867 A/environment/Maryland/1162/2006 (A/H5N1) segment 4 (HA) 3003.8 0.000000e+00 1672/1695 (98%)
EPI280726 A/mallard/Ohio/468158/2006 (A/H5N2) segment 4 (HA) 3003.8 0.000000e+00 1673/1696 (98%)
EPI280470 A/wild bird/Minnesota/460613/2006 (A/H5N2) segment 4 (HA) 3003.8 0.000000e+00 1672/1695 (98%)
EPI255561 A/environment/New York/484678/2007 (A/H5N2) segment 4 (HA) 3003.8 0.000000e+00 1672/1695 (98%)
EPI255505 A/duck/New York/489761/2007 (A/H5N2) segment 4 (HA) 3003.8 0.000000e+00 1672/1695 (98%)
EPI255481 A/duck/New York/469961/2006 (A/H5N2) segment 4 (HA) 3003.8 0.000000e+00 1673/1696 (98%)
EPI255457 A/duck/New York/465571/2006 (A/H5N2) segment 4 (HA) 3003.8 0.000000e+00 1672/1695 (98%)
EPI227339 A/mallard/Quebec/16334/2005 (A/H5N3) segment 4 (HA) 3003.8 0.000000e+00 1672/1695 (98%)
EPI225161 A/mallard/Pennsylvania/454069-12/2006 (A/H5N4) segment 4 (HA) 3003.8 0.000000e+00 1672/1695 (98%)
EPI141396 A/environment/Maryland/1189/2006 (A/H5N1) segment 4 (HA) 3003.8 0.000000e+00 1672/1695 (98%)
EPI118594 A/mute swan/MI/451072-2/2006 (A/H5N1) segment 4 (HA) 3003.8 0.000000e+00 1672/1695 (98%)
EPI116162 A/mallard/ON/499/2005 (A/H5N1) segment 4 (HA) 3003.8 0.000000e+00 1672/1695 (98%)
EPI331872 A/environment/Maryland/1153/2006 (A/H5N1) segment 4 (HA) 2998.2 0.000000e+00 1671/1695 (98%)
EPI331868 A/environment/Maryland/1159/2006 (A/H5N1) segment 4 (HA) 2998.2 0.000000e+00 1671/1695 (98%)
EPI286344 A/green winged teal/Delaware/468157-6/2006 (A/H5N2) segment 4 (HA) 2998.2 0.000000e+00 1671/1695 (98%)
EPI286335 A/duck/Michigan/463796-7/2006 (A/H5N2) segment 4 (HA) 2998.2 0.000000e+00 1671/1695 (98%)
EPI280774 A/mallard/Indiana/465297-2/2006 (A/H5N2) segment 4 (HA) 2998.2 0.000000e+00 1671/1695 (98%)
EPI280718 A/mallard/Ohio/468159-4/2006 (A/H5N2) segment 4 (HA) 2998.2 0.000000e+00 1671/1695 (98%)
EPI280686 A/mallard/Kentucky/472048-2/2006 (A/H5N2) segment 4 (HA) 2998.2 0.000000e+00 1671/1695 (98%)
EPI280614 A/waterfowl/Colorado/476466-3/2007 (A/H5N2) segment 4 (HA) 2998.2 0.000000e+00 1672/1696 (98%)
EPI280502 A/waterfowl/Colorado/457952-2/2006 (A/H5N2) segment 4 (HA) 2998.2 0.000000e+00 1672/1696 (98%)
EPI280494 A/green winged teal/Delaware/458672-5/2006 (A/H5N2) segment 4 (HA) 2998.2 0.000000e+00 1671/1695 (98%)
EPI280438 A/duck/New York/504371/2007 (A/H5N2) segment 4 (HA) 2998.2 0.000000e+00 1671/1695 (98%)
EPI255521 A/duck/New York/494165/2007 (A/H5N2) segment 4 (HA) 2998.2 0.000000e+00 1671/1695 (98%)
EPI255513 A/duck/New York/490722/2007 (A/H5N2) segment 4 (HA) 2998.2 0.000000e+00 1671/1695 (98%)
EPI225153 A/mallard/PA/454069-9/2006 (A/H5N1) segment 4 (HA) 2998.2 0.000000e+00 1671/1695 (98%)
EPI118592 A/duck/PA/454069/2005 (A/H5N1) segment 4 (HA) 2998.2 0.000000e+00 1671/1695 (98%)
EPI115021 A/mallard/ON/499/2005 (A/H5N1) segment 4 (HA) 2998.2 0.000000e+00 1671/1695 (98%)
EPI280814 A/green winged teal/Iowa/463990-3/2006 (A/H5N2) segment 4 (HA) 2992.7 0.000000e+00 1670/1695 (98%)
EPI280630 A/waterfowl/Colorado/476466/2007 (A/H5N2) segment 4 (HA) 2992.7 0.000000e+00 1670/1695 (98%)
EPI280462 A/duck/New York/504372/2007 (A/H5N2) segment 4 (HA) 2992.7 0.000000e+00 1670/1695 (98%)
EPI230706 A/mallard/Maryland/802/2007 (A/H5N1) segment 4 (HA) 2992.7 0.000000e+00 1670/1695 (98%)
EPI225324 A/northern pintail/Illinois/464067-4/2006 (A/H5N9) segment 4 (HA) 2992.7 0.000000e+00 1670/1695 (98%)
EPI222710 A/turkey/Virginia/505477-17/2007 (A/H5N1) segment 4 (HA) 2992.7 0.000000e+00 1671/1696 (98%)
EPI315612 A/mallard/Maryland/792/2007 (A/H5N9) segment 4 (HA) 2987.2 0.000000e+00 1669/1695 (98%)
EPI286351 A/Canada goose/Wisconsin/474847-4/2006 (A/H5N2) segment 4 (HA) 2987.2 0.000000e+00 1669/1695 (98%)
EPI280710 A/green winged teal/Ohio/468160/2006 (A/H5N2) segment 4 (HA) 2987.2 0.000000e+00 1669/1695 (98%)
EPI280638 A/Canada goose/New York/475813-2/2007 (A/H5N2) segment 4 (HA) 2987.2 0.000000e+00 1669/1695 (98%)
EPI171085 A/environment/New York/11653-1/2005 (A/H5N2) segment 4 (HA) 2987.2 0.000000e+00 1669/1695 (98%)
EPI286349 A/mallard/Arkansas/473507-13/2006 (A/H5N2) segment 4 (HA) 2981.6 0.000000e+00 1668/1695 (98%)
EPI280806 A/American wigeon/Iowa/463993/2006 (A/H5N2) segment 4 (HA) 2981.6 0.000000e+00 1668/1695 (98%)
EPI280766 A/avian/Missouri/465593-7/2006 (A/H5N2) segment 4 (HA) 2981.6 0.000000e+00 1668/1695 (98%)
EPI280662 A/mallard/Arkansas/473507-1/2006 (A/H5N2) segment 4 (HA) 2981.6 0.000000e+00 1668/1695 (98%)
EPI222702 A/turkey/VA/505477-18/2007 (A/H5N1) segment 4 (HA) 2981.6 0.000000e+00 1669/1696 (98%)
EPI286336 A/northern pintail/Iowa/463992/2006 (A/H5N2) segment 4 (HA) 2976.1 0.000000e+00 1667/1695 (98%)
EPI280854 A/waterfowl/Minnesota/459675/2006 (A/H5N2) segment 4 (HA) 2976.1 0.000000e+00 1667/1695 (98%)
EPI280798 A/American wigeon/Iowa/463998/2006 (A/H5N2) segment 4 (HA) 2976.1 0.000000e+00 1667/1695 (98%)
EPI280622 A/waterfowl/Colorado/476466-2/2007 (A/H5N2) segment 4 (HA) 2976.1 0.000000e+00 1667/1695 (98%)
EPI280486 A/wild bird/Minnesota/459254-5/2006 (A/H5N2) segment 4 (HA) 2976.1 0.000000e+00 1667/1695 (98%)
EPI334113 A/environment/Indiana/3596/2009 (A/H5N2) segment 4 (HA) 2970.5 0.000000e+00 1666/1695 (98%)
EPI334097 A/environment/Indiana/3607/2009 (A/H5N2) segment 4 (HA) 2970.5 0.000000e+00 1666/1695 (98%)

_________________
www.twitter.com/hniman


Top
 Profile  
 
Display posts from previous:  Sort by  
Post new topic Reply to topic  [ 11 posts ]  Go to page 1, 2  Next

All times are UTC - 5 hours [ DST ]


Who is online

Users browsing this forum: Google [Bot], Majestic-12 [Bot], Yahoo [Bot] and 64 guests


You cannot post new topics in this forum
You cannot reply to topics in this forum
You cannot edit your posts in this forum
You cannot delete your posts in this forum
You cannot post attachments in this forum

Search for:
Jump to:  
cron
Powered by phpBB® Forum Software © phpBB Group