Rhiza Labs FluTracker Forum

The place to discuss the flu
It is currently Mon May 29, 2017 4:51 pm

All times are UTC - 5 hours [ DST ]




Post new topic Reply to topic  [ 50 posts ]  Go to page 1, 2, 3, 4, 5  Next
Author Message
PostPosted: Mon Apr 29, 2013 10:12 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
Three gene segments (H7, N9, MP) for A/Jiangsu/2013 have been released and exactly match A/Hangzhou/2013. There are three unique polymorphisms (2 in H7 and 1 in N9) and two of the three are silent.

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Mon Apr 29, 2013 10:23 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
LOCUS KC853766 1683 bp cRNA linear VRL 19-APR-2013
DEFINITION Influenza A virus (A/Hangzhou/1/2013(H7N9)) segment 4 hemagglutinin
(HA) gene, complete cds.
ACCESSION KC853766
VERSION KC853766.1 GI:475662453
KEYWORDS .
SOURCE Influenza A virus (A/Hangzhou/1/2013(H7N9))
ORGANISM Influenza A virus (A/Hangzhou/1/2013(H7N9))
Viruses; ssRNA negative-strand viruses; Orthomyxoviridae;
Influenzavirus A.
REFERENCE 1 (bases 1 to 1683)
AUTHORS Li,J., Sun,Y.X., Pu,X.Y., Yu,X.F., Chen,Q.J., Kou,Y., Ding,S.J.,
Zhou,Y.Y. and Pan,J.C.
TITLE Genetic Characterization of a Novel Influenza A(H7N9) Virus in
Hangzhou, China
JOURNAL Unpublished
REFERENCE 2 (bases 1 to 1683)
AUTHORS Li,J., Sun,Y.X., Pu,X.Y., Yu,X.F., Chen,Q.J., Kou,Y., Ding,S.J.,
Zhou,Y.Y. and Pan,J.C.
TITLE Direct Submission
JOURNAL Submitted (03-APR-2013) Microbiology Laboratory, Hangzhou Center
for Disease Control and Prevention, Jianggan district, Jianqiao
town, Mingshi Road, Hangzhou, Zhejiang 310021, China
FEATURES Location/Qualifiers
source 1..1683
/organism="Influenza A virus (A/Hangzhou/1/2013(H7N9))"
/mol_type="viral cRNA"
/strain="A/Hangzhou/1/2013"
/serotype="H7N9"
/isolation_source="throat swab"
/host="Homo sapiens"
/db_xref="taxon:1314758"
/segment="4"
/country="China: Hangzhou"
/collection_date="24-Mar-2013"
gene 1..1683
/gene="HA"
CDS 1..1683
/gene="HA"
/codon_start=1
/product="hemagglutinin"
/protein_id="AGI60301.1"
/db_xref="GI:475662454"
/translation="MNTQILVFALIAIIPTNADKICLGHHAVSNGTKVNTLTERGVEV
VNATETVERTNIPRICSKGKRTVDLGQCGLLGTITGPPQCDQFLEFSADLIIERREGS
DVCYPGKFVNEEALRQILRESGGIDKEAMGFTYSGIRTNGATSACRRSGSSFYAEMKW
LLSNTDNAAFPQMTKSYKNTRKSPALIVWGIHHSVSTAEQTKLYGSGNKLVTVGSSNY
QQSFVPSPGARPQVNGISGRIDFHWLMLNPNDTVTFSFNGAFIAPDRASFLRGKSMGI
QSGVQVDANCEGDCYHSGGTIISNLPFQNIDSRAVGKCPRYVKQRSLLLATGMKNVPE
IPKGRGLFGAIAGFIENGWEGLIDGWYGFRHQNAQGEGTAADYKSTQSAIDQITGKLN
RLIEKTNQQFELIDNEFNEVEKQIGNVINWTRDSITEVWSYNAELLVAMENQHTIDLA
DSEMDKLYERVKRQLRENAEEDGTGCFEIFHKCDDDCMASIRNNTYDHSKYREEAMQN
RIQIDPVKLSSGYKDVILWFSFGASCFILLAIVMGLVFICVKNGNMRCTICI"
ORIGIN
1 atgaacactc aaatcctggt attcgctctg attgcgatca ttccaacaaa tgcagacaaa
61 atctgcctcg gacatcatgc cgtgtcaaac ggaaccaaag taaacacatt aactgaaaga
121 ggagtggaag tcgtcaatgc aactgaaaca gtggaacgaa caaacatccc caggatctgc
181 tcaaaaggga aaaggacagt tgacctcggt caatgtggac tcctggggac aatcactgga
241 ccacctcaat gtgaccaatt cctagaattt tcagccgatt taattattga gaggcgagaa
301 ggaagtgatg tctgttatcc tgggaaattc gtgaatgaag aagctctgag gcaaattctc
361 agagaatcag gcggaattga caaggaagca atgggattca catacagtgg aataagaact
421 aatggagcaa ccagtgcatg taggagatca ggatcttcat tctatgcaga aatgaaatgg
481 ctcctgtcaa acacagataa tgctgcattc ccgcagatga ctaagtcata taaaaataca
541 agaaaaagcc cagctctaat agtatggggg atccatcatt ccgtatcaac tgcagagcaa
601 accaagctat atgggagtgg aaacaaactg gtgacagttg ggagttctaa ttatcaacaa
661 tcttttgtac cgagtccagg agcgagacca caagttaatg gtatatctgg aagaattgac
721 tttcattggc taatgctaaa tcccaatgat acagtcactt tcagtttcaa tggggctttc
781 atagctccag accgtgcaag cttcctgaga ggaaaatcta tgggaatcca gagtggagta
841 caggttgatg ccaattgtga aggggactgc tatcatagtg gagggacaat aataagtaac
901 ttgccatttc agaacataga tagcagggca gttggaaaat gtccgagata tgttaagcaa
961 aggagtctgc tgctagcaac agggatgaag aatgttcctg agattccaaa gggaagaggc
1021 ctatttggtg ctatagcggg tttcattgaa aatggatggg aaggcctaat tgatggttgg
1081 tatggtttca gacaccagaa tgcacaggga gagggaactg ctgcagatta caaaagcact
1141 caatcggcaa ttgatcaaat aacaggaaaa ttaaaccggc ttatagaaaa aaccaaccaa
1201 caatttgagt tgatcgacaa tgaattcaat gaggtagaga agcaaatcgg taatgtgata
1261 aattggacca gagattctat aacagaagtg tggtcataca atgctgaact cttggtagca
1321 atggagaacc agcatacaat tgatctggct gattcagaaa tggacaaact gtacgaacga
1381 gtgaaaagac agctgagaga gaatgctgaa gaagatggca ctggttgctt tgaaatattt
1441 cacaagtgtg atgatgactg tatggccagt attagaaata acacctatga tcacagcaaa
1501 tacagggaag aggcaatgca aaatagaata cagattgacc cagtcaaact aagcagcggc
1561 tacaaagatg tgatactttg gtttagcttc ggggcatcat gtttcatact tctagccatt
1621 gtaatgggcc ttgtcttcat atgtgtaaag aatggaaaca tgcggtgcac tatttgtata
1681 taa

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Mon Apr 29, 2013 10:25 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
Isolate detail
Isolate name:

A/Jiangsu/01/2013

Isolate ID:

EPI_ISL_139651
Passage details/history:

E1
Type:

A / H7N9
Lineage:



Sample information

Collection date:

2013-03-30
Host

Human
Additional host information:


Zip code:


Patient status:


Last vaccinated:


In-vivo pathogenicity test:


Location:

China / Jiangsu Provice
Additional location information:


Patient age:

45 Year(s)
Gender:

Female
Outbreak:


Treatment:


Specimen source:




Institute information

Originating lab:

Sample ID given by the sample provider:


Address:



Submitting lab:
WHO Chinese National Influenza Center
Sample ID given by the submitting laboratory:


Authors:

Address:
WHO Chinese National Influenza Center
Virology Institute, Chinese CDC
100 Yingxin Jie, Xuanwu Qu,
Beijing 100052
China


Publication
Publication


In vivo antiviral resistance

Phenotype Genotype Unspecified Antiviral resistance tested by experimental procedures
Adamantanes:

Unknown
Oseltamivir:

Unknown
Zanamivir:

Unknown
Peramivir:

Unknown
Other:

Unknown

Antiviral resistance tested by sequence prediction
Adamantanes:

Resistant
Oseltamivir:

Unknown
Zanamivir:

Unknown
Peramivir:

Unknown
Other:

Unknown
Antiviral resistance tested by unknown method
Adamantanes:

Unknown
Oseltamivir:

Unknown
Zanamivir:

Unknown
Peramivir:

Unknown
Other:

Unknown

Additional information
Antigenic characterization:


Note:


Sequence

segment identifier length accession # INSDC Sequence
HA A/Jiangsu/01/2013 1683 EPI443028
NA A/Jiangsu/01/2013 1398 EPI443029
MP A/Jiangsu/01/2013 982 EPI443030

Submitter information

Submitter:

Yang, Lei
Submission Date:

2013-04-27
Last modifier:

Yang, Lei
Last modified:

2013-04-27
Address:
WHO Chinese National Influenza Center
Virology Institute, Chinese CDC
100 Yingxin Jie, Xuanwu Qu,
Beijing 100052
China

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Mon Apr 29, 2013 10:26 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
Isolate name:

A/Zhejiang/1/2013

Isolate ID:

EPI_ISL_139652
Passage details/history:


Type:

A / H7N9
Lineage:



Sample information

Collection date:

2013-03-24
Host

Human
Additional host information:


Zip code:


Patient status:


Last vaccinated:


In-vivo pathogenicity test:


Location:

China
Additional location information:

Zhejiang
Patient age:

37 Year(s)
Gender:

Male
Outbreak:


Treatment:


Specimen source:




Institute information

Originating lab:
Zhejiang Provincial Center for Disease Control and Prevention
Sample ID given by the sample provider:

ZJ-201304001
Address:
Zhejiang Provincial Center for Disease Control and Prevention
3399 Binsheng Road, Binjiang District,
Hangzhou 310000
China


Submitting lab:
Zhejiang Provincial Center for Disease Control and Prevention
Sample ID given by the submitting laboratory:

ZJH7-2013001
Authors:
Sun, Y;
Zhang, YJ
Address:
Zhejiang Provincial Center for Disease Control and Prevention
3399 Binsheng Road, Binjiang District,
Hangzhou 310000
China


Publication
Publication


In vivo antiviral resistance

Phenotype Genotype Unspecified Antiviral resistance tested by experimental procedures
Adamantanes:

Unknown
Oseltamivir:

Unknown
Zanamivir:

Unknown
Peramivir:

Unknown
Other:

Unknown

Antiviral resistance tested by sequence prediction
Adamantanes:

Resistant
Oseltamivir:

Sensitive
Zanamivir:

Sensitive
Peramivir:

Unknown
Other:

Unknown
Antiviral resistance tested by unknown method
Adamantanes:

Unknown
Oseltamivir:

Unknown
Zanamivir:

Unknown
Peramivir:

Unknown
Other:

Unknown

Additional information
Antigenic characterization:


Note:


Sequence

segment identifier length accession # INSDC Sequence
PB2 ZJH7-201301PB2 2280 EPI443031
PB1 ZJH7-201301PB1 2274 EPI443032
PA ZJH7-201301PA 2151 EPI443033
HA ZJH7-201301HA 1683 EPI443034
NP ZJH7-201301NP 1497 EPI443035
NA ZJH7-201301NA 1398 EPI443036
MP ZJH7-201301MP 982 EPI443037
NS ZJH7-201301NS 838 EPI443038

Submitter information

Submitter:

Sun, Yi
Submission Date:

2013-04-28
Last modifier:

Sun, Yi
Last modified:

2013-04-28
Address:
Zhejiang Provincial Center for Disease Control and Prevention
3399 Binsheng Road, Binjiang District,
Hangzhou 310000
China

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Mon Apr 29, 2013 10:30 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
L703A (L226I) up

EPI443034 A/Zhejiang/1/2013 (A/H7N9) segment 4 (HA) 28.8 2.834385e+00 15/15 (100%)
EPI443028 A/Jiangsu/01/2013 (A/H7N9) segment 4 (HA) 28.8 2.834385e+00 15/15 (100%)
EPI440095 A/Hangzhou/1/2013 (A/H7N9) segment 4 (HA) 28.8 2.834385e+00 15/15 (100%)

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Mon Apr 29, 2013 10:31 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
C703A (L226I) down
EPI443034 A/Zhejiang/1/2013 (A/H7N9) segment 4 (HA) 28.8 2.834385e+00 15/15 (100%)
EPI443028 A/Jiangsu/01/2013 (A/H7N9) segment 4 (HA) 28.8 2.834385e+00 15/15 (100%)
EPI440095 A/Hangzhou/1/2013 (A/H7N9) segment 4 (HA) 28.8 2.834385e+00 15/15 (100%)

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Mon Apr 29, 2013 10:31 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
A1215C up

EPI443034 A/Zhejiang/1/2013 (A/H7N9) segment 4 (HA) 28.8 2.834385e+00 15/15 (100%)
EPI443028 A/Jiangsu/01/2013 (A/H7N9) segment 4 (HA) 28.8 2.834385e+00 15/15 (100%)
EPI440095 A/Hangzhou/1/2013 (A/H7N9) segment 4 (HA) 28.8 2.834385e+00 15/15 (100%)

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Mon Apr 29, 2013 10:32 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
A1215C down
EPI443034 A/Zhejiang/1/2013 (A/H7N9) segment 4 (HA) 28.8 2.834385e+00 15/15 (100%)
EPI443028 A/Jiangsu/01/2013 (A/H7N9) segment 4 (HA) 28.8 2.834385e+00 15/15 (100%)
EPI440095 A/Hangzhou/1/2013 (A/H7N9) segment 4 (HA) 28.8 2.834385e+00 15/15 (100%)

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Mon Apr 29, 2013 10:32 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
A409C up
EPI443036 A/Zhejiang/1/2013 (A/H7N9) segment 6 (NA) 28.8 2.834385e+00 15/15 (100%)
EPI443029 A/Jiangsu/01/2013 (A/H7N9) segment 6 (NA) 28.8 2.834385e+00 15/15 (100%)
EPI440096 A/Hangzhou/1/2013 (A/H7N9) segment 6 (NA) 28.8 2.834385e+00 15/15 (100%)

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Mon Apr 29, 2013 10:32 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
A409C down

EPI443036 A/Zhejiang/1/2013 (A/H7N9) segment 6 (NA) 28.8 2.834385e+00 15/15 (100%)
EPI443029 A/Jiangsu/01/2013 (A/H7N9) segment 6 (NA) 28.8 2.834385e+00 15/15 (100%)
EPI440096 A/Hangzhou/1/2013 (A/H7N9) segment 6 (NA) 28.8 2.834385e+00 15/15 (100%)

_________________
www.twitter.com/hniman


Top
 Profile  
 
Display posts from previous:  Sort by  
Post new topic Reply to topic  [ 50 posts ]  Go to page 1, 2, 3, 4, 5  Next

All times are UTC - 5 hours [ DST ]


Who is online

Users browsing this forum: Google [Bot] and 51 guests


You cannot post new topics in this forum
You cannot reply to topics in this forum
You cannot edit your posts in this forum
You cannot delete your posts in this forum
You cannot post attachments in this forum

Search for:
Jump to:  
cron
Powered by phpBB® Forum Software © phpBB Group