Rhiza Labs FluTracker Forum

The place to discuss the flu
It is currently Wed Oct 01, 2014 1:57 am

All times are UTC - 5 hours [ DST ]




Post new topic Reply to topic  [ 14 posts ]  Go to page 1, 2  Next
Author Message
PostPosted: Thu Jan 31, 2013 6:34 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 44581
Location: Pittsburgh, PA USA
UC Davis Vet School has released a full set of H1N1pdm09 sequnces from two 2010 collections from Elephant Seals off the coast of California.

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Thu Jan 31, 2013 6:35 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 44581
Location: Pittsburgh, PA USA
JX865419 Seal 1 H1N1 USA 2010/05 2267 Influenza A virus (A/Elephant seal/California/1/2010(H1N1)) p
JX865420 Seal 2 H1N1 USA 2010/05 2267 Influenza A virus (A/Elephant seal/California/1/2010(H1N1)) p
JX865421 Seal 3 H1N1 USA 2010/05 2152 Influenza A virus (A/Elephant seal/California/1/2010(H1N1)) nc
JX865422 Seal 4 H1N1 USA 2010/05 1711 Influenza A virus (A/Elephant seal/California/1/2010(H1N1)) nc
JX865423 Seal 5 H1N1 USA 2010/05 1507 Influenza A virus (A/Elephant seal/California/1/2010(H1N1)) nc
JX865424 Seal 6 H1N1 USA 2010/05 1400 Influenza A virus (A/Elephant seal/California/1/2010(H1N1)) p
JX865425 Seal 7 H1N1 USA 2010/05 757 Influenza A virus (A/Elephant seal/California/1/2010(H1N1)) p
JX865426 Seal 8 H1N1 USA 2010/05 670 Influenza A virus (A/Elephant seal/California/1/2010(H1N1)) p

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Thu Jan 31, 2013 6:36 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 44581
Location: Pittsburgh, PA USA
LOCUS JX865422 1711 bp cRNA linear VRL 30-JAN-2013
DEFINITION Influenza A virus (A/Elephant seal/California/1/2010(H1N1)) segment
4 hemagglutinin (HA) gene, partial cds.
ACCESSION JX865422
VERSION JX865422.1 GI:409194247
KEYWORDS .
SOURCE Influenza A virus (A/Elephant seal/California/1/2010(H1N1))
ORGANISM Influenza A virus (A/Elephant seal/California/1/2010(H1N1))
Viruses; ssRNA negative-strand viruses; Orthomyxoviridae;
Influenzavirus A.
REFERENCE 1 (bases 1 to 1711)
AUTHORS Goldstein,T., Mena,I., Anthony,S.J., Medina,R., Robinson,P.W.,
Greig,D.J., Costa,D.P., Lipkin,W.I., Garcia-Sastre,A. and
Boyce,W.M.
TITLE Pandemic H1N1 Isolated from Free-Ranging Northern Elephant Seals in
2010 off the Central California Coast
JOURNAL Unpublished
REFERENCE 2 (bases 1 to 1711)
AUTHORS Goldstein,T., Mena,I., Anthony,S.J., Medina,R., Robinson,P.W.,
Greig,D.J., Costa,D.P., Lipkin,W.I. and Boyce,W.M.
TITLE Direct Submission
JOURNAL Submitted (25-SEP-2012) Wildlife Health Center, School of
Veterinary Medicine, University of California, Davis, One Shields
Ave, Davis, CA 95616, USA
COMMENT GenBank Accession Numbers JX865419-JX865426 represent sequences
from the 8 segments of Influenza A virus (A/Elephant
seal/California/1/2010(H1N1)).

##Assembly-Data-START##
Sequencing Technology :: Sanger dideoxy sequencing
##Assembly-Data-END##
FEATURES Location/Qualifiers
source 1..1711
/organism="Influenza A virus (A/Elephant
seal/California/1/2010(H1N1))"
/mol_type="viral cRNA"
/strain="A/Elephant seal/California/1/2010"
/serotype="H1N1"
/isolation_source="nasal swab"
/host="Mirounga angustirostris (Northern elephant seal)"
/db_xref="taxon:1235806"
/segment="4"
/country="USA"
/collection_date="May-2010"
gene 14..>1711
/gene="HA"
CDS 14..>1711
/gene="HA"
/codon_start=1
/product="hemagglutinin"
/protein_id="AFV31454.1"
/db_xref="GI:409194248"
/translation="MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVT
HSVNLLEDKHNGKLCKLRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETSSS
DNGTCYPGDFIDYEELREQLSSVSSFERFEIFPKTSSWPNHDPNKGVTAACPHAGAKS
FYKNLIWLVKKGNSYPKLSKSYINDKGKEVLVLWGIHHPSTSADQQSLYQNADAYVFV
GTSRYSKKFKPEIAIRPKVRNQEGRMNYYWTLVEPGDKITFEATGNLVVPRYAFAMER
NAGSGIIISDTPVHDCNTTCQTPKGAINTSLPFQNIHPITIGKCPKYVKSTKLRLATG
LRNVPSIQSRGLFGAIAGFIEGGWTGMVDGWYGYHHQNEQGSGYAADLKSTQNAIDKI
TNKVNSVIEKMNTQFTAVGKEFNHLEKRIENLNKKVDDGFLDIWTYNAELLVLLENER
TLDYHDSNVKNLYEKVRSQLKNNAKEIGNGCFEFYHKCDNTCMESVKNGTYDYPKYSE
EAKLNREEIDGVKLESTRIYQILAIYSTVASSLVLVVSLGAISFWMCSNGSLQCRICI
"
ORIGIN
1 aaaagcaaca aaaatgaagg caatactagt agttctgcta tatacatttg caaccgcaaa
61 tgcagacaca ttatgtatag gttatcatgc gaacaattca acagacactg tagacacagt
121 actagaaaag aatgtaacag taacacactc tgttaacctt ctagaagaca agcataacgg
181 gaaactatgc aaactaagag gggtagcccc attgcatttg ggtaaatgta acattgctgg
241 ctggatcctg ggaaatccag agtgtgaatc actctccaca gcaagctcat ggtcctacat
301 tgtggaaaca tctagttcag acaatggaac gtgttaccca ggagatttca tcgattatga
361 ggagctaaga gagcaattga gctcagtgtc atcatttgaa aggtttgaga tattccccaa
421 gacaagttca tggcccaatc atgacccgaa caaaggtgta acggcagcat gtcctcatgc
481 tggagcaaaa agcttctaca aaaatttaat atggctagtt aaaaaaggaa attcataccc
541 aaagctcagc aaatcctaca ttaatgataa agggaaagaa gtcctcgtgc tatggggcat
601 tcaccatcca tctactagtg ctgaccaaca aagtctctat cagaatgcag atgcatatgt
661 ttttgtgggg acatcaagat acagcaagaa gttcaagcca gaaatagcaa taagacccaa
721 agtgaggaat caagaaggga gaatgaacta ttactggaca ctagtagagc cgggagacaa
781 aataacattc gaagcaactg gaaatctagt ggtaccgaga tatgcattcg caatggaaag
841 aaatgctgga tctggtatta tcatttcaga tacaccagtc cacgattgca atacaacttg
901 tcagacaccc aagggtgcta taaacaccag cctcccattt cagaatatac atccgatcac
961 aattggaaaa tgtccaaaat atgtaaaaag cacaaaattg agactggcca caggattgag
1021 gaatgtcccg tctattcaat ctagaggcct atttggggcc attgccggtt tcattgaagg
1081 gggatggaca gggatggtag atggatggta cggttatcac catcaaaatg agcaggggtc
1141 aggatatgca gccgacctga agagcacaca gaatgccatt gacaagatta ctaacaaagt
1201 aaattctgtt attgaaaaga tgaatacaca gttcacagca gtaggtaaag agttcaacca
1261 cctggaaaaa agaatagaga atttaaataa aaaagttgat gatggtttcc tggacatttg
1321 gacttacaat gccgaactgt tggttctatt ggaaaatgaa agaactttgg actaccacga
1381 ttcaaatgtg aagaacttat atgaaaaggt aagaagccag ttaaaaaaca atgccaagga
1441 aattggaaac ggctgctttg aattttacca caaatgcgat aacacgtgca tggaaagtgt
1501 caaaaatggg acttatgact acccaaaata ctcagaggaa gcaaaattaa acagagaaga
1561 aatagatggg gtaaagctgg aatcaacaag gatttaccag attttggcga tctattcaac
1621 tgtcgccagt tcattggtac tggtagtctc cctgggggca atcagtttct ggatgtgctc
1681 taatgggtct ctacagtgta gaatatgtat t

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Thu Jan 31, 2013 6:36 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 44581
Location: Pittsburgh, PA USA
EPI416775 A/elephant seal/California/2/2010 (A/H1N1) segment 4 (HA) 3136.7 0.000000e+00 1698/1698 (100%)
EPI416757 A/Elephant seal/California/1/2010 (A/H1N1) segment 4 (HA) 3136.7 0.000000e+00 1698/1698 (100%)
EPI327199 A/Goias/16651/2010 (A/H1N1) segment 4 (HA) 3120.1 0.000000e+00 1695/1698 (99%)
EPI258108 A/Guangxi-Jiangzhou/SWL151/2010 (A/H1N1 pdm09) segment 4 (HA) 3120.1 0.000000e+00 1695/1698 (99%)
EPI258004 A/Shanghai-Pudongxin/SWL181/2010 (A/H1N1 pdm09) segment 4 (HA) 3120.1 0.000000e+00 1695/1698 (99%)
EPI252738 A/Texas/JMS358/2009 (A/H1N1 pdm09) segment 4 (HA) 3120.1 0.000000e+00 1695/1698 (99%)
EPI392428 A/Scotland/EastKilbride_420881/2009 (A/H1N1) segment 4 (HA) 3114.6 0.000000e+00 1694/1698 (99%)
EPI392420 A/Scotland/EastKilbride_420880/2009 (A/H1N1) segment 4 (HA) 3114.6 0.000000e+00 1694/1698 (99%)
EPI392413 A/Scotland/EastKilbride_420875/2009 (A/H1N1) segment 4 (HA) 3114.6 0.000000e+00 1694/1698 (99%)
EPI392407 A/Scotland/EastKilbride_420874/2009 (A/H1N1) segment 4 (HA) 3114.6 0.000000e+00 1694/1698 (99%)
EPI385955 A/Guangdong/1105/2009 (A/H1N1) segment 4 (HA) 3114.6 0.000000e+00 1694/1698 (99%)
EPI382334 A/Taiwan/65052/2010 (A/H1N1) segment 4 (HA) 3114.6 0.000000e+00 1694/1698 (99%)
EPI382323 A/Taiwan/97184/2009 (A/H1N1) segment 4 (HA) 3114.6 0.000000e+00 1694/1698 (99%)
EPI382317 A/Taiwan/99721/2009 (A/H1N1) segment 4 (HA) 3114.6 0.000000e+00 1694/1698 (99%)
EPI382316 A/Taiwan/99666/2009 (A/H1N1) segment 4 (HA) 3114.6 0.000000e+00 1694/1698 (99%)
EPI382306 A/Taiwan/90230/2009 (A/H1N1) segment 4 (HA) 3114.6 0.000000e+00 1694/1698 (99%)
EPI382295 A/Taiwan/98031/2009 (A/H1N1) segment 4 (HA) 3114.6 0.000000e+00 1694/1698 (99%)
EPI382111 A/Gunma/293/2009 (A/H1N1 pdm09) segment 4 (HA) 3114.6 0.000000e+00 1694/1698 (99%)
EPI379229 A/Singapore/GP3733/2009 (A/H1N1) segment 4 (HA) 3114.6 0.000000e+00 1694/1698 (99%)
EPI374055 A/Malaysia/2082543/2009 (A/H1N1) segment 4 (HA) 3114.6 0.000000e+00 1694/1698 (99%)
EPI360085 A/Tianjinninghe/SWL49/2009 (A/H1N1 pdm09) segment 4 (HA) 3114.6 0.000000e+00 1694/1698 (99%)
EPI354382 A/India/Blore/2010 (A/H1N1 pdm09) segment 4 (HA) 3114.6 0.000000e+00 1694/1698 (99%)
EPI351158 A/Zhejiang/92/2009 (A/H1N1 pdm09) segment 4 (HA) 3114.6 0.000000e+00 1694/1698 (99%)
EPI351140 A/Zhejiang/9/2009 (A/H1N1 pdm09) segment 4 (HA) 3114.6 0.000000e+00 1694/1698 (99%)
EPI351064 A/Zhejiang/80/2009 (A/H1N1 pdm09) segment 4 (HA) 3114.6 0.000000e+00 1694/1698 (99%)
EPI349516 A/Taiwan/6078/2009 (A/H1N1 pdm09) segment 4 (HA) 3114.6 0.000000e+00 1694/1698 (99%)
EPI348131 A/Shenzhen/40-SZCDC/2009 (A/H1N1 pdm09) segment 4 (HA) 3114.6 0.000000e+00 1694/1698 (99%)
EPI348130 A/Shenzhen/38/2009 (A/H1N1 pdm09) segment 4 (HA) 3114.6 0.000000e+00 1694/1698 (99%)
EPI348120 A/Shenzhen/959/2009 (A/H1N1 pdm09) segment 4 (HA) 3114.6 0.000000e+00 1694/1698 (99%)
EPI348108 A/Shenzhen/1282/2009 (A/H1N1 pdm09) segment 4 (HA) 3114.6 0.000000e+00 1694/1698 (99%)
EPI348105 A/Shenzhen/74/2009 (A/H1N1 pdm09) segment 4 (HA) 3114.6 0.000000e+00 1694/1698 (99%)
EPI347995 A/Shenzhen/43/2009 (A/H1N1 pdm09) segment 4 (HA) 3114.6 0.000000e+00 1694/1698 (99%)
EPI347993 A/Shenzhen/39/2009 (A/H1N1 pdm09) segment 4 (HA) 3114.6 0.000000e+00 1694/1698 (99%)
EPI347973 A/Shenzhen/1447/2009 (A/H1N1 pdm09) segment 4 (HA) 3114.6 0.000000e+00 1694/1698 (99%)
EPI347966 A/Shenzhen/75/2009 (A/H1N1 pdm09) segment 4 (HA) 3114.6 0.000000e+00 1694/1698 (99%)
EPI336536 A/England/616/2009 (A/H1N1 pdm09) segment 4 (HA) 3114.6 0.000000e+00 1694/1698 (99%)
EPI336392 A/England/738/2009 (A/H1N1 pdm09) segment 4 (HA) 3114.6 0.000000e+00 1694/1698 (99%)
EPI336341 A/Scotland/94420029/2009 (A/H1N1 pdm09) segment 4 (HA) 3114.6 0.000000e+00 1694/1698 (99%)
EPI336326 A/England/829/2009 (A/H1N1 pdm09) segment 4 (HA) 3114.6 0.000000e+00 1694/1698 (99%)
EPI336325 A/England/827/2009 (A/H1N1 pdm09) segment 4 (HA) 3114.6 0.000000e+00 1694/1698 (99%)
EPI336315 A/England/834/2009 (A/H1N1 pdm09) segment 4 (HA) 3114.6 0.000000e+00 1694/1698 (99%)
EPI336243 A/England/906/2009 (A/H1N1 pdm09) segment 4 (HA) 3114.6 0.000000e+00 1694/1698 (99%)
EPI336221 A/England/95060207/2009 (A/H1N1 pdm09) segment 4 (HA) 3114.6 0.000000e+00 1694/1698 (99%)
EPI336127 A/England/911/2009 (A/H1N1 pdm09) segment 4 (HA) 3114.6 0.000000e+00 1694/1698 (99%)
EPI335991 A/Shanghai/1744T/2009 (A/H1N1) segment 4 (HA) 3114.6 0.000000e+00 1694/1698 (99%)
EPI323655 A/England/862/2009 (A/H1N1 pdm09) segment 4 (HA) 3114.6 0.000000e+00 1694/1698 (99%)
EPI323631 A/England/1111/2009 (A/H1N1 pdm09) segment 4 (HA) 3114.6 0.000000e+00 1694/1698 (99%)
EPI320700 A/Nanchang/8009/2009 (A/H1N1) segment 4 (HA) 3114.6 0.000000e+00 1694/1698 (99%)
EPI313249 A/Hong Kong/433397/2009 (A/H1N1) segment 4 (HA) 3114.6 0.000000e+00 1694/1698 (99%)
EPI308865 A/San Diego/INS194/2009 (A/H1N1) segment 4 (HA) 3114.6 0.000000e+00 1694/1698 (99%)
EPI308613 A/Terrassa/INS94/2009 (A/H1N1) segment 4 (HA) 3114.6 0.000000e+00 1694/1698 (99%)
EPI302574 A/Thailand/C602/2010 (A/H1N1) segment 4 (HA) 3114.6 0.000000e+00 1694/1698 (99%)
EPI297199 A/Sendai/TU1004/2009 (A/H1N1 pdm09) segment 4 (HA) 3114.6 0.000000e+00 1694/1698 (99%)
EPI297165 A/Sendai/TU502/2009 (A/H1N1 pdm09) segment 4 (HA) 3114.6 0.000000e+00 1694/1698 (99%)
EPI297157 A/Sendai/TU483/2009 (A/H1N1 pdm09) segment 4 (HA) 3114.6 0.000000e+00 1694/1698 (99%)
EPI281685 A/Alagoas/140/2010 (A/H1N1) segment 4 (HA) 3114.6 0.000000e+00 1694/1698 (99%)
EPI281057 A/Korea/CJ63/2009 (A/H1N1 pdm09) segment 4 (HA) 3114.6 0.000000e+00 1694/1698 (99%)
EPI276588 A/ENG/911/2009 (A/H1N1 pdm09) segment 4 (HA) 3114.6 0.000000e+00 1694/1698 (99%)
EPI276555 A/ENG/95060207/2009 (A/H1N1 pdm09) segment 4 (HA) 3114.6 0.000000e+00 1694/1698 (99%)
EPI276535 A/ENG/906/2009 (A/H1N1 pdm09) segment 4 (HA) 3114.6 0.000000e+00 1694/1698 (99%)
EPI276455 A/ENG/834/2009 (A/H1N1 pdm09) segment 4 (HA) 3114.6 0.000000e+00 1694/1698 (99%)
EPI276446 A/ENG/827/2009 (A/H1N1 pdm09) segment 4 (HA) 3114.6 0.000000e+00 1694/1698 (99%)
EPI276445 A/ENG/829/2009 (A/H1N1 pdm09) segment 4 (HA) 3114.6 0.000000e+00 1694/1698 (99%)
EPI276430 A/SC/94420029/2009 (A/H1N1 pdm09) segment 4 (HA) 3114.6 0.000000e+00 1694/1698 (99%)
EPI276379 A/ENG/738/2009 (A/H1N1 pdm09) segment 4 (HA) 3114.6 0.000000e+00 1694/1698 (99%)
EPI271499 A/San Diego/INS215/2009 (A/H1N1 pdm09) segment 4 (HA) 3114.6 0.000000e+00 1694/1698 (99%)
EPI270878 A/San Diego/INS202/2009 (A/H1N1 pdm09) segment 4 (HA) 3114.6 0.000000e+00 1694/1698 (99%)
EPI270575 A/California/VRDL127/2009 (A/H1N1 pdm09) segment 4 (HA) 3114.6 0.000000e+00 1694/1698 (99%)
EPI270495 A/California/VRDL117/2009 (A/H1N1 pdm09) segment 4 (HA) 3114.6 0.000000e+00 1694/1698 (99%)
EPI270423 A/California/VRDL108/2009 (A/H1N1 pdm09) segment 4 (HA) 3114.6 0.000000e+00 1694/1698 (99%)
EPI270005 A/Ulgii/9911/2009 (A/H1N1 pdm09) segment 4 (HA) 3114.6 0.000000e+00 1694/1698 (99%)
EPI269974 A/Perth/431/2009 (A/H1N1 pdm09) segment 4 (HA) 3114.6 0.000000e+00 1694/1698 (99%)
EPI267063 A/Xuchang/SWL48/2009 (A/H1N1 pdm09) segment 4 (HA) 3114.6 0.000000e+00 1694/1698 (99%)
EPI267061 A/Weidu/SWL51/2009 (A/H1N1 pdm09) segment 4 (HA) 3114.6 0.000000e+00 1694/1698 (99%)
EPI267056 A/Ruyang/SWL1606/2009 (A/H1N1 pdm09) segment 4 (HA) 3114.6 0.000000e+00 1694/1698 (99%)
EPI267055 A/Qingfeng/SWL43/2009 (A/H1N1 pdm09) segment 4 (HA) 3114.6 0.000000e+00 1694/1698 (99%)
EPI267054 A/Jinshui/SWL54/2009 (A/H1N1 pdm09) segment 4 (HA) 3114.6 0.000000e+00 1694/1698 (99%)
EPI266167 A/Hubei-Songzi/SWL160/2010 (A/H1N1 pdm09) segment 4 (HA) 3114.6 0.000000e+00 1694/1698 (99%)
EPI263491 A/Singapore/ON2193/2009 (A/H1N1 pdm09) segment 4 (HA) 3114.6 0.000000e+00 1694/1698 (99%)
EPI263483 A/Singapore/ON2063/2009 (A/H1N1 pdm09) segment 4 (HA) 3114.6 0.000000e+00 1694/1698 (99%)
EPI263481 A/Singapore/ON2018/2009 (A/H1N1 pdm09) segment 4 (HA) 3114.6 0.000000e+00 1694/1698 (99%)
EPI263421 A/Singapore/GP3491/2009 (A/H1N1 pdm09) segment 4 (HA) 3114.6 0.000000e+00 1694/1698 (99%)
EPI263414 A/Singapore/GP3084/2009 (A/H1N1 pdm09) segment 4 (HA) 3114.6 0.000000e+00 1694/1698 (99%)
EPI258758 A/San Diego/INS74/2009 (A/H1N1 pdm09) segment 4 (HA) 3114.6 0.000000e+00 1694/1698 (99%)
EPI258180 A/Guangxi-Xixiangtang/SWL118/2010 (A/H1N1 pdm09) segment 4 (HA) 3114.6 0.000000e+00 1694/1698 (99%)
EPI258076 A/Xinjiang-Hutubi/SWL118/2010 (A/H1N1 pdm09) segment 4 (HA) 3114.6 0.000000e+00 1694/1698 (99%)
EPI258068 A/Xinjiang-Hutubi/SWL115/2010 (A/H1N1 pdm09) segment 4 (HA) 3114.6 0.000000e+00 1694/1698 (99%)
EPI257752 A/Zhejiang-Xiacheng/SWL167/2010 (A/H1N1 pdm09) segment 4 (HA) 3114.6 0.000000e+00 1694/1698 (99%)
EPI257632 A/Liaoning-Heping/SWL116/2010 (A/H1N1 pdm09) segment 4 (HA) 3114.6 0.000000e+00 1694/1698 (99%)
EPI257424 A/Jiangsu-Pingjiang/SWL1567/2009 (A/H1N1 pdm09) segment 4 (HA) 3114.6 0.000000e+00 1694/1698 (99%)
EPI257356 A/Shandong-Shizhong/SWL1850/2009 (A/H1N1 pdm09) segment 4 (HA) 3114.6 0.000000e+00 1694/1698 (99%)
EPI257348 A/Hunan-Yuhua/SWL11707/2009 (A/H1N1 pdm09) segment 4 (HA) 3114.6 0.000000e+00 1694/1698 (99%)
EPI257276 A/Fujian-Gulou/SWL11951/2009 (A/H1N1 pdm09) segment 4 (HA) 3114.6 0.000000e+00 1694/1698 (99%)
EPI257268 A/Guangdong-Yuexiu/SWL11552/2009 (A/H1N1 pdm09) segment 4 (HA) 3114.6 0.000000e+00 1694/1698 (99%)
EPI256570 A/Henan-Qingfeng/SWL43/2009 (A/H1N1 pdm09) segment 4 (HA) 3114.6 0.000000e+00 1694/1698 (99%)
EPI256506 A/Liaoning-Huanggu/SWL11020/2009 (A/H1N1 pdm09) segment 4 (HA) 3114.6 0.000000e+00 1694/1698 (99%)
EPI256498 A/Guangdong-Luohu/SWL1792/2009 (A/H1N1 pdm09) segment 4 (HA) 3114.6 0.000000e+00 1694/1698 (99%)
EPI256326 A/Shanxi-Chengqu/SWL581/2009 (A/H1N1 pdm09) segment 4 (HA) 3114.6 0.000000e+00 1694/1698 (99%)
EPI256322 A/Shanxi-Chengqu/SWL563/2009 (A/H1N1 pdm09) segment 4 (HA) 3114.6 0.000000e+00 1694/1698 (99%)
EPI256290 A/Shanxi-Chengqu/SWL1727/2009 (A/H1N1 pdm09) segment 4 (HA) 3114.6 0.000000e+00 1694/1698 (99%)
EPI256234 A/Shanxi-Xinghualing/SWL1480/2009 (A/H1N1 pdm09) segment 4 (HA) 3114.6 0.000000e+00 1694/1698 (99%)
EPI256230 A/Gansu-Linxia/SWL1259/2009 (A/H1N1 pdm09) segment 4 (HA) 3114.6 0.000000e+00 1694/1698 (99%)
EPI256194 A/Xinjiang-Kuitun/SWL314/2009 (A/H1N1 pdm09) segment 4 (HA) 3114.6 0.000000e+00 1694/1698 (99%)
EPI256190 A/Xinjiang-Kuitun/SWL39/2009 (A/H1N1 pdm09) segment 4 (HA) 3114.6 0.000000e+00 1694/1698 (99%)
EPI256054 A/Beijing-Xicheng/SWL11336/2009 (A/H1N1 pdm09) segment 4 (HA) 3114.6 0.000000e+00 1694/1698 (99%)
EPI255323 A/swine/Hong Kong/NS1583/2009 (A/H1N1 pdm09) segment 4 (HA) 3114.6 0.000000e+00 1694/1698 (99%)
EPI255275 A/swine/Hong Kong/2299/2009 (A/H1N1 pdm09) segment 4 (HA) 3114.6 0.000000e+00 1694/1698 (99%)
EPI254706 A/California/VRDL80/2009 (A/H1N1 pdm09) segment 4 (HA) 3114.6 0.000000e+00 1694/1698 (99%)
EPI254551 A/India/4725/2009 (A/H1N1 pdm09) segment 4 (HA) 3114.6 0.000000e+00 1694/1698 (99%)
EPI254069 A/New York/6806/2009 (A/H1N1 pdm09) segment 4 (HA) 3114.6 0.000000e+00 1694/1698 (99%)
EPI253843 A/Saarland/16/2009 (A/H1N1 pdm09) segment 4 (HA) 3114.6 0.000000e+00 1694/1698 (99%)
EPI253518 A/Beijing/SWL18/2009 (A/H1N1 pdm09) segment 4 (HA) 3114.6 0.000000e+00 1694/1698 (99%)
EPI253470 A/Xinjiang/SWL1/2009 (A/H1N1 pdm09) segment 4 (HA) 3114.6 0.000000e+00 1694/1698 (99%)
EPI253454 A/Xizang/SWL2/2009 (A/H1N1 pdm09) segment 4 (HA) 3114.6 0.000000e+00 1694/1698 (99%)
EPI253446 A/Xizang/SWL1/2009 (A/H1N1 pdm09) segment 4 (HA) 3114.6 0.000000e+00 1694/1698 (99%)
EPI252666 A/Texas/46221665/2009 (A/H1N1 pdm09) segment 4 (HA) 3114.6 0.000000e+00 1694/1698 (99%)
EPI252610 A/San Diego/INS102/2009 (A/H1N1 pdm09) segment 4 (HA) 3114.6 0.000000e+00 1694/1698 (99%)
EPI252578 A/New York/6772/2009 (A/H1N1 pdm09) segment 4 (HA) 3114.6 0.000000e+00 1694/1698 (99%)
EPI249670 A/Texas/46182018/2009 (A/H1N1 pdm09) segment 4 (HA) 3114.6 0.000000e+00 1694/1698 (99%)
EPI247994 A/Wisconsin/629-D00834/2009 (A/H1N1 pdm09) segment 4 (HA) 3114.6 0.000000e+00 1694/1698 (99%)
EPI247641 A/New York/5161/2009 (A/H1N1 pdm09) segment 4 (HA) 3114.6 0.000000e+00 1694/1698 (99%)
EPI247028 A/Wisconsin/629-D02133/2009 (A/H1N1 pdm09) segment 4 (HA) 3114.6 0.000000e+00 1694/1698 (99%)
EPI246972 A/San Diego/INS61/2009 (A/H1N1 pdm09) segment 4 (HA) 3114.6 0.000000e+00 1694/1698 (99%)
EPI246764 A/New York/6293/2009 (A/H1N1 pdm09) segment 4 (HA) 3114.6 0.000000e+00 1694/1698 (99%)
EPI246660 A/New York/5916/2009 (A/H1N1 pdm09) segment 4 (HA) 3114.6 0.000000e+00 1694/1698 (99%)
EPI245596 A/San Diego/INS52/2009 (A/H1N1 pdm09) segment 4 (HA) 3114.6 0.000000e+00 1694/1698 (99%)
EPI245556 A/San Diego/INS16/2009 (A/H1N1 pdm09) segment 4 (HA) 3114.6 0.000000e+00 1694/1698 (99%)
EPI245295 A/California/VRDL78/2009 (A/H1N1 pdm09) segment 4 (HA) 3114.6 0.000000e+00 1694/1698 (99%)
EPI245255 A/California/VRDL72/2009 (A/H1N1 pdm09) segment 4 (HA) 3114.6 0.000000e+00 1694/1698 (99%)
EPI244382 A/Malaysia/8860/2009 (A/H1N1 pdm09) segment 4 (HA) 3114.6 0.000000e+00 1694/1698 (99%)
EPI243717 A/California/42/2009 (A/H1N1 pdm09) segment 4 (HA) 3114.6 0.000000e+00 1694/1698 (99%)
EPI240609 A/SHIZUOKA/1380/2009 (A/H1N1 pdm09) segment 4 (HA) 3114.6 0.000000e+00 1694/1698 (99%)
EPI237310 A/California/VRDL70/2009 (A/H1N1 pdm09) segment 4 (HA) 3114.6 0.000000e+00 1694/1698 (99%)
EPI237278 A/California/VRDL67/2009 (A/H1N1 pdm09) segment 4 (HA) 3114.6 0.000000e+00 1694/1698 (99%)
EPI237262 A/California/VRDL64/2009 (A/H1N1 pdm09) segment 4 (HA) 3114.6 0.000000e+00 1694/1698 (99%)
EPI236494 A/ENG/616/2009 (A/H1N1 pdm09) segment 4 (HA) 3114.6 0.000000e+00 1694/1698 (99%)
EPI232926 A/HIROSHIMA/310/2009 (A/H1N1 pdm09) segment 4 (HA) 3114.6 0.000000e+00 1694/1698 (99%)
EPI231419 A/South Dakota/13/2009 (A/H1N1 pdm09) segment 4 (HA) 3114.6 0.000000e+00 1694/1698 (99%)
EPI226592 A/SHIGA/61/2009 (A/H1N1 pdm09) segment 4 (HA) 3114.6 0.000000e+00 1694/1698 (99%)
EPI226376 A/SAITAMA-C/88/2009 (A/H1N1 pdm09) segment 4 (HA) 3114.6 0.000000e+00 1694/1698 (99%)
EPI223712 A/Texas/45062584/2009 (A/H1N1 pdm09) segment 4 (HA) 3114.6 0.000000e+00 1694/1698 (99%)
EPI222816 A/Chita/01/2009 (A/H1N1 pdm09) segment 4 (HA) 3114.6 0.000000e+00 1694/1698 (99%)
EPI221069 A/California/38/2009 (A/H1N1 pdm09) segment 4 (HA) 3114.6 0.000000e+00 1694/1698 (99%)
EPI218354 A/Norway/3797/2009 (A/H1N1 pdm09) segment 4 (HA) 3114.6 0.000000e+00 1694/1698 (99%)
EPI218207 A/New York/4777/2009 (A/H1N1 pdm09) segment 4 (HA) 3114.6 0.000000e+00 1694/1698 (99%)
EPI217147 A/South Carolina/33/2009 (A/H1N1 pdm09) segment 4 (HA) 3114.6 0.000000e+00 1694/1698 (99%)
EPI217066 A/North Carolina/35/2009 (A/H1N1 pdm09) segment 4 (HA) 3114.6 0.000000e+00 1694/1698 (99%)
EPI213223 A/Sao Paulo/53845/2009 (A/H1N1 pdm09) segment 4 (HA) 3114.6 0.000000e+00 1694/1698 (99%)
EPI212274 A/Chengdu/54/2009 (A/H1N1 pdm09) segment 4 (HA) 3114.6 0.000000e+00 1694/1698 (99%)
EPI212273 A/Chengdu/47/2009 (A/H1N1 pdm09) segment 4 (HA) 3114.6 0.000000e+00 1694/1698 (99%)
EPI212267 A/Chengdu/39/2009 (A/H1N1 pdm09) segment 4 (HA) 3114.6 0.000000e+00 1694/1698 (99%)
EPI212262 A/Chengdu/33/2009 (A/H1N1 pdm09) segment 4 (HA) 3114.6 0.000000e+00 1694/1698 (99%)
EPI212261 A/Chengdu/31/2009 (A/H1N1 pdm09) segment 4 (HA) 3114.6 0.000000e+00 1694/1698 (99%)
EPI212256 A/Chengdu/21/2009 (A/H1N1 pdm09) segment 4 (HA) 3114.6 0.000000e+00 1694/1698 (99%)
EPI212249 A/Chengdu/14/2009 (A/H1N1 pdm09) segment 4 (HA) 3114.6 0.000000e+00 1694/1698 (99%)
EPI212246 A/Chengdu/06/2009 (A/H1N1 pdm09) segment 4 (HA) 3114.6 0.000000e+00 1694/1698 (99%)
EPI212240 A/Chengdu/03/2009 (A/H1N1 pdm09) segment 4 (HA) 3114.6 0.000000e+00 1694/1698 (99%)
EPI336240 A/England/94860684/2009 (A/H1N1 pdm09) segment 4 (HA) 3110.9 0.000000e+00 1693/1698 (99%)
EPI256118 A/Guangdong-Ruizhou/SWL1433/2009 (A/H1N1 pdm09) segment 4 (HA) 3110.9 0.000000e+00 1693/1698 (99%)
EPI243893 A/Taiwan/1127/2009 (A/H1N1 pdm09) segment 4 (HA) 3110.9 0.000000e+00 1693/1698 (99%)
EPI234597 A/KAGOSHIMA/92/2009 (A/H1N1 pdm09) segment 4 (HA) 3110.9 0.000000e+00 1693/1698 (99%)
EPI408183 A/Jeddah/3673/2010(H1N1) (A/H1N1) segment 4 (HA) 3109.0 0.000000e+00 1693/1698 (99%)
EPI408182 A/Jeddah/3670/2010(H1N1) (A/H1N1) segment 4 (HA) 3109.0 0.000000e+00 1693/1698 (99%)
EPI408178 A/Jeddah/3663/2010(H1N1) (A/H1N1) segment 4 (HA) 3109.0 0.000000e+00 1693/1698 (99%)
EPI408177 A/Jeddah/3647/2010(H1N1) (A/H1N1) segment 4 (HA) 3109.0 0.000000e+00 1693/1698 (99%)
EPI407407 A/India/GWL-02/2011 (A/H1N1) segment 4 (HA) 3109.0 0.000000e+00 1693/1698 (99%)
EPI405412 A/Viet Nam/13032002/2009 (A/H1N1) segment 4 (HA) 3109.0 0.000000e+00 1693/1698 (99%)
EPI403807 A/Northern Ireland/94940033/2009 (A/H1N1) segment 4 (HA) 3109.0 0.000000e+00 1693/1698 (99%)
EPI403791 A/Northern Ireland/94940020/2009 (A/H1N1) segment 4 (HA) 3109.0 0.000000e+00 1693/1698 (99%)
EPI403669 A/England/93320016/2009 (A/H1N1) segment 4 (HA) 3109.0 0.000000e+00 1693/1698 (99%)
EPI396368 A/England/393/2009 (A/H1N1 pdm09) segment 4 (HA) 3109.0 0.000000e+00 1693/1698 (99%)
EPI396108 A/England/271/2009 (A/H1N1 pdm09) segment 4 (HA) 3109.0 0.000000e+00 1693/1698 (99%)
EPI396092 A/England/260/2009 (A/H1N1 pdm09) segment 4 (HA) 3109.0 0.000000e+00 1693/1698 (99%)
EPI393990 A/Tottori/ST312/2009 (A/H1N1) segment 4 (HA) 3109.0 0.000000e+00 1693/1698 (99%)
EPI387318 A/Brazil/AVS07/2009 (A/H1N1) segment 4 (HA) 3109.0 0.000000e+00 1693/1698 (99%)
EPI387077 A/Scotland/Dumfries_425403/2009 (A/H1N1) segment 4 (HA) 3109.0 0.000000e+00 1693/1698 (99%)
EPI385952 A/Guangdong/1106/2009 (A/H1N1) segment 4 (HA) 3109.0 0.000000e+00 1693/1698 (99%)
EPI385951 A/Guangdong/1104/2009 (A/H1N1) segment 4 (HA) 3109.0 0.000000e+00 1693/1698 (99%)
EPI385501 A/Singapore/KK349/2010 (A/H1N1) segment 4 (HA) 3109.0 0.000000e+00 1693/1698 (99%)
EPI385295 A/Singapore/SS13/2010 (A/H1N1) segment 4 (HA) 3109.0 0.000000e+00 1693/1698 (99%)
EPI385230 A/Singapore/MM05/2010 (A/H1N1) segment 4 (HA) 3109.0 0.000000e+00 1693/1698 (99%)
EPI385222 A/Singapore/TT144/2010 (A/H1N1) segment 4 (HA) 3109.0 0.000000e+00 1693/1698 (99%)
EPI385166 A/Singapore/GP820/2010 (A/H1N1) segment 4 (HA) 3109.0 0.000000e+00 1693/1698 (99%)
EPI385131 A/Singapore/TT123/2010 (A/H1N1) segment 4 (HA) 3109.0 0.000000e+00 1693/1698 (99%)
EPI385114 A/Singapore/GP1040/2010 (A/H1N1) segment 4 (HA) 3109.0 0.000000e+00 1693/1698 (99%)
EPI385085 A/Singapore/GP811/2010 (A/H1N1) segment 4 (HA) 3109.0 0.000000e+00 1693/1698 (99%)
EPI385073 A/Singapore/GP720/2010 (A/H1N1) segment 4 (HA) 3109.0 0.000000e+00 1693/1698 (99%)
EPI384992 A/Singapore/GP205/2010 (A/H1N1) segment 4 (HA) 3109.0 0.000000e+00 1693/1698 (99%)
EPI384903 A/Singapore/GP256/2010 (A/H1N1) segment 4 (HA) 3109.0 0.000000e+00 1693/1698 (99%)
EPI383425 A/Anhui/1225/2010 (A/H1N1 pdm09) segment 4 (HA) 3109.0 0.000000e+00 1693/1698 (99%)
EPI382341 A/Taiwan/65337/2010 (A/H1N1) segment 4 (HA) 3109.0 0.000000e+00 1693/1698 (99%)
EPI382337 A/Taiwan/65211/2010 (A/H1N1) segment 4 (HA) 3109.0 0.000000e+00 1693/1698 (99%)
EPI382330 A/Taiwan/97487/2009 (A/H1N1) segment 4 (HA) 3109.0 0.000000e+00 1693/1698 (99%)
EPI382329 A/Taiwan/97394/2009 (A/H1N1) segment 4 (HA) 3109.0 0.000000e+00 1693/1698 (99%)
EPI382319 A/Taiwan/99867/2009 (A/H1N1) segment 4 (HA) 3109.0 0.000000e+00 1693/1698 (99%)
EPI382314 A/Taiwan/99502/2009 (A/H1N1) segment 4 (HA) 3109.0 0.000000e+00 1693/1698 (99%)
EPI382313 A/Taiwan/99422/2009 (A/H1N1) segment 4 (HA) 3109.0 0.000000e+00 1693/1698 (99%)
EPI382311 A/Taiwan/99334/2009 (A/H1N1) segment 4 (HA) 3109.0 0.000000e+00 1693/1698 (99%)
EPI382309 A/Taiwan/99144/2009 (A/H1N1) segment 4 (HA) 3109.0 0.000000e+00 1693/1698 (99%)
EPI382294 A/Taiwan/97888/2009 (A/H1N1) segment 4 (HA) 3109.0 0.000000e+00 1693/1698 (99%)
EPI382291 A/Taiwan/90060/2009 (A/H1N1) segment 4 (HA) 3109.0 0.000000e+00 1693/1698 (99%)
EPI382290 A/Taiwan/90052/2009 (A/H1N1) segment 4 (HA) 3109.0 0.000000e+00 1693/1698 (99%)
EPI382287 A/Taiwan/71433/2009 (A/H1N1) segment 4 (HA) 3109.0 0.000000e+00 1693/1698 (99%)
EPI382286 A/Taiwan/71354/2009 (A/H1N1) segment 4 (HA) 3109.0 0.000000e+00 1693/1698 (99%)
EPI382285 A/Taiwan/97291/2009 (A/H1N1) segment 4 (HA) 3109.0 0.000000e+00 1693/1698 (99%)
EPI382280 A/Taiwan/1768/2009 (A/H1N1) segment 4 (HA) 3109.0 0.000000e+00 1693/1698 (99%)
EPI380745 A/Singapore/ON819/2009 (A/H1N1) segment 4 (HA) 3109.0 0.000000e+00 1693/1698 (99%)
EPI380737 A/Singapore/ON816/2009 (A/H1N1) segment 4 (HA) 3109.0 0.000000e+00 1693/1698 (99%)
EPI380713 A/Singapore/ON809/2009 (A/H1N1) segment 4 (HA) 3109.0 0.000000e+00 1693/1698 (99%)
EPI380701 A/Singapore/ON807/2009 (A/H1N1) segment 4 (HA) 3109.0 0.000000e+00 1693/1698 (99%)
EPI380693 A/Singapore/ON806/2009 (A/H1N1) segment 4 (HA) 3109.0 0.000000e+00 1693/1698 (99%)
EPI380665 A/Singapore/ON802/2009 (A/H1N1) segment 4 (HA) 3109.0 0.000000e+00 1693/1698 (99%)
EPI380657 A/Singapore/ON800/2009 (A/H1N1) segment 4 (HA) 3109.0 0.000000e+00 1693/1698 (99%)
EPI380649 A/Singapore/ON799/2009 (A/H1N1) segment 4 (HA) 3109.0 0.000000e+00 1693/1698 (99%)
EPI380641 A/Singapore/ON580/2009 (A/H1N1) segment 4 (HA) 3109.0 0.000000e+00 1693/1698 (99%)
EPI380634 A/Singapore/ON575/2009 (A/H1N1) segment 4 (HA) 3109.0 0.000000e+00 1693/1698 (99%)
EPI380626 A/Singapore/ON547/2009 (A/H1N1) segment 4 (HA) 3109.0 0.000000e+00 1693/1698 (99%)
EPI380618 A/Singapore/ON520/2009 (A/H1N1) segment 4 (HA) 3109.0 0.000000e+00 1693/1698 (99%)
EPI380575 A/Singapore/ON406/2009 (A/H1N1) segment 4 (HA) 3109.0 0.000000e+00 1693/1698 (99%)
EPI380571 A/Singapore/ON402/2009 (A/H1N1) segment 4 (HA) 3109.0 0.000000e+00 1693/1698 (99%)
EPI380564 A/Singapore/ON396/2009 (A/H1N1) segment 4 (HA) 3109.0 0.000000e+00 1693/1698 (99%)
EPI380559 A/Singapore/ON392/2009 (A/H1N1) segment 4 (HA) 3109.0 0.000000e+00 1693/1698 (99%)
EPI380513 A/Singapore/ON368/2009 (A/H1N1) segment 4 (HA) 3109.0 0.000000e+00 1693/1698 (99%)
EPI380509 A/Singapore/ON362/2009 (A/H1N1) segment 4 (HA) 3109.0 0.000000e+00 1693/1698 (99%)
EPI380496 A/Singapore/ON355/2009 (A/H1N1) segment 4 (HA) 3109.0 0.000000e+00 1693/1698 (99%)
EPI380488 A/Singapore/ON313/2009 (A/H1N1) segment 4 (HA) 3109.0 0.000000e+00 1693/1698 (99%)
EPI380480 A/Singapore/ON305/2009 (A/H1N1) segment 4 (HA) 3109.0 0.000000e+00 1693/1698 (99%)
EPI380467 A/Singapore/ON279/2009 (A/H1N1) segment 4 (HA) 3109.0 0.000000e+00 1693/1698 (99%)
EPI380463 A/Singapore/ON2394/2009 (A/H1N1) segment 4 (HA) 3109.0 0.000000e+00 1693/1698 (99%)
EPI380445 A/Singapore/ON2365/2009 (A/H1N1) segment 4 (HA) 3109.0 0.000000e+00 1693/1698 (99%)
EPI380407 A/Singapore/ON2250/2009 (A/H1N1) segment 4 (HA) 3109.0 0.000000e+00 1693/1698 (99%)
EPI380378 A/Singapore/ON2159/2009 (A/H1N1) segment 4 (HA) 3109.0 0.000000e+00 1693/1698 (99%)
EPI380326 A/Singapore/ON2067/2009 (A/H1N1) segment 4 (HA) 3109.0 0.000000e+00 1693/1698 (99%)
EPI380316 A/Singapore/ON2035/2009 (A/H1N1) segment 4 (HA) 3109.0 0.000000e+00 1693/1698 (99%)
EPI380312 A/Singapore/ON2024/2009 (A/H1N1) segment 4 (HA) 3109.0 0.000000e+00 1693/1698 (99%)
EPI380305 A/Singapore/ON202/2009 (A/H1N1) segment 4 (HA) 3109.0 0.000000e+00 1693/1698 (99%)
EPI380297 A/Singapore/ON201/2009 (A/H1N1) segment 4 (HA) 3109.0 0.000000e+00 1693/1698 (99%)
EPI380271 A/Singapore/ON1964/2009 (A/H1N1) segment 4 (HA) 3109.0 0.000000e+00 1693/1698 (99%)
EPI380233 A/Singapore/ON1927/2009 (A/H1N1) segment 4 (HA) 3109.0 0.000000e+00 1693/1698 (99%)
EPI380204 A/Singapore/ON1911/2009 (A/H1N1) segment 4 (HA) 3109.0 0.000000e+00 1693/1698 (99%)
EPI380120 A/Singapore/ON1808/2009 (A/H1N1) segment 4 (HA) 3109.0 0.000000e+00 1693/1698 (99%)
EPI380061 A/Singapore/GP875/2009 (A/H1N1) segment 4 (HA) 3109.0 0.000000e+00 1693/1698 (99%)
EPI380047 A/Singapore/GP687/2009 (A/H1N1) segment 4 (HA) 3109.0 0.000000e+00 1693/1698 (99%)
EPI379711 A/Singapore/ON1095/2009 (A/H1N1) segment 4 (HA) 3109.0 0.000000e+00 1693/1698 (99%)
EPI379702 A/Singapore/ON1091/2009 (A/H1N1) segment 4 (HA) 3109.0 0.000000e+00 1693/1698 (99%)
EPI379686 A/Singapore/ON1074/2009 (A/H1N1) segment 4 (HA) 3109.0 0.000000e+00 1693/1698 (99%)
EPI379622 A/Singapore/GP4728/2009 (A/H1N1) segment 4 (HA) 3109.0 0.000000e+00 1693/1698 (99%)
EPI379321 A/Singapore/GP4440/2009 (A/H1N1) segment 4 (HA) 3109.0 0.000000e+00 1693/1698 (99%)
EPI379319 A/Singapore/GP4436/2009 (A/H1N1) segment 4 (HA) 3109.0 0.000000e+00 1693/1698 (99%)
EPI379293 A/Singapore/GP4228/2009 (A/H1N1) segment 4 (HA) 3109.0 0.000000e+00 1693/1698 (99%)

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Thu Jan 31, 2013 6:37 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 44581
Location: Pittsburgh, PA USA
Influenza A virus (A/elephant seal/California/2/2010(H1N1)) segment 4 hemagglutinin (HA) gene, partial cds 3063 3063 100% 0.0 100% KC222502.1
2 Influenza A virus (A/Elephant seal/California/1/2010(H1N1)) segment 4 hemagglutinin (HA) gene, partial cds 3063 3063 100% 0.0 100% JX865422.1
3 Influenza A virus (A/Goias/16651/2010(H1N1)) segment 4 hemagglutinin (HA) gene, complete cds 3048 3048 100% 0.0 99% HM601436.1
4 Influenza A virus (A/Texas/JMS358/2009(H1N1)) segment 4, complete sequence 3048 3048 100% 0.0 99% CY060851.1
5 Influenza A virus (A/Singapore/GP3733/2009(H1N1)) hemagglutinin (HA) gene, complete cds >gb|CY120924.1| Influenza A virus (A/Guangdong/1105/2009(H1N1)) hemagglutinin (HA) gene, complete cds 3045 3045 100% 0.0 99% CY123179.1
6 Influenza A virus (A/Malaysia/2082543/2009(H1N1)) hemagglutinin (HA) gene, complete cds 3045 3045 100% 0.0 99% CY119394.1
7 Influenza A virus (A/Tianjinninghe/SWL49/2009(H1N1)) segment 4 hemagglutinin (HA) gene, complete cds 3045 3045 100% 0.0 99% JQ714165.1
8 Influenza A virus (A/Zhejiang/80/2009(H1N1)) hemagglutinin (HA) gene, complete cds 3045 3045 100% 0.0 99% CY095912.1
9 Influenza A virus (A/Zhejiang/92/2009(H1N1)) hemagglutinin (HA) gene, complete cds 3045 3045 100% 0.0 99% CY095999.1
10 Influenza A virus (A/England/616/2009(H1N1)) segment 4 sequence 3045 3045 100% 0.0 99% CY070333.1
11 Influenza A virus (A/England/1111/2009(H1N1)) segment 4 hemagglutinin (HA) gene, complete cds >gb|HM568024.1| Influenza A virus (A/England/862/2009(H1N1)) segment 4 hemagglutinin (HA) gene, complete cds >gb|CY083942.1| Influenza A virus (A/San Diego/INS194/2009(H1N1)) hemagglutinin (HA) gene, complete cds 3045 3045 100% 0.0 99% HM567976.1
12 Influenza A virus (A/Texas/46182018/2009(H1N1)) segment 4, complete sequence >gb|CY083690.1| Influenza A virus (A/Terrassa/INS94/2009(H1N1)) hemagglutinin (HA) gene, complete cds 3045 3045 100% 0.0 99% CY058684.1
13 Influenza A virus (A/Korea/CJ63/2009(H1N1)) segment 4 hemagglutinin (HA) gene, complete cds 3045 3045 100% 0.0 99% HM189486.1
14 Influenza A virus (A/Alagoas/140/2010(H1N1)) segment 4 sequence >gb|CY080307.1| Influenza A virus (A/Thailand/C602/2010(H1N1)) segment 4 sequence >gb|JN381222.1| Influenza A virus (A/Taiwan/98031/2009(H1N1)) segment 4 hemagglutinin (HA) gene, complete cds >gb|JN381233.1| Influenza A virus (A/Taiwan/90230/2009(H1N1)) segment 4 hemagglutinin (HA) gene, complete cds >gb|JN381243.1| Influenza A virus (A/Taiwan/99666/2009(H1N1)) segment 4 hemagglutinin (HA) gene, complete cds >gb|JN381244.1| Influenza A virus (A/Taiwan/99721/2009(H1N1)) segment 4 hemagglutinin (HA) gene, complete cds >gb|JN381250.1| Influenza A virus (A/Taiwan/97184/2009(H1N1)) segment 4 hemagglutinin (HA) gene, complete cds >gb|JN381261.1| Influenza A virus (A/Taiwan/65052/2010(H1N1)) segment 4 hemagglutinin (HA) gene, complete cds >gb|CY107784.1| Influenza A virus (A/Scotland/EastKilbride_420874/2009(H1N1)) hemagglutinin (HA) gene, complete cds >gb|CY107790.1| Influenza A virus (A/Scotland/EastKilbride_420875/2009(H1N1)) hemagglutinin (HA) gene, complete cds >gb|CY107797.1| Influenza A virus (A/Scotland/EastKilbride_420880/2009(H1N1)) hemagglutinin (HA) gene, complete cds >gb|CY107804.1| Influenza A virus (A/Scotland/EastKilbride_420881/2009(H1N1)) hemagglutinin (HA) gene, complete cds >dbj|AB704454.1| Influenza A virus (A/Gunma/293/2009(H1N1)) HA gene for hemagglutinin, complete cds 3045 3045 100% 0.0 99% CY072076.1
15 Influenza A virus (A/Taipei/WR1489N/2009(H1N1)) segment 4 sequence >dbj|AB558362.1| Influenza A virus (A/Sendai/TU483/2009(H1N1)) HA gene for hemagglutinin, complete cds >dbj|AB558370.1| Influenza A virus (A/Sendai/TU502/2009(H1N1)) HA gene for hemagglutinin, complete cds >dbj|AB558404.1| Influenza A virus (A/Sendai/TU1004/2009(H1N1)) HA gene for hemagglutinin, complete cds >gb|JF293316.1| Influenza A virus (A/India/Blore/2010(H1N1)) segment 4 hemagglutinin (HA) gene, complete cds >gb|CY087301.1| Influenza A virus (A/Hong Kong/433397/2009(H1N1)) hemagglutinin (HA) gene, complete cds >gb|JN187126.1| Influenza A virus (A/Taiwan/6078/2009(H1N1)) segment 4 hemagglutinin (HA) gene, complete cds >gb|CY070477.1| Influenza A virus (A/England/738/2009(H1N1)) segment 4 sequence >gb|CY070528.1| Influenza A virus (A/Scotland/94420029/2009(H1N1)) segment 4 sequence >gb|CY070543.1| Influenza A virus (A/England/829/2009(H1N1)) segment 4 sequence >gb|CY070544.1| Influenza A virus (A/England/827/2009(H1N1)) segment 4 sequence >gb|CY070554.1| Influenza A virus (A/England/834/2009(H1N1)) segment 4 sequence >gb|CY070626.1| Influenza A virus (A/England/906/2009(H1N1)) segment 4 sequence >gb|CY070648.1| Influenza A virus (A/England/95060207/2009(H1N1)) segment 4 sequence >gb|CY070742.1| Influenza A virus (A/England/911/2009(H1N1)) segment 4 sequence >gb|JQ065149.1| Influenza A virus (A/Shenzhen/38/2009(H1N1)) segment 4 hemagglutinin (HA) gene, complete cds >gb|JQ065150.1| Influenza A virus (A/Shenzhen/39/2009(H1N1)) segment 4 hemagglutinin (HA) gene, complete cds >gb|JQ065151.1| Influenza A virus (A/Shenzhen/40-SZCDC/2009(H1N1)) segment 4 hemagglutinin (HA) gene, complete cds >gb|JQ065154.1| Influenza A virus (A/Shenzhen/43/2009(H1N1)) segment 4 hemagglutinin (HA) gene, complete cds >gb|JQ065171.1| Influenza A virus (A/Shenzhen/959/2009(H1N1)) segment 4 hemagglutinin (HA) gene, complete cds >gb|JQ065185.1| Influenza A virus (A/Shenzhen/74/2009(H1N1)) segment 4 hemagglutinin (HA) gene, complete cds >gb|JQ065186.1| Influenza A virus (A/Shenzhen/75/2009(H1N1)) segment 4 hemagglutinin (HA) gene, complete cds >gb|JQ065191.1| Influenza A virus (A/Shenzhen/1282/2009(H1N1)) segment 4 hemagglutinin (HA) gene, complete cds >gb|JQ065200.1| Influenza A virus (A/Shenzhen/1447/2009(H1N1)) segment 4 hemagglutinin (HA) gene, complete cds 3045 3045 100% 0.0 99% CY071642.2
16 Influenza A virus (A/San Diego/INS202/2009(H1N1)) segment 4, complete sequence 3045 3045 100% 0.0 99% CY066575.1
17 Influenza A virus (A/Ulgii/9911/2009(H1N1)) segment 4 sequence 3045 3045 100% 0.0 99% CY065995.1
18 Influenza A virus (A/Singapore/ON2193/2009(H1N1)) segment 4 sequence 3045 3045 100% 0.0 99% CY063803.1
19 Influenza A virus (A/Singapore/GP3491/2009(H1N1)) segment 4 sequence 3045 3045 100% 0.0 99% CY063761.1
20 Influenza A virus (A/Singapore/ON2018/2009(H1N1)) segment 4 sequence >gb|CY063795.1| Influenza A virus (A/Singapore/ON2063/2009(H1N1)) segment 4 sequence 3045 3045 100% 0.0 99% CY063793.1
21 Influenza A virus (A/Singapore/GP3084/2009(H1N1)) segment 4 sequence 3045 3045 100% 0.0 99% CY063754.1
22 Influenza A virus (A/San Diego/INS61/2009(H1N1)) segment 4, complete sequence 3045 3045 100% 0.0 99% CY056915.1
23 Influenza A virus (A/swine/Hong Kong/NS1583/2009(H1N1)) segment 4 sequence 3045 3045 100% 0.0 99% CY061725.1
24 Influenza A virus (A/swine/Hong Kong/2299/2009(H1N1)) segment 4 sequence 3045 3045 100% 0.0 99% CY061733.1
25 Influenza A virus (A/California/VRDL80/2009(H1N1)) segment 4, complete sequence 3045 3045 100% 0.0 99% CY062202.1
26 Influenza A virus (A/San Diego/INS74/2009(H1N1)) segment 4, complete sequence 3045 3045 100% 0.0 99% CY062651.1
27 Influenza A virus (A/New York/5916/2009(H1N1)) segment 4, complete sequence 3045 3045 100% 0.0 99% CY056595.1
28 Influenza A virus (A/California/VRDL64/2009(H1N1)) segment 4, complete sequence 3045 3045 100% 0.0 99% CY055003.1
29 Influenza A virus (A/Sao Paulo/53845/2009(H1N1)) segment 4 hemagglutinin (HA) gene, complete cds >gb|CY055248.1| Influenza A virus (A/Malaysia/8860/2009(H1N1)) segment 4 sequence 3045 3045 100% 0.0 99% GQ915021.1
30 Influenza A virus (A/Texas/45062584/2009(H1N1)) segment 4, complete sequence 3045 3045 100% 0.0 99% CY052639.1
31 Influenza A virus (A/California/VRDL78/2009(H1N1)) segment 4, complete sequence >gb|CY055479.1| Influenza A virus (A/California/VRDL72/2009(H1N1)) segment 4, complete sequence 3045 3045 100% 0.0 99% CY055518.1
32 Influenza A virus (A/California/VRDL67/2009(H1N1)) segment 4, complete sequence >gb|CY055043.1| Influenza A virus (A/California/VRDL70/2009(H1N1)) segment 4, complete sequence >gb|CY056028.1| Influenza A virus (A/San Diego/INS16/2009(H1N1)) segment 4, complete sequence >gb|CY056204.1| Influenza A virus (A/San Diego/INS52/2009(H1N1)) segment 4, complete sequence >gb|CY056699.1| Influenza A virus (A/New York/6293/2009(H1N1)) segment 4, complete sequence >gb|CY057019.1| Influenza A virus (A/Wisconsin/629-D02133/2009(H1N1)) segment 4, complete sequence >gb|CY057246.1| Influenza A virus (A/New York/5161/2009(H1N1)) segment 4, complete sequence >gb|CY057566.1| Influenza A virus (A/Wisconsin/629-D00834/2009(H1N1)) segment 4, complete sequence >gb|CY060779.1| Influenza A virus (A/Texas/46221665/2009(H1N1)) segment 4, complete sequence >gb|CY061219.1| Influenza A virus (A/New York/6772/2009(H1N1)) segment 4, complete sequence >gb|CY061235.1| Influenza A virus (A/San Diego/INS102/2009(H1N1)) segment 4, complete sequence >gb|CY061594.1| Influenza A virus (A/New York/6806/2009(H1N1)) segment 4, complete sequence >gb|CY066239.1| Influenza A virus (A/California/VRDL108/2009(H1N1)) segment 4, complete sequence >gb|CY066311.1| Influenza A virus (A/California/VRDL117/2009(H1N1)) segment 4, complete sequence >gb|CY066391.1| Influenza A virus (A/California/VRDL127/2009(H1N1)) segment 4, complete sequence >gb|CY066791.1| Influenza A virus (A/San Diego/INS215/2009(H1N1)) segment 4, complete sequence 3045 3045 100% 0.0 99% CY055019.1
33 Influenza A virus (A/Chita/01/2009(H1N1)) segment 4 hemagglutinin (HA) gene, complete cds 3045 3045 100% 0.0 99% GU271944.1
34 Influenza A virus (A/Norway/3797/2009(H1N1)) segment 4 sequence 3045 3045 100% 0.0 99% CY052011.1
35 Influenza A virus (A/New York/4777/2009(H1N1)) segment 4, complete sequence 3045 3045 100% 0.0 99% CY051695.1
36 Influenza A virus (A/Chengdu/03/2009(H1N1)) segment 4 hemagglutinin (HA) gene, complete cds 3045 3045 100% 0.0 99% GU057010.1
37 Influenza A virus (A/Chengdu/06/2009(H1N1)) segment 4 hemagglutinin (HA) gene, complete cds >gb|GU057013.1| Influenza A virus (A/Chengdu/14/2009(H1N1)) segment 4 hemagglutinin (HA) gene, complete cds >gb|GU057015.1| Influenza A virus (A/Chengdu/21/2009(H1N1)) segment 4 hemagglutinin (HA) gene, complete cds >gb|GU057016.1| Influenza A virus (A/Chengdu/31/2009(H1N1)) segment 4 hemagglutinin (HA) gene, complete cds >gb|GU057017.1| Influenza A virus (A/Chengdu/33/2009(H1N1)) segment 4 hemagglutinin (HA) gene, complete cds >gb|GU057018.1| Influenza A virus (A/Chengdu/39/2009(H1N1)) segment 4 hemagglutinin (HA) gene, complete cds >gb|GU057020.1| Influenza A virus (A/Chengdu/47/2009(H1N1)) segment 4 hemagglutinin (HA) gene, complete cds >gb|GU057021.1| Influenza A virus (A/Chengdu/54/2009(H1N1)) segment 4 hemagglutinin (HA) gene, complete cds >gb|GU968911.2| Influenza A virus (A/Beijing/SE1113/2009(H1N1)) segment 4 hemagglutinin (HA) gene, complete cds >gb|GU968920.2| Influenza A virus (A/Beijing/SE2849/2009(H1N1)) segment 4 hemagglutinin (HA) gene, complete cds >gb|CY064390.1| Influenza A virus (A/Weidu/SWL51/2009(H1N1)) segment 4 sequence >gb|CY064391.1| Influenza A virus (A/Qingfeng/SWL43/2009(H1N1)) segment 4 sequence >gb|CY064392.1| Influenza A virus (A/Jinshui/SWL54/2009(H1N1)) segment 4 sequence >gb|CY064394.1| Influenza A virus (A/Ruyang/SWL1606/2009(H1N1)) segment 4 sequence >gb|CY064395.1| Influenza A virus (A/Xuchang/SWL48/2009(H1N1)) segment 4 sequence >gb|CY080259.1| Influenza A virus (A/Nanchang/8009/2009(H1N1)) segment 4 sequence >gb|JN631054.1| Influenza A virus (A/Shanghai/1744T/2009(H1N1)) segment 4 hemagglutinin (HA) gene, complete cds >gb|CY095979.1| Influenza A virus (A/Zhejiang/9/2009(H1N1)) hemagglutinin (HA) gene, complete cds 3045 3045 100% 0.0 99% GU057012.1
38 Influenza A virus (A/England/94860684/2009(H1N1)) segment 4 sequence 3041 3041 100% 0.0 99% CY070629.1
39 Influenza A virus (A/India/GWL-02/2011(H1N1)) segment 4 hemagglutinin (HA) gene, complete cds 3039 3039 100% 0.0 99% JQ319657.1
40 Influenza A virus (A/Northern Ireland/94940020/2009(H1N1)) segment 4 hemagglutinin (HA) gene, complete cds 3039 3039 100% 0.0 99% JX625606.1
41 Influenza A virus (A/Tottori/ST312/2009(H1N1)) HA gene for hemagglutinin, complete cds 3039 3039 100% 0.0 99% AB745178.1
42 Influenza A virus (A/Singapore/KK349/2010(H1N1)) segment 4 hemagglutinin (HA) gene, complete cds 3039 3039 100% 0.0 99% JX309615.1
43 Influenza A virus (A/Singapore/SS13/2010(H1N1)) segment 4 hemagglutinin (HA) gene, complete cds 3039 3039 100% 0.0 99% JX309409.1
44 Influenza A virus (A/Singapore/MM05/2010(H1N1)) segment 4 hemagglutinin (HA) gene, complete cds 3039 3039 100% 0.0 99% JX309344.1
45 Influenza A virus (A/Singapore/TT144/2010(H1N1)) segment 4 hemagglutinin (HA) gene, complete cds 3039 3039 100% 0.0 99% JX309336.1
46 Influenza A virus (A/Singapore/GP820/2010(H1N1)) segment 4 hemagglutinin (HA) gene, complete cds 3039 3039 100% 0.0 99% JX309280.1
47 Influenza A virus (A/Singapore/GP1040/2010(H1N1)) segment 4 hemagglutinin (HA) gene, complete cds 3039 3039 100% 0.0 99% JX309228.1
48 Influenza A virus (A/Singapore/GP811/2010(H1N1)) segment 4 hemagglutinin (HA) gene, complete cds 3039 3039 100% 0.0 99% JX309199.1
49 Influenza A virus (A/Singapore/GP205/2010(H1N1)) segment 4 hemagglutinin (HA) gene, complete cds 3039 3039 100% 0.0 99% JX309106.1
50 Influenza A virus (A/Singapore/GP256/2010(H1N1)) segment 4 hemagglutinin (HA) gene, complete cds 3039 3039 100% 0.0 99% JX309017.1
51 Influenza A virus (A/Taiwan/65337/2010(H1N1)) segment 4 hemagglutinin (HA) gene, complete cds 3039 3039 100% 0.0 99% JN381268.1
52 Influenza A virus (A/Taiwan/65211/2010(H1N1)) segment 4 hemagglutinin (HA) gene, complete cds 3039 3039 100% 0.0 99% JN381264.1
53 Influenza A virus (A/Taiwan/97487/2009(H1N1)) segment 4 hemagglutinin (HA) gene, complete cds 3039 3039 100% 0.0 99% JN381257.1
54 Influenza A virus (A/Taiwan/97394/2009(H1N1)) segment 4 hemagglutinin (HA) gene, complete cds 3039 3039 100% 0.0 99% JN381256.1
55 Influenza A virus (A/Taiwan/99867/2009(H1N1)) segment 4 hemagglutinin (HA) gene, complete cds 3039 3039 100% 0.0 99% JN381246.1
56 Influenza A virus (A/Taiwan/99502/2009(H1N1)) segment 4 hemagglutinin (HA) gene, complete cds 3039 3039 100% 0.0 99% JN381241.1
57 Influenza A virus (A/Taiwan/99422/2009(H1N1)) segment 4 hemagglutinin (HA) gene, complete cds >gb|JX625622.1| Influenza A virus (A/Northern Ireland/94940033/2009(H1N1)) segment 4 hemagglutinin (HA) gene, complete cds 3039 3039 100% 0.0 99% JN381240.1
58 Influenza A virus (A/Taiwan/99334/2009(H1N1)) segment 4 hemagglutinin (HA) gene, complete cds 3039 3039 100% 0.0 99% JN381238.1
59 Influenza A virus (A/Taiwan/97888/2009(H1N1)) segment 4 hemagglutinin (HA) gene, complete cds 3039 3039 100% 0.0 99% JN381221.1
60 Influenza A virus (A/Taiwan/97291/2009(H1N1)) segment 4 hemagglutinin (HA) gene, complete cds 3039 3039 100% 0.0 99% JN381212.1
61 Influenza A virus (A/Guangdong/1104/2009(H1N1)) hemagglutinin (HA) gene, complete cds >gb|CY120921.1| Influenza A virus (A/Guangdong/1106/2009(H1N1)) hemagglutinin (HA) gene, complete cds 3039 3039 100% 0.0 99% CY120920.1
62 Influenza A virus (A/Singapore/ON802/2009(H1N1)) hemagglutinin (HA) gene, complete cds 3039 3039 100% 0.0 99% CY124059.1
63 Influenza A virus (A/Singapore/ON520/2009(H1N1)) hemagglutinin (HA) gene, complete cds 3039 3039 100% 0.0 99% CY124012.1
64 Influenza A virus (A/Singapore/ON800/2009(H1N1)) hemagglutinin (HA) gene, complete cds 3039 3039 100% 0.0 99% CY124051.1
65 Influenza A virus (A/Singapore/ON2394/2009(H1N1)) hemagglutinin (HA) gene, complete cds 3039 3039 100% 0.0 99% CY123884.1
66 Influenza A virus (A/Singapore/ON2250/2009(H1N1)) hemagglutinin (HA) gene, complete cds 3039 3039 100% 0.0 99% CY123817.1
67 Influenza A virus (A/Singapore/ON2159/2009(H1N1)) hemagglutinin (HA) gene, complete cds 3039 3039 100% 0.0 99% CY123788.1
68 Influenza A virus (A/Singapore/ON2024/2009(H1N1)) hemagglutinin (HA) gene, complete cds 3039 3039 100% 0.0 99% CY123724.1
69 Influenza A virus (A/Singapore/ON202/2009(H1N1)) hemagglutinin (HA) gene, complete cds >gb|CY123913.1| Influenza A virus (A/Singapore/ON305/2009(H1N1)) hemagglutinin (HA) gene, complete cds >gb|CY123921.1| Influenza A virus (A/Singapore/ON313/2009(H1N1)) hemagglutinin (HA) gene, complete cds >gb|CY123929.1| Influenza A virus (A/Singapore/ON355/2009(H1N1)) hemagglutinin (HA) gene, complete cds >gb|CY123942.1| Influenza A virus (A/Singapore/ON362/2009(H1N1)) hemagglutinin (HA) gene, complete cds >gb|CY123946.1| Influenza A virus (A/Singapore/ON368/2009(H1N1)) hemagglutinin (HA) gene, complete cds >gb|CY123953.1| Influenza A virus (A/Singapore/ON392/2009(H1N1)) hemagglutinin (HA) gene, complete cds >gb|CY123969.1| Influenza A virus (A/Singapore/ON406/2009(H1N1)) hemagglutinin (HA) gene, complete cds >gb|CY124028.1| Influenza A virus (A/Singapore/ON575/2009(H1N1)) hemagglutinin (HA) gene, complete cds >gb|CY124035.1| Influenza A virus (A/Singapore/ON580/2009(H1N1)) hemagglutinin (HA) gene, complete cds 3039 3039 100% 0.0 99% CY123717.1
70 Influenza A virus (A/Thailand/ICRC-BKK34004/2010(H1N1)) hemagglutinin (HA) gene, complete cds 3039 3039 100% 0.0 99% CY096806.1
71 Influenza A virus (A/Hangzhou/15/2010(H1N1)) segment 4 hemagglutinin (HA) gene, complete cds 3039 3039 100% 0.0 99% JQ365003.1
72 Influenza A virus (A/Hangzhou/1732/2009(H1N1)) segment 4 hemagglutinin (HA) gene, complete cds 3039 3039 100% 0.0 99% JQ364999.1
73 Influenza A virus (A/Merida/2189-CIR/2009(H1N1)) hemagglutinin (HA) gene, complete cds 3039 3039 100% 0.0 99% CY106568.1
74 Influenza A virus (A/swine/Guangdong/297/2010(H1N1)) segment 4 hemagglutinin (HA) gene, complete cds 3039 3039 100% 0.0 99% JN375113.1
75 Influenza A virus (A/swine/Guangdong/294/2010(H1N1)) segment 4 hemagglutinin (HA) gene, complete cds 3039 3039 100% 0.0 99% JN375112.1
76 Influenza A virus (A/swine/Guangdong/286/2010(H1N1)) segment 4 hemagglutinin (HA) gene, complete cds 3039 3039 100% 0.0 99% JN375111.1
77 Influenza A virus (A/swine/Guangdong/278/2010(H1N1)) segment 4 hemagglutinin (HA) gene, complete cds 3039 3039 100% 0.0 99% JN375110.1
78 Influenza A virus (A/Shanghai/1783T/2009(H1N1)) segment 4 hemagglutinin (HA) gene, complete cds 3039 3039 100% 0.0 99% JN631053.1
79 Influenza A virus (A/England/936/2009(H1N1)) segment 4 sequence 3039 3039 100% 0.0 99% CY070667.1
80 Influenza A virus (A/England/95200063/2009(H1N1)) segment 4 sequence 3039 3039 100% 0.0 99% CY070661.1
81 Influenza A virus (A/England/867/2009(H1N1)) segment 4 sequence 3039 3039 100% 0.0 99% CY070627.1
82 Influenza A virus (A/England/885/2009(H1N1)) segment 4 sequence 3039 3039 100% 0.0 99% CY070607.1
83 Influenza A virus (A/England/879/2009(H1N1)) segment 4 sequence 3039 3039 100% 0.0 99% CY070599.1
84 Influenza A virus (A/Scotland/61/2009(H1N1)) segment 4 sequence 3039 3039 100% 0.0 99% CY070566.1
85 Influenza A virus (A/England/94620043/2009(H1N1)) segment 4 sequence 3039 3039 100% 0.0 99% CY070563.1
86 Influenza A virus (A/England/838/2009(H1N1)) segment 4 sequence >gb|CY070561.1| Influenza A virus (A/Scotland/56/2009(H1N1)) segment 4 sequence >gb|CY070574.1| Influenza A virus (A/England/94700025/2009(H1N1)) segment 4 sequence 3039 3039 100% 0.0 99% CY070550.1
87 Influenza A virus (A/England/809/2009(H1N1)) segment 4 sequence 3039 3039 100% 0.0 99% CY070538.1
88 Influenza A virus (A/England/94340856/2009(H1N1)) segment 4 sequence 3039 3039 100% 0.0 99% CY070514.1
89 Influenza A virus (A/England/751/2009(H1N1)) segment 4 sequence 3039 3039 100% 0.0 99% CY070488.1
90 Influenza A virus (A/England/94260047/2009(H1N1)) segment 4 sequence >gb|CY070505.1| Influenza A virus (A/England/1002/2009(H1N1)) segment 4 sequence >gb|CY070582.1| Influenza A virus (A/England/94720081/2009(H1N1)) segment 4 sequence >gb|CY070641.1| Influenza A virus (A/England/920/2009(H1N1)) segment 4 sequence >gb|CY070657.1| Influenza A virus (A/England/1052/2009(H1N1)) segment 4 sequence 3039 3039 100% 0.0 99% CY070472.1
91 Influenza A virus (A/England/94160078/2009(H1N1)) segment 4 sequence 3039 3039 100% 0.0 99% CY070439.1
92 Influenza A virus (A/England/94020500/2009(H1N1)) segment 4 sequence 3039 3039 100% 0.0 99% CY070404.1
93 Influenza A virus (A/England/707/2009(H1N1)) segment 4 sequence >gb|JQ065184.1| Influenza A virus (A/Shenzhen/1230/2009(H1N1)) segment 4 hemagglutinin (HA) gene, complete cds 3039 3039 100% 0.0 99% CY070395.1
94 Influenza A virus (A/Scotland/93860052/2009(H1N1)) segment 4 sequence >gb|CY070468.1| Influenza A virus (A/Scotland/32/2009(H1N1)) segment 4 sequence 3039 3039 100% 0.0 99% CY070380.1
95 Influenza A virus (A/Scotland/93860051/2009(H1N1)) segment 4 sequence >gb|CY070384.1| Influenza A virus (A/Scotland/93880057/2009(H1N1)) segment 4 sequence 3039 3039 100% 0.0 99% CY070379.1
96 Influenza A virus (A/England/508/2009(H1N1)) segment 4 sequence 3039 3039 100% 0.0 99% CY070169.1
97 Influenza A virus (A/Pernambuco/82/2009(H1N1)) hemagglutinin (HA) gene, complete cds 3038 3038 100% 0.0 99% CY103941.1
98 Influenza A virus (A/Pernambuco/42/2009(H1N1)) hemagglutinin (HA) gene, complete cds 3038 3038 100% 0.0 99% CY103923.1
99 Influenza A virus (A/Scotland/73/2009(H1N1)) segment 4 sequence 3038 3038 100% 0.0 99% CY070585.1
100 Influenza A virus (A/Mexico City/INER2/2009(H1N1)) hemagglutinin (HA) gene, complete cds 3034 3034 100% 0.0 99% CY100464.1

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Thu Jan 31, 2013 6:39 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 44581
Location: Pittsburgh, PA USA
LOCUS KC222502 1698 bp cRNA linear VRL 30-JAN-2013
DEFINITION Influenza A virus (A/elephant seal/California/2/2010(H1N1)) segment
4 hemagglutinin (HA) gene, partial cds.
ACCESSION KC222502
VERSION KC222502.1 GI:429999301
KEYWORDS .
SOURCE Influenza A virus (A/elephant seal/California/2/2010(H1N1))
ORGANISM Influenza A virus (A/elephant seal/California/2/2010(H1N1))
Viruses; ssRNA negative-strand viruses; Orthomyxoviridae;
Influenzavirus A.
REFERENCE 1 (bases 1 to 1698)
AUTHORS Goldstein,T., Mena,I., Anthony,S.J., Medina,R., Robinson,P.W.,
Greig,D.J., Costa,D.P., Lipkin,W.I., Garcia-Sastre,A. and
Boyce,W.M.
TITLE Pandemic H1N1 Influenza Isolated from Free-Ranging Northern
Elephant Seals in 2010 off the Central California Coast
JOURNAL Unpublished
REFERENCE 2 (bases 1 to 1698)
AUTHORS Goldstein,T., Mena,I., Anthony,S.J., Medina,R., Robinson,P.W.,
Greig,D.J., Costa,D.P., Lipkin,W.I., Garcia-Sastre,A. and
Boyce,W.M.
TITLE Direct Submission
JOURNAL Submitted (28-NOV-2012) School of Veterinary Medicine, University
of California Davis, Wildlife Health Center, One Shields Ave,
Davis, CA 95618, USA
COMMENT GenBank Accession Numbers KC222499-KC222506 represent sequences
from the 8 segments of Influenza A virus (A/elephant
seal/California/2/2010(H1N1)).

##Assembly-Data-START##
Sequencing Technology :: Sanger dideoxy sequencing
##Assembly-Data-END##
FEATURES Location/Qualifiers
source 1..1698
/organism="Influenza A virus (A/elephant
seal/California/2/2010(H1N1))"
/mol_type="viral cRNA"
/strain="A/elephant seal/California/2/2010"
/serotype="H1N1"
/isolation_source="nasal swab"
/host="Mirounga angustirostris (Northern elephant seal)"
/db_xref="taxon:1263915"
/segment="4"
/country="USA"
/collection_date="Apr-2010"
gene 1..>1698
/gene="HA"
CDS 1..>1698
/gene="HA"
/codon_start=1
/product="hemagglutinin"
/protein_id="AGA19350.1"
/db_xref="GI:429999302"
/translation="MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVT
HSVNLLEDKHNGKLCKLRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETSSS
DNGTCYPGDFIDYEELREQLSSVSSFERFEIFPKTSSWPNHDPNKGVTAACPHAGAKS
FYKNLIWLVKKGNSYPKLSKSYINDKGKEVLVLWGIHHPSTSADQQSLYQNADAYVFV
GTSRYSKKFKPEIAIRPKVRNQEGRMNYYWTLVEPGDKITFEATGNLVVPRYAFAMER
NAGSGIIISDTPVHDCNTTCQTPKGAINTSLPFQNIHPITIGKCPKYVKSTKLRLATG
LRNVPSIQSRGLFGAIAGFIEGGWTGMVDGWYGYHHQNEQGSGYAADLKSTQNAIDKI
TNKVNSVIEKMNTQFTAVGKEFNHLEKRIENLNKKVDDGFLDIWTYNAELLVLLENER
TLDYHDSNVKNLYEKVRSQLKNNAKEIGNGCFEFYHKCDNTCMESVKNGTYDYPKYSE
EAKLNREEIDGVKLESTRIYQILAIYSTVASSLVLVVSLGAISFWMCSNGSLQCRICI
"
ORIGIN
1 atgaaggcaa tactagtagt tctgctatat acatttgcaa ccgcaaatgc agacacatta
61 tgtataggtt atcatgcgaa caattcaaca gacactgtag acacagtact agaaaagaat
121 gtaacagtaa cacactctgt taaccttcta gaagacaagc ataacgggaa actatgcaaa
181 ctaagagggg tagccccatt gcatttgggt aaatgtaaca ttgctggctg gatcctggga
241 aatccagagt gtgaatcact ctccacagca agctcatggt cctacattgt ggaaacatct
301 agttcagaca atggaacgtg ttacccagga gatttcatcg attatgagga gctaagagag
361 caattgagct cagtgtcatc atttgaaagg tttgagatat tccccaagac aagttcatgg
421 cccaatcatg acccgaacaa aggtgtaacg gcagcatgtc ctcatgctgg agcaaaaagc
481 ttctacaaaa atttaatatg gctagttaaa aaaggaaatt catacccaaa gctcagcaaa
541 tcctacatta atgataaagg gaaagaagtc ctcgtgctat ggggcattca ccatccatct
601 actagtgctg accaacaaag tctctatcag aatgcagatg catatgtttt tgtggggaca
661 tcaagataca gcaagaagtt caagccagaa atagcaataa gacccaaagt gaggaatcaa
721 gaagggagaa tgaactatta ctggacacta gtagagccgg gagacaaaat aacattcgaa
781 gcaactggaa atctagtggt accgagatat gcattcgcaa tggaaagaaa tgctggatct
841 ggtattatca tttcagatac accagtccac gattgcaata caacttgtca gacacccaag
901 ggtgctataa acaccagcct cccatttcag aatatacatc cgatcacaat tggaaaatgt
961 ccaaaatatg taaaaagcac aaaattgaga ctggccacag gattgaggaa tgtcccgtct
1021 attcaatcta gaggcctatt tggggccatt gccggtttca ttgaaggggg atggacaggg
1081 atggtagatg gatggtacgg ttatcaccat caaaatgagc aggggtcagg atatgcagcc
1141 gacctgaaga gcacacagaa tgccattgac aagattacta acaaagtaaa ttctgttatt
1201 gaaaagatga atacacagtt cacagcagta ggtaaagagt tcaaccacct ggaaaaaaga
1261 atagagaatt taaataaaaa agttgatgat ggtttcctgg acatttggac ttacaatgcc
1321 gaactgttgg ttctattgga aaatgaaaga actttggact accacgattc aaatgtgaag
1381 aacttatatg aaaaggtaag aagccagtta aaaaacaatg ccaaggaaat tggaaacggc
1441 tgctttgaat tttaccacaa atgcgataac acgtgcatgg aaagtgtcaa aaatgggact
1501 tatgactacc caaaatactc agaggaagca aaattaaaca gagaagaaat agatggggta
1561 aagctggaat caacaaggat ttaccagatt ttggcgatct attcaactgt cgccagttca
1621 ttggtactgg tagtctccct gggggcaatc agtttctgga tgtgctctaa tgggtctcta
1681 cagtgtagaa tatgtatt

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Thu Jan 31, 2013 7:14 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 44581
Location: Pittsburgh, PA USA
EPI416777 A/elephant seal/California/2/2010 (A/H1N1) segment 6 (NA) 2586.4 0.000000e+00 1400/1400 (100%)
EPI416759 A/Elephant seal/California/1/2010 (A/H1N1) segment 6 (NA) 2580.9 0.000000e+00 1399/1400 (99%)
EPI392331 A/Scotland/Glasgow_443734/2009 (A/H1N1) segment 6 (NA) 2553.2 0.000000e+00 1394/1400 (99%)
EPI392030 A/Scotland/Edinburgh_23151/2009 (A/H1N1) segment 6 (NA) 2553.2 0.000000e+00 1394/1400 (99%)
EPI277511 A/Tessenderlo/INS380/2009 (A/H1N1 pdm09) segment 6 (NA) 2553.2 0.000000e+00 1394/1400 (99%)
EPI270880 A/San Diego/INS202/2009 (A/H1N1 pdm09) segment 6 (NA) 2553.2 0.000000e+00 1394/1400 (99%)
EPI256117 A/Guangdong-Ruizhou/SWL1433/2009 (A/H1N1 pdm09) segment 6 (NA) 2553.2 0.000000e+00 1394/1400 (99%)
EPI194181 A/Kenya/126/2009 (A/H1N1 pdm09) segment 6 (NA) 2553.2 0.000000e+00 1394/1400 (99%)
EPI408193 A/Jeddah/3657/2010 (H1N1) (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI408192 A/Jeddah/3673/2010(H1N1) (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI408189 A/Jeddah/3669/2010(H1N1) (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI408188 A/Jeddah/3666/2010(H1N1) (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI408187 A/Jeddah/3663/2010(H1N1) (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI408185 A/Jeddah/1296/2009(H1N1) (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI408184 A/Jeddah/3659/2010(H1N1) (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI406689 A/Mexico City/IBT23/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI405734 A/Viet Nam/001-1889/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI405718 A/Viet Nam/001-1716/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI405686 A/Viet Nam/11032021/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI405620 A/Viet Nam/13032076/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI405509 A/Viet Nam/13032044/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI405501 A/Viet Nam/13032040/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI405454 A/Viet Nam/13032016/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI405430 A/Viet Nam/13032009/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI405422 A/Viet Nam/13032008/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI405414 A/Viet Nam/13032002/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI405406 A/Viet Nam/13032001/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI403793 A/Northern Ireland/94940020/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI403770 A/England/94620043/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI403631 A/England/687/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI403583 A/England/527/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI396134 A/England/391/2009 (A/H1N1 pdm09) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI396110 A/England/271/2009 (A/H1N1 pdm09) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI396094 A/England/260/2009 (A/H1N1 pdm09) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI395991 A/England/527/2009 (A/H1N1 pdm09) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI392445 A/Scotland/StAndrews_17693/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI392437 A/Scotland/EastKilbride_425383/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI392430 A/Scotland/EastKilbride_420881/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI392422 A/Scotland/EastKilbride_420880/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI392415 A/Scotland/EastKilbride_420875/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI392408 A/Scotland/EastKilbride_420874/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI392404 A/Scotland/EastKilbride_420703/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI392397 A/Scotland/EastKilbride_419809/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI392377 A/Scotland/Paisley_413960/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI392253 A/Scotland/Paisley_413739/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI392182 A/Scotland/Glasgow_420768/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI392164 A/Scotland/Glasgow_419865/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI392157 A/Scotland/Glasgow_419707/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI392150 A/Scotland/Glasgow_414473/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI392131 A/Scotland/Glasgow_413886/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI392123 A/Scotland/Paisley_413869/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI392117 A/Scotland/Glasgow_413848/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI392108 A/Scotland/EastKilbride_413652/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI392105 A/Scotland/Glasgow_413608/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI392067 A/Scotland/Glasgow_412311/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI392062 A/Scotland/Glasgow_412286/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI392055 A/Scotland/Glasgow_412118/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI392044 A/Scotland/Livingston_412757/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI387344 A/Brazil/AVS05/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI387304 A/Brazil/AVS04/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI387067 A/Scotland/Dundee_09V502666/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI387039 A/Scotland/Dundee_09V502215/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI386982 A/Scotland/Perth_09V500259/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI386947 A/Scotland/Edinburgh_17715/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI386929 A/Scotland/Aberdeen_7/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI386922 A/Scotland/Aberdeen_6/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI386909 A/Scotland/Aberdeen_4/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI385614 A/Singapore/TT405/2010 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI385610 A/Singapore/SS41/2010 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI385498 A/Singapore/KK420/2010 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI385402 A/Singapore/TT341/2010 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI385362 A/Singapore/TT255/2010 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI385318 A/Singapore/SS09/2010 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI385287 A/Singapore/TT278/2010 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI385283 A/Singapore/GP185/2010 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI385270 A/Singapore/KK147/2010 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI385178 A/Singapore/TT145/2010 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI385164 A/Singapore/TT128/2010 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI385104 A/Singapore/GP1012/2010 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI385083 A/Singapore/GP784/2010 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI385065 A/Singapore/GP643/2010 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI385055 A/Singapore/TT106/2010 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI384993 A/Singapore/GP205/2010 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI384929 A/Singapore/GP398/2010 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI384881 A/Singapore/GP329/2010 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI382488 A/Taiwan/90112/2010 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI382482 A/Taiwan/90027/2010 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI382473 A/Taiwan/97487/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI382472 A/Taiwan/97394/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI382471 A/Taiwan/97382/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI382469 A/Taiwan/97341/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI382463 A/Taiwan/99902/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI382462 A/Taiwan/99867/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI382460 A/Taiwan/99721/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI382458 A/Taiwan/99542/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI382456 A/Taiwan/99422/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI382455 A/Taiwan/99384/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI382453 A/Taiwan/99330/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI382452 A/Taiwan/99144/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI382448 A/Taiwan/99011/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI382447 A/Taiwan/99006/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI382443 A/Taiwan/98706/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI382442 A/Taiwan/98677/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI382439 A/Taiwan/98158/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI382438 A/Taiwan/98031/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI382431 A/Taiwan/71526/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI382430 A/Taiwan/71433/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI382423 A/Taiwan/97196/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI382422 A/Taiwan/1776/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI382421 A/Taiwan/1775/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI382420 A/Taiwan/1768/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI382419 A/Taiwan/1767/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI382418 A/Taiwan/1766/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI382417 A/Taiwan/1765/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI380754 A/Singapore/ON822/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI380723 A/Singapore/ON811/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI380715 A/Singapore/ON809/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI380675 A/Singapore/ON803/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI380667 A/Singapore/ON802/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI380659 A/Singapore/ON800/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI380651 A/Singapore/ON799/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI380643 A/Singapore/ON580/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI380628 A/Singapore/ON547/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI380612 A/Singapore/ON506/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI380604 A/Singapore/ON496/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI380596 A/Singapore/ON479/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI380588 A/Singapore/ON477/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI380580 A/Singapore/ON457/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI380572 A/Singapore/ON402/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI380565 A/Singapore/ON396/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI380561 A/Singapore/ON392/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI380514 A/Singapore/ON368/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI380510 A/Singapore/ON362/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI380502 A/Singapore/ON360/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI380498 A/Singapore/ON355/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI380490 A/Singapore/ON313/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI380481 A/Singapore/ON305/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI380477 A/Singapore/ON304/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI380471 A/Singapore/ON288/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI380468 A/Singapore/ON279/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI380465 A/Singapore/ON276/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI380454 A/Singapore/ON2378/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI380448 A/Singapore/ON2370/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI380417 A/Singapore/ON226/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI380374 A/Singapore/ON2145/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI380358 A/Singapore/ON2135/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI380335 A/Singapore/ON2081/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI380325 A/Singapore/ON2064/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI380319 A/Singapore/ON2040/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI380313 A/Singapore/ON2024/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI380265 A/Singapore/ON1955/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI380239 A/Singapore/ON193/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI380230 A/Singapore/ON1924/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI380214 A/Singapore/ON1914/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI380182 A/Singapore/ON1896/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI380174 A/Singapore/ON1892/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI380130 A/Singapore/ON1811/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI380114 A/Singapore/ON1802/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI380090 A/Singapore/ON1757/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI380088 A/Singapore/ON1754/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI380084 A/Singapore/ON1747/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI380042 A/Singapore/GP674/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI379757 A/Singapore/ON1616/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI379737 A/Singapore/ON1114/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI379721 A/Singapore/ON1102/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI379713 A/Singapore/ON1095/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI379704 A/Singapore/ON1091/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI379696 A/Singapore/ON1079/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI379688 A/Singapore/ON1074/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI379680 A/Singapore/ON1069/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI379672 A/Singapore/ON1063/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI379656 A/Singapore/ON1048/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI379226 A/Singapore/GP3710/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI379220 A/Singapore/GP3668/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI379214 A/Singapore/GP3594/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI379194 A/Singapore/GP3515/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI379192 A/Singapore/GP3502/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI379186 A/Singapore/GP3292/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI379174 A/Singapore/GP3212/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI379166 A/Singapore/GP3205/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI379158 A/Singapore/GP3191/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI379134 A/Singapore/GP3179/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI379119 A/Singapore/GP3175/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI379111 A/Singapore/GP3104/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI379095 A/Singapore/GP3081/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI379079 A/Singapore/GP3069/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI379063 A/Singapore/GP3040/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI379031 A/Singapore/GP3009/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI379019 A/Singapore/GP2982/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI378987 A/Singapore/GP2693/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI378979 A/Singapore/GP2680/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI378963 A/Singapore/GP2658/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI378947 A/Singapore/GP2640/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI378911 A/Singapore/GP2290/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI378899 A/Singapore/GP2266/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI378863 A/Singapore/GP2223/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI378847 A/Singapore/GP2215/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI378823 A/Singapore/GP1178/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI378815 A/Singapore/GP1174/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI378807 A/Singapore/GP1169/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI378749 A/Singapore/GP1167/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI378733 A/Singapore/GP1163/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI378725 A/Singapore/GP1162/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI378721 A/Singapore/GP1160/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI378717 A/Singapore/GP1156/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI378713 A/Singapore/GP1147/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI378689 A/Singapore/GP1137/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI378681 A/Singapore/GP1136/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI378673 A/Singapore/GP1132/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI378665 A/Singapore/GP1127/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI378657 A/Singapore/GP1124/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI378649 A/Singapore/GP1122/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI378641 A/Singapore/GP1120/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI378633 A/Singapore/GP1114/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI378621 A/Singapore/GP1102/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI378613 A/Singapore/GP1099/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI378605 A/Singapore/GP1097/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI378597 A/Singapore/GP1094/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI378589 A/Singapore/GP1092/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI378581 A/Singapore/GP1090/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI378573 A/Singapore/GP1087/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI378557 A/Singapore/GP1020/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI376296 A/Scotland/Aberdeen_13/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI376267 A/Scotland/Paisley_417557/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI376053 A/Hong Kong/H090-793-V20/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI376045 A/Hong Kong/H090-793-V10/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI376021 A/Hong Kong/H090-779-V22/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI376013 A/Hong Kong/H090-779-V21/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI376005 A/Hong Kong/H090-779-V12/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI375997 A/Hong Kong/H090-779-V10/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI375989 A/Hong Kong/H090-774-V10/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI375973 A/Hong Kong/H090-771-V10/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI375933 A/Hong Kong/H090-759-V10/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI375917 A/Hong Kong/H090-757-V10/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI375909 A/Hong Kong/H090-751-V34/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI375901 A/Hong Kong/H090-751-V31/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI375893 A/Hong Kong/H090-751-V24/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI375885 A/Hong Kong/H090-751-V23/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI375869 A/Hong Kong/H090-751-V10/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI375829 A/Hong Kong/H090-722-V10/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI375821 A/Hong Kong/H090-721-V10/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI375813 A/Hong Kong/H090-712-V24/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI375805 A/Hong Kong/H090-712-V20/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI375797 A/Hong Kong/H090-712-V14/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI375789 A/Hong Kong/H090-712-V10/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI375765 A/Hong Kong/H090-701-V10/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI375757 A/Hong Kong/H090-698-V20/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI375749 A/Hong Kong/H090-693-V10/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI375693 A/Hong Kong/H090-678-V10/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)
EPI375669 A/Hong Kong/H090-663-V10/2009 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1393/1400 (99%)

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Thu Jan 31, 2013 7:15 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 44581
Location: Pittsburgh, PA USA
EPI416778 A/elephant seal/California/2/2010 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI414130 A/Mexico City/INERPHAC4/2010 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI408452 A/Wurzburg/INS578/2010 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI406749 A/Mexico City/INER18/2010 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI406723 A/Mexico City/INER14/2009 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI406706 A/Mexico City/INER13/2009 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI406698 A/Mexico City/INER12/2009 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI405741 A/Viet Nam/001-1020/2009 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI405733 A/Viet Nam/001-1889/2009 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI405717 A/Viet Nam/001-1716/2009 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI405709 A/Viet Nam/001-1424/2009 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI405693 A/Viet Nam/12032001/2009 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI405677 A/Viet Nam/11032017/2009 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI405669 A/Viet Nam/11032016/2009 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI405661 A/Viet Nam/11032010/2009 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI405653 A/Viet Nam/11032006/2009 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI405637 A/Viet Nam/15032004/2009 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI405577 A/Viet Nam/13032079/2009 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI405540 A/Viet Nam/13032060/2009 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI405532 A/Viet Nam/13032059/2009 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI405524 A/Viet Nam/13032051/2009 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI405508 A/Viet Nam/13032044/2009 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI405500 A/Viet Nam/13032040/2009 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI405492 A/Viet Nam/13032037/2009 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI405476 A/Viet Nam/13032035/2009 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI405468 A/Viet Nam/13032030/2009 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI405453 A/Viet Nam/13032016/2009 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI405445 A/Viet Nam/13032015/2009 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI405437 A/Viet Nam/13032011/2009 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI405429 A/Viet Nam/13032009/2009 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI405421 A/Viet Nam/13032008/2009 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI405413 A/Viet Nam/13032002/2009 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI405405 A/Viet Nam/13032001/2009 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI405397 A/Viet Nam/841/2009 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI405389 A/Viet Nam/850/2009 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI405381 A/Viet Nam/823/2009 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI405348 A/Viet Nam/835/2009 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI405340 A/Viet Nam/818/2009 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI405332 A/Viet Nam/811/2009 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI405324 A/Viet Nam/817/2009 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI405316 A/Viet Nam/11032011/2009 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI405312 A/Viet Nam/13032042/2009 (A/H1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI405308 A/Viet Nam/814/2009 (A/H1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI404197 A/Viet Nam/15032002/2009 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI404168 A/England/421/2009 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI403810 A/Northern Ireland/94940033/2009 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI403802 A/Northern Ireland/94940023/2009 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI403771 A/England/94620043/2009 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI403741 A/England/1397/2009 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI403734 A/Northern Ireland/94480417/2009 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI403693 A/England/94200009/2009 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI403687 A/England/93760756/2009 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI403678 A/England/93520038/2009 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI403672 A/England/93320016/2009 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI403664 A/England/646/2009 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI403656 A/England/92980479/2009 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI403648 A/England/688/2009 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI403640 A/England/671/2009 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI403632 A/England/687/2009 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI403625 A/England/685/2009 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI403617 A/England/527/2009 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI403606 A/England/92920018/2009 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI403598 A/England/667/2009 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI403590 A/England/92880002/2009 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI403576 A/England/506/2009 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI399552 A/swine/Minnesota/A01300999/2012 (A/H3N2) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI399490 A/swine/Minnesota/A01301000/2012 (A/H3N2) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI399151 A/swine/Minnesota/A01327764/2012 (A/H3N2) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI399115 A/swine/Minnesota/A01327763/2012 (A/H3N2) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI398128 A/swine/Iowa/A01203809/2012 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI397871 A/TASMANIA/2004/2009 (A/H1N1 pdm09) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI396371 A/England/393/2009 (A/H1N1 pdm09) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI396333 A/England/413/2009 (A/H1N1 pdm09) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI396111 A/England/271/2009 (A/H1N1 pdm09) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI396095 A/England/260/2009 (A/H1N1 pdm09) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI396000 A/England/633/2009 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI395992 A/England/527/2009 (A/H1N1 pdm09) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI395535 A/Reunion/2956-2-M1E/2009 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI395531 A/Reunion/2956-1-M2E/2009 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI395529 A/Reunion/2969-5-M1E/2009 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI395528 A/Reunion/2923-3-M1E/2009 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI395527 A/Reunion/2692-2-M2E/2009 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI395526 A/Reunion/2245-3-M1E/2009 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI395525 A/Reunion/2224-3-M3E/2009 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI395524 A/Reunion/2133-6-M1E/2009 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI395523 A/Reunion/2133-5-M1E/2009 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI395522 A/Reunion/1722-8-M1E/2009 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI395521 A/Reunion/1722-7-M1E/2009 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI395520 A/Reunion/1709-4-M2E/2009 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI395519 A/Reunion/1698-3-M1E/2009 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI395518 A/Reunion/1658-4-M1E/2009 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI395517 A/Reunion/1632-5-M1E/2009 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI395516 A/Reunion/1572-3-M1E/2009 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI395515 A/Reunion/0159-3-M1E/2009 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI395514 A/Reunion/0148-4-M1E/2009 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI395509 A/Reunion/0116-3-M1E/2009 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI392446 A/Scotland/StAndrews_17693/2009 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI392438 A/Scotland/EastKilbride_425383/2009 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI392431 A/Scotland/EastKilbride_420881/2009 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI392423 A/Scotland/EastKilbride_420880/2009 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI392416 A/Scotland/EastKilbride_420875/2009 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI392409 A/Scotland/EastKilbride_420874/2009 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI392405 A/Scotland/EastKilbride_420703/2009 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI392398 A/Scotland/EastKilbride_419809/2009 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI392383 A/Scotland/Paisley_415110/2009 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI392359 A/Scotland/Glasgow_445236/2009 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI392332 A/Scotland/Glasgow_443734/2009 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI392190 A/Scotland/Glasgow_422823/2009 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI392183 A/Scotland/Glasgow_420768/2009 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI392179 A/Scotland/Glasgow_420755/2009 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI392172 A/Scotland/Glasgow_419977/2009 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI392165 A/Scotland/Glasgow_419865/2009 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI392158 A/Scotland/Glasgow_419707/2009 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI392151 A/Scotland/Glasgow_414473/2009 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI392145 A/Scotland/Glasgow_414159/2009 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI392139 A/Scotland/Glasgow_413941/2009 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI392132 A/Scotland/Glasgow_413886/2009 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI392124 A/Scotland/Paisley_413869/2009 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI392118 A/Scotland/Glasgow_413848/2009 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI392111 A/Scotland/Paisley_413739/2009 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI392106 A/Scotland/Glasgow_413608/2009 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI392090 A/Scotland/EastKilbride_412770/2009 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI392083 A/Scotland/Paisley_412666/2009 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI392076 A/Scotland/Glasgow_412313/2009 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI392068 A/Scotland/Glasgow_412311/2009 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI392063 A/Scotland/Glasgow_412286/2009 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI392056 A/Scotland/Glasgow_412118/2009 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI392049 A/Scotland/Livingston_416138/2009 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI392045 A/Scotland/Livingston_412757/2009 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI392038 A/Scotland/Fife_17690/2009 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI392031 A/Scotland/Edinburgh_23151/2009 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI392025 A/Scotland/Edinburgh_21027/2009 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI391458 A/swine/Iowa/A01203126/2012 (A/H1N2) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI391457 A/swine/Iowa/A01203125/2012 (A/H1N2) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI391094 A/swine/Iowa/A01202087/2011 (A/H1N2) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI391093 A/swine/Iowa/A01202086/2011 (A/H1N2) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI390968 A/swine/Iowa/A01049451/2011 (A/H1N2) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI390428 A/reassortant/NYMC X-205 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI390394 A/South Carolina/10/2010 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI387359 A/swine/Shandong/731/2009 (A/H1N1 pdm09) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI387116 A/Scotland/Edinburgh_20203/2009 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI387109 A/Scotland/Edinburgh_17714/2009 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI387087 A/Scotland/Fife_17712/2009 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI387080 A/Scotland/Dumfries_425403/2009 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI387075 A/Scotland/Dundee_10V070791/2010 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI387068 A/Scotland/Dundee_09V502666/2009 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI387061 A/Scotland/Perth_09V502475/2009 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI387040 A/Scotland/Dundee_09V502215/2009 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI387025 A/Scotland/Dundee_09V500800/2009 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI387018 A/Scotland/Dundee_09V500795/2009 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI387011 A/Scotland/StAndrews_09V500630/2009 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI387004 A/Scotland/Dundee_09V500624/2009 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI386990 A/Scotland/Dundee_09V500266/2009 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI386983 A/Scotland/Perth_09V500259/2009 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI386976 A/Scotland/Perth_09V500257/2009 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI386969 A/Scotland/StAndrews_09V500252/2009 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI386948 A/Scotland/Edinburgh_17715/2009 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI386941 A/Scotland/Fife_20234/2009 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI386936 A/Scotland/Aberdeen_8/2009 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI386930 A/Scotland/Aberdeen_7/2009 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI386923 A/Scotland/Aberdeen_6/2009 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI386917 A/Scotland/Aberdeen_5/2009 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI386861 A/Scotland/Inverness_18/2009 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI386854 A/Scotland/Aberdeen_16/2009 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI386847 A/Scotland/Inverness_15/2009 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI385751 A/Singapore/GP4276/2010 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI385740 A/Singapore/GP4255/2010 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI385721 A/Singapore/EN193/2010 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI385595 A/Singapore/TT428/2010 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI385519 A/Singapore/GP3442/2010 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI385511 A/Singapore/GP3395/2010 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI385319 A/Singapore/SS09/2010 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI385311 A/Singapore/SS08/2010 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI385248 A/Singapore/GP1112/2010 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI385225 A/Singapore/TT144/2010 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI385134 A/Singapore/TT123/2010 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI385123 A/Singapore/KK100/2010 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI385099 A/Singapore/KK70/2010 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI385096 A/Singapore/KK80/2010 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI385093 A/Singapore/GP690/2010 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI385090 A/Singapore/GP680/2010 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI385087 A/Singapore/GP811/2010 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI385069 A/Singapore/KK77/2010 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI385063 A/Singapore/GP758/2010 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI385060 A/Singapore/GP735/2010 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI385045 A/Singapore/GP567/2010 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI385025 A/Singapore/GP521/2010 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI385022 A/Singapore/TT37/2010 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI385006 A/Singapore/GP311/2010 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI385002 A/Singapore/GP293/2010 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI384998 A/Singapore/GP266/2010 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI384978 A/Singapore/GP75/2010 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI384874 A/Singapore/TT01/2010 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI384854 A/Singapore/GP64/2010 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI384768 A/swine/Minnesota/A01134593/2010 (A/H1N2) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI384751 A/swine/Minnesota/A01134248/2011 (A/H1N2) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI384750 A/swine/Minnesota/A01134236/2011 (A/H1N2) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI384749 A/swine/Minnesota/A01134226/2011 (A/H1N2) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI384740 A/swine/Minnesota/A01116381/2011 (A/H3N2) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI384734 A/swine/Minnesota/A01116330/2011 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI384725 A/swine/Minnesota/A00907734/2011 (A/H3N2) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI384687 A/swine/Minnesota/A01201102/2011 (A/H1N2) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI384685 A/swine/Oklahoma/A01134906/2011 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI384668 A/swine/Minnesota/A01076209/2010 (A/H1N2) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI384658 A/swine/Illinois/A01076194/2010 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI384656 A/swine/North Carolina/A01076192/2010 (A/H1N2) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI384650 A/swine/North Carolina/A01076185/2010 (A/H1N2) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI384638 A/swine/Minnesota/A01047500/2010 (A/H1N2) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI384626 A/swine/Minnesota/A01047911/2010 (A/H1N2) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI384615 A/swine/Illinois/A01076179/2009 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI384611 A/swine/Oklahoma/A01134901/2011 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI384610 A/swine/Oklahoma/A01134903/2011 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI384597 A/swine/Minnesota/A01201667/2011 (A/H1N2) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI384567 A/swine/Illinois/A01134671/2011 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI384555 A/swine/Minnesota/A01134592/2010 (A/H1N2) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI384534 A/swine/Minnesota/A01134524/2011 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI384507 A/swine/Minnesota/A01134246/2011 (A/H1N2) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI384504 A/swine/Minnesota/A01134235/2011 (A/H1N2) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI384501 A/swine/Minnesota/A01134221/2011 (A/H1N2) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI384449 A/swine/USA/11_125/2011 (A/H1N2) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI384435 A/swine/Minnesota/A01116286/2011 (A/H1N2) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI384432 A/swine/Minnesota/A00907733/2011 (A/H3N2) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI384351 A/swine/North Carolina/A01076198/2010 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI384346 A/swine/North Carolina/A01076184/2010 (A/H1N2) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI384343 A/swine/North Carolina/A01076176/2009 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI384337 A/swine/Minnesota/A01116364/2010 (A/H1N2) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI384334 A/swine/USA/11_123/2011 (A/H1N2) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI384333 A/swine/USA/10_98/2010 (A/H1N2) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI384332 A/swine/USA/10_95/2010 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI384325 A/swine/USA/10_72/2010 (A/H1N2) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI384309 A/swine/Illinois/A01047715/2010 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI384303 A/swine/Minnesota/A01047499/2010 (A/H1N2) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI384296 A/swine/USA/A01076122/2010 (A/H1N2) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI384282 A/swine/Minnesota/A01047910/2010 (A/H1N2) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI384279 A/swine/Minnesota/A01047909/2010 (A/H1N2) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI384258 A/swine/Illinois/A01076767/2010 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI384255 A/swine/USA/A01076118/2010 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI382660 A/swine/Taitung/110-2/2010 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI382658 A/swine/Changhua/415-7/2009 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI382655 A/swine/Hwalien/168-4/2009 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI382652 A/swine/Hwalien/167-7/2009 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI382178 A/Yamaguchi/247/2009 (A/H1N1 pdm09) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI382170 A/Yamaguchi/217/2009 (A/H1N1 pdm09) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI382100 A/Gunma/287/2009 (A/H1N1 pdm09) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI380755 A/Singapore/ON822/2009 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI380740 A/Singapore/ON816/2009 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI380732 A/Singapore/ON812/2009 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI380724 A/Singapore/ON811/2009 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI380708 A/Singapore/ON808/2009 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)
EPI380704 A/Singapore/ON807/2009 (A/H1N1) segment 7 (MP) 1399.0 0.000000e+00 757/757 (100%)

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Thu Jan 31, 2013 7:17 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 44581
Location: Pittsburgh, PA USA
Align Segment-ID Name Score E-Value Identity
EPI416772 A/elephant seal/California/2/2010 (A/H1N1) segment 1 (PB2) 4181.9 0.000000e+00 2264/2264 (100%)
EPI416754 A/Elephant seal/California/1/2010 (A/H1N1) segment 1 (PB2) 4181.9 0.000000e+00 2264/2264 (100%)
EPI308800 A/San Diego/INS49/2009 (A/H1N1) segment 1 (PB2) 4165.3 0.000000e+00 2261/2264 (99%)
EPI270893 A/San Diego/INS203/2009 (A/H1N1 pdm09) segment 1 (PB2) 4165.3 0.000000e+00 2261/2264 (99%)
EPI270885 A/San Diego/INS202/2009 (A/H1N1 pdm09) segment 1 (PB2) 4165.3 0.000000e+00 2261/2264 (99%)
EPI270470 A/California/VRDL113/2009 (A/H1N1 pdm09) segment 1 (PB2) 4165.3 0.000000e+00 2261/2264 (99%)
EPI252093 A/Vermont/01/2010 (A/H1N1 pdm09) segment 1 (PB2) 4165.3 0.000000e+00 2261/2264 (99%)
EPI246985 A/San Diego/INS65/2009 (A/H1N1 pdm09) segment 1 (PB2) 4165.3 0.000000e+00 2261/2264 (99%)
EPI308599 A/San Diego/INS62/2009 (A/H1N1) segment 1 (PB2) 4159.8 0.000000e+00 2260/2264 (99%)
EPI283209 A/Managua/5295.02/2009 (A/H1N1) segment 1 (PB2) 4159.8 0.000000e+00 2260/2264 (99%)
EPI270630 A/California/VRDL133/2009 (A/H1N1 pdm09) segment 1 (PB2) 4159.8 0.000000e+00 2260/2264 (99%)
EPI270606 A/California/VRDL130/2009 (A/H1N1 pdm09) segment 1 (PB2) 4159.8 0.000000e+00 2260/2264 (99%)
EPI254751 A/California/VRDL86/2009 (A/H1N1 pdm09) segment 1 (PB2) 4159.8 0.000000e+00 2260/2264 (99%)
EPI254743 A/California/VRDL85/2009 (A/H1N1 pdm09) segment 1 (PB2) 4159.8 0.000000e+00 2260/2264 (99%)
EPI253055 A/Texas/JMS411/2009 (A/H1N1 pdm09) segment 1 (PB2) 4159.8 0.000000e+00 2260/2264 (99%)
EPI249771 A/Wisconsin/629-S1425/2009 (A/H1N1 pdm09) segment 1 (PB2) 4159.8 0.000000e+00 2260/2264 (99%)
EPI246969 A/San Diego/INS61/2009 (A/H1N1 pdm09) segment 1 (PB2) 4159.8 0.000000e+00 2260/2264 (99%)
EPI245625 A/San Diego/INS70/2009 (A/H1N1 pdm09) segment 1 (PB2) 4159.8 0.000000e+00 2260/2264 (99%)
EPI245561 A/San Diego/INS34/2009 (A/H1N1 pdm09) segment 1 (PB2) 4159.8 0.000000e+00 2260/2264 (99%)
EPI245553 A/San Diego/INS16/2009 (A/H1N1 pdm09) segment 1 (PB2) 4159.8 0.000000e+00 2260/2264 (99%)
EPI245309 A/District of Columbia/INS18/2009 (A/H1N1 pdm09) segment 1 (PB2) 4159.8 0.000000e+00 2260/2264 (99%)
EPI245292 A/California/VRDL78/2009 (A/H1N1 pdm09) segment 1 (PB2) 4159.8 0.000000e+00 2260/2264 (99%)
EPI245260 A/California/VRDL73/2009 (A/H1N1 pdm09) segment 1 (PB2) 4159.8 0.000000e+00 2260/2264 (99%)
EPI245244 A/California/VRDL18/2009 (A/H1N1 pdm09) segment 1 (PB2) 4159.8 0.000000e+00 2260/2264 (99%)
EPI245228 A/California/VRDL12/2009 (A/H1N1 pdm09) segment 1 (PB2) 4159.8 0.000000e+00 2260/2264 (99%)
EPI237259 A/California/VRDL64/2009 (A/H1N1 pdm09) segment 1 (PB2) 4159.8 0.000000e+00 2260/2264 (99%)
EPI237235 A/California/VRDL58/2009 (A/H1N1 pdm09) segment 1 (PB2) 4159.8 0.000000e+00 2260/2264 (99%)
EPI237219 A/California/VRDL53/2009 (A/H1N1 pdm09) segment 1 (PB2) 4159.8 0.000000e+00 2260/2264 (99%)
EPI237019 A/California/VRDL23/2009 (A/H1N1 pdm09) segment 1 (PB2) 4159.8 0.000000e+00 2260/2264 (99%)
EPI223871 A/Texas/45072273/2009 (A/H1N1 pdm09) segment 1 (PB2) 4159.8 0.000000e+00 2260/2264 (99%)
EPI182712 A/New York/3211/2009 (A/H1N1 pdm09) segment 1 (PB2) 4159.8 0.000000e+00 2260/2264 (99%)
EPI245577 A/San Diego/INS42/2009 (A/H1N1 pdm09) segment 1 (PB2) 4156.1 0.000000e+00 2259/2264 (99%)
EPI404163 A/England/421/2009 (A/H1N1) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI403650 A/England/92980479/2009 (A/H1N1) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI403634 A/England/671/2009 (A/H1N1) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI396329 A/England/413/2009 (A/H1N1 pdm09) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI392426 A/Scotland/EastKilbride_420881/2009 (A/H1N1) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI392418 A/Scotland/EastKilbride_420880/2009 (A/H1N1) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI392411 A/Scotland/EastKilbride_420875/2009 (A/H1N1) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI392400 A/Scotland/EastKilbride_420703/2009 (A/H1N1) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI392393 A/Scotland/EastKilbride_419809/2009 (A/H1N1) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI392373 A/Scotland/Paisley_413960/2009 (A/H1N1) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI392367 A/Scotland/Paisley_412182/2009 (A/H1N1) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI392185 A/Scotland/Glasgow_422823/2009 (A/H1N1) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI392174 A/Scotland/Glasgow_420755/2009 (A/H1N1) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI392160 A/Scotland/Glasgow_419865/2009 (A/H1N1) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI392153 A/Scotland/Glasgow_419707/2009 (A/H1N1) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI392141 A/Scotland/Glasgow_414159/2009 (A/H1N1) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI392134 A/Scotland/Glasgow_413941/2009 (A/H1N1) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI392126 A/Scotland/Glasgow_413886/2009 (A/H1N1) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI392120 A/Scotland/Paisley_413869/2009 (A/H1N1) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI392113 A/Scotland/Glasgow_413848/2009 (A/H1N1) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI392085 A/Scotland/EastKilbride_412770/2009 (A/H1N1) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI392078 A/Scotland/Paisley_412666/2009 (A/H1N1) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI392070 A/Scotland/Glasgow_412313/2009 (A/H1N1) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI392065 A/Scotland/Glasgow_412311/2009 (A/H1N1) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI392058 A/Scotland/Glasgow_412286/2009 (A/H1N1) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI392051 A/Scotland/Glasgow_412118/2009 (A/H1N1) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI392033 A/Scotland/Fife_17690/2009 (A/H1N1) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI392020 A/Scotland/Edinburgh_21027/2009 (A/H1N1) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI380710 A/Singapore/ON809/2009 (A/H1N1) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI380670 A/Singapore/ON803/2009 (A/H1N1) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI380599 A/Singapore/ON496/2009 (A/H1N1) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI380550 A/Singapore/ON2416/2009 (A/H1N1 pdm09) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI380412 A/Singapore/ON226/2009 (A/H1N1) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI379667 A/Singapore/ON1063/2009 (A/H1N1) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI378700 A/Singapore/GP1146/2009 (A/H1N1) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI378668 A/Singapore/GP1132/2009 (A/H1N1) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI378628 A/Singapore/GP1114/2009 (A/H1N1) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI375930 A/Hong Kong/H090-758-V10/2009 (A/H1N1) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI375818 A/Hong Kong/H090-712-V24/2009 (A/H1N1) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI375810 A/Hong Kong/H090-712-V20/2009 (A/H1N1) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI375802 A/Hong Kong/H090-712-V14/2009 (A/H1N1) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI375794 A/Hong Kong/H090-712-V10/2009 (A/H1N1) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI375754 A/Hong Kong/H090-693-V10/2009 (A/H1N1) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI375746 A/Hong Kong/H090-684-V23/2009 (A/H1N1) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI375738 A/Hong Kong/H090-684-V10/2009 (A/H1N1) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI375646 A/Hong Kong/H090-693-V20/2009 (A/H1N1) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI374994 A/Scotland/Paisley_417557/2009 (A/H1N1) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI374198 A/Malaysia/2072040/2009 (A/H1N1) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI362164 A/Hong Kong/H090-758-V10/2009 (A/H1N1) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI362012 A/Hong Kong/H090-712-V24/2009 (A/H1N1) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI362004 A/Hong Kong/H090-712-V20/2009 (A/H1N1) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI361996 A/Hong Kong/H090-712-V1_4/2009 (A/H1N1) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI361988 A/Hong Kong/H090-712-V10/2009 (A/H1N1) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI361940 A/Hong Kong/H090-693-V20/2009 (A/H1N1) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI361932 A/Hong Kong/H090-693-V10/2009 (A/H1N1) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI361923 A/Hong Kong/H090-684-V23/2009 (A/H1N1) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI361915 A/Hong Kong/H090-684-V10/2009 (A/H1N1) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI356146 A/Argentina/9721/2009(H1N1) (A/H1N1) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI356134 A/Argentina/9597/2009(H1N1) (A/H1N1) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI356126 A/Argentina/9583/2009(H1N1) (A/H1N1) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI356114 A/Argentina/9452/2009(H1N1) (A/H1N1) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI356106 A/Argentina/9333/2009(H1N1) (A/H1N1) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI356090 A/Argentina/8989/2009(H1N1) (A/H1N1) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI356086 A/Argentina/8673/2009(H1N1) (A/H1N1) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI356082 A/Argentina/8574/2009(H1N1) (A/H1N1) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI356062 A/Argentina/7953/2009(H1N1) (A/H1N1) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI356060 A/Argentina/7937/2009(H1N1) (A/H1N1) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI356052 A/Argentina/7649/2009(H1N1) (A/H1N1) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI353893 A/Helsinki/Vi3/2009 (A/H1N1) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI350287 A/Helsinki/P15/2009 (A/H1N1 pdm09) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI349438 A/Scotland/10/2009 (A/H1N1 pdm09) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI349422 A/England/434/2009 (A/H1N1 pdm09) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI348774 A/England/385/2009 (A/H1N1 pdm09) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI348710 A/England/XFL00482/2009 (A/H1N1 pdm09) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI348326 A/England/551/2009 (A/H1N1 pdm09) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI348318 A/England/200/2009 (A/H1N1 pdm09) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI348310 A/England/207/2009 (A/H1N1 pdm09) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI348273 A/England/202/2009 (A/H1N1 pdm09) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI348265 A/England/675/2009 (A/H1N1 pdm09) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI348229 A/Scotland/91800799/2009 (A/H1N1 pdm09) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI348218 A/Scotland/91800797/2009 (A/H1N1 pdm09) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI324366 A/California/VRDL353/2009 (A/H0) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI323810 A/England/421/2009 (A/H1N1 pdm09) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI323798 A/Ireland/4/2009 (A/H1N1 pdm09) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI323793 A/Ireland/10/2009 (A/H1N1 pdm09) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI323791 A/Ireland/7/2009 (A/H1N1 pdm09) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI323777 A/England/380/2009 (A/H1N1 pdm09) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI323771 A/England/366/2009 (A/H1N1 pdm09) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI323765 A/Scotland/8/2009 (A/H1N1 pdm09) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI323735 A/Ireland/1/2009 (A/H1N1 pdm09) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI320301 A/Australia/17/2009 (A/H1N1) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI313194 A/Frankfurt/INS93/2009 (A/H1N1) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI308872 A/San Diego/INS194/2009 (A/H1N1) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI308784 A/Pensacola/INS39/2009 (A/H1N1) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI308760 A/San Diego/INS07/2009 (A/H1N1) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI308298 A/San Diego/WRAIR1656P/2009 (A/H1N1) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI308226 A/San Diego/WRAIR1643P/2009 (A/H1N1) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI300650 A/Argentina/HNRG8/2009 (A/H1N1 pdm09) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI300632 A/Argentina/HNRG45/2009 (A/H1N1 pdm09) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI300602 A/Argentina/HNRG21/2009 (A/H1N1 pdm09) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI300597 A/Argentina/HNRG15/2009 (A/H1N1 pdm09) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI288265 A/Boston/655/2009 (A/H1N1) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI288201 A/Boston/591/2009 (A/H1N1) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI288080 A/Chile/3586/2009 (A/H1N1) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI288048 A/Chile/3369/2009 (A/H1N1) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI283217 A/Managua/4451.02/2009 (A/H1N1) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI283145 A/Managua/466.01/2009 (A/H1N1) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI283016 A/San Diego/WR1639P/2009 (A/H1N1) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI282940 A/San Diego/WR1627P/2009 (A/H1N1) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI282574 A/Managua/585.01/2009 (A/H1N1) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI282542 A/Managua/4063.01/2009 (A/H1N1) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI282462 A/Managua/4702.04/2009 (A/H1N1) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI282342 A/Managua/4407.02/2009 (A/H1N1) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI282278 A/Managua/2339.03/2009 (A/H1N1) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI277466 A/New York/NHRC0004/2009 (A/H1N1 pdm09) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI277458 A/New York/NHRC0003/2009 (A/H1N1 pdm09) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI277450 A/New York/NHRC0002/2009 (A/H1N1 pdm09) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI277378 A/Guam/NHRC0032/2009 (A/H1N1 pdm09) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI277354 A/Guam/NHRC0029/2009 (A/H1N1 pdm09) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI277346 A/Guam/NHRC0007/2009 (A/H1N1 pdm09) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI277338 A/Guam/NHRC0006/2009 (A/H1N1 pdm09) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI277039 A/Singapore/478/2009 (A/H1N1 pdm09) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI275449 A/Guangdong/45/2009 (A/H1N1 pdm09) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI275118 A/Vienna/INS366/2009 (A/H1N1 pdm09) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI274926 A/Guam/NHRC0021/2009 (A/H1N1 pdm09) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI271512 A/San Diego/INS217/2009 (A/H1N1 pdm09) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI270989 A/Hvidovre/INS288/2009 (A/H1N1 pdm09) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI270845 A/San Diego/INS195/2009 (A/H1N1 pdm09) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI270646 A/California/VRDL2/2010 (A/H1N1 pdm09) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI270558 A/California/VRDL124/2009 (A/H1N1 pdm09) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI270462 A/California/VRDL112/2009 (A/H1N1 pdm09) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI267891 A/Argentina/19656/2009 (A/H1N1 pdm09) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI267773 A/New York/7421/2009 (A/H1N1 pdm09) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI267448 A/ENG/385/2009 (A/H1N1 pdm09) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI267392 A/ENG/XFL00482/2009 (A/H1N1 pdm09) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI267376 A/ENG/675/2009 (A/H1N1 pdm09) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI267224 A/SC/10/2009 (A/H1N1 pdm09) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI266689 A/Boston/134/2009 (A/H1N1 pdm09) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI266345 A/Mexico city/CIA11/2009 (A/H1N1 pdm09) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI266338 A/Mexico city/CIA10/2009 (A/H1N1 pdm09) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI258635 A/District of Columbia/INS45/2009 (A/H1N1 pdm09) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI258611 A/California/VRDL99/2009 (A/H1N1 pdm09) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI257534 A/Hunan-Yuhua/SWL15/2010 (A/H1N1 pdm09) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI257194 A/SAPPORO/190/2009 (A/H1N1 pdm09) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI256735 A/Mexico city/CIA9/2009 (A/H1N1 pdm09) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI256724 A/Mexico city/CIA7/2009 (A/H1N1 pdm09) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI256712 A/Mexico city/CIA5/2009 (A/H1N1 pdm09) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI256686 A/Mexico city/CIA1/2009 (A/H1N1 pdm09) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI256148 A/Gansu-Chengguan/SWL12770/2009 (A/H1N1 pdm09) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI256144 A/Hubei-Hongshan/SWL1288/2009 (A/H1N1 pdm09) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI254983 A/New York/6976/2009 (A/H1N1 pdm09) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI254975 A/New York/6949/2009 (A/H1N1 pdm09) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI254090 A/Texas/JMS400/2009 (A/H1N1 pdm09) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI253941 A/New York/18/2009 (A/H1N1 pdm09) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI253934 A/New Zealand/874/2009 (A/H1N1 pdm09) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI253540 A/Swine/Italy/290271/2009 (A/H1N1 pdm09) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI253403 A/Henan/SWL14/2009 (A/H1N1 pdm09) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI253379 A/Guangdong/SWL27/2009 (A/H1N1 pdm09) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI252983 A/Texas/JMS399/2009 (A/H1N1 pdm09) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI252975 A/Texas/JMS398/2009 (A/H1N1 pdm09) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI252967 A/Texas/JMS397/2009 (A/H1N1 pdm09) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI252863 A/Texas/JMS383/2009 (A/H1N1 pdm09) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI252775 A/Texas/JMS364/2009 (A/H1N1 pdm09) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI252767 A/Texas/JMS363/2009 (A/H1N1 pdm09) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI252711 A/Texas/46240925/2009 (A/H1N1 pdm09) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI252623 A/San Diego/INS104/2009 (A/H1N1 pdm09) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI252607 A/San Diego/INS102/2009 (A/H1N1 pdm09) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI252511 A/Ontario/315637/2009 (A/H1N1 pdm09) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI252495 A/Ontario/315187/2009 (A/H1N1 pdm09) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI252471 A/Ontario/315047/2009 (A/H1N1 pdm09) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI252463 A/Ontario/315015/2009 (A/H1N1 pdm09) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI252407 A/Ontario/308054/2009 (A/H1N1 pdm09) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI252399 A/Ontario/305598/2009 (A/H1N1 pdm09) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI252391 A/Ontario/305139/2009 (A/H1N1 pdm09) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI252327 A/Ontario/235657/2009 (A/H1N1 pdm09) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI252319 A/Ontario/222656/2009 (A/H1N1 pdm09) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI252201 A/New Zealand/871/2009 (A/H1N1 pdm09) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI252099 A/Wisconsin/01/2010 (A/H1N1 pdm09) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI252020 A/Bangladesh/2001/2009 (A/H1N1 pdm09) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI251966 A/Belgorod/01/2009 (A/H1N1 pdm09) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI249675 A/Texas/461917783/2009 (A/H1N1 pdm09) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI249595 A/Managua/4218.01/2009 (A/H1N1 pdm09) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI249369 A/Wisconsin/629-D02100/2009 (A/H1N1 pdm09) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI249033 A/Managua/164.01/2009 (A/H1N1 pdm09) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI248439 A/Wisconsin/629-S1398/2009 (A/H1N1 pdm09) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI248431 A/Wisconsin/629-S1397/2009 (A/H1N1 pdm09) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI248407 A/Wisconsin/629-S1350/2009 (A/H1N1 pdm09) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI248399 A/Wisconsin/629-S1348/2009 (A/H1N1 pdm09) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI248311 A/Wisconsin/629-D02299/2009 (A/H1N1 pdm09) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI248135 A/Wisconsin/629-D01355/2009 (A/H1N1 pdm09) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI248079 A/Wisconsin/629-D01014/2009 (A/H1N1 pdm09) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI248047 A/Wisconsin/629-D00936/2009 (A/H1N1 pdm09) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI247879 A/Wisconsin/629-D00410/2009 (A/H1N1 pdm09) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI247758 A/Texas/46181235/2009 (A/H1N1 pdm09) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI247726 A/San Diego/INS08/2009 (A/H1N1 pdm09) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI247686 A/New York/5276/2009 (A/H1N1 pdm09) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI247678 A/New York/5271/2009 (A/H1N1 pdm09) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI247670 A/New York/5221/2009 (A/H1N1 pdm09) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI247638 A/New York/5161/2009 (A/H1N1 pdm09) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI247111 A/Stockholm/67/2009 (A/H1N1 pdm09) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI246977 A/San Diego/INS63/2009 (A/H1N1 pdm09) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI246961 A/San Diego/INS60/2009 (A/H1N1 pdm09) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI246953 A/San Diego/INS57/2009 (A/H1N1 pdm09) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI246929 A/San Diego/INS51/2009 (A/H1N1 pdm09) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI246785 A/New York/6473/2009 (A/H1N1 pdm09) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI246673 A/New York/5976/2009 (A/H1N1 pdm09) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI246409 A/Brussels/INS71/2009 (A/H1N1 pdm09) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI245601 A/San Diego/INS53/2009 (A/H1N1 pdm09) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI245593 A/San Diego/INS52/2009 (A/H1N1 pdm09) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI245513 A/San Diego/INS06/2009 (A/H1N1 pdm09) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI245505 A/San Diego/INS05/2009 (A/H1N1 pdm09) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI245497 A/San Diego/INS04/2009 (A/H1N1 pdm09) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI245481 A/San Diego/INS02/2009 (A/H1N1 pdm09) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI245473 A/San Diego/INS01/2009 (A/H1N1 pdm09) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI245457 A/Pensacola/INS38/2009 (A/H1N1 pdm09) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI245252 A/California/VRDL72/2009 (A/H1N1 pdm09) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI245172 A/Australia/73/2009 (A/H1N1 pdm09) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)
EPI245148 A/Australia/7/2009 (A/H1N1 pdm09) segment 1 (PB2) 4154.2 0.000000e+00 2259/2264 (99%)

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Thu Jan 31, 2013 7:18 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 44581
Location: Pittsburgh, PA USA
EPI416773 A/elephant seal/California/2/2010 (A/H1N1) segment 2 (PB1) 4185.6 0.000000e+00 2266/2266 (100%)
EPI416755 A/Elephant seal/California/1/2010 (A/H1N1) segment 2 (PB1) 4183.8 0.000000e+00 2265/2265 (100%)
EPI255016 A/New York/7036/2009 (A/H1N1 pdm09) segment 2 (PB1) 4169.0 0.000000e+00 2263/2266 (99%)
EPI270884 A/San Diego/INS202/2009 (A/H1N1 pdm09) segment 2 (PB1) 4163.5 0.000000e+00 2262/2266 (99%)
EPI245578 A/San Diego/INS42/2009 (A/H1N1 pdm09) segment 2 (PB1) 4163.5 0.000000e+00 2262/2266 (99%)
EPI246986 A/San Diego/INS65/2009 (A/H1N1 pdm09) segment 2 (PB1) 4157.9 0.000000e+00 2261/2266 (99%)
EPI245310 A/District of Columbia/INS18/2009 (A/H1N1 pdm09) segment 2 (PB1) 4157.9 0.000000e+00 2261/2266 (99%)
EPI252094 A/Vermont/01/2010 (A/H1N1 pdm09) segment 2 (PB1) 4154.2 0.000000e+00 2260/2266 (99%)
EPI270892 A/San Diego/INS203/2009 (A/H1N1 pdm09) segment 2 (PB1) 4152.4 0.000000e+00 2260/2266 (99%)
EPI253056 A/Texas/JMS411/2009 (A/H1N1 pdm09) segment 2 (PB1) 4152.4 0.000000e+00 2260/2266 (99%)
EPI246786 A/New York/6473/2009 (A/H1N1 pdm09) segment 2 (PB1) 4152.4 0.000000e+00 2260/2266 (99%)
EPI400139 A/Kentucky/180/2010 (A/H1N1) segment 2 (PB1) 4146.8 0.000000e+00 2259/2266 (99%)
EPI347062 A/Wisconsin/02/2010 (A/H1N1 pdm09) segment 2 (PB1) 4146.8 0.000000e+00 2259/2266 (99%)
EPI273827 A/Kentucky/06/2010 (A/H1N1 pdm09) segment 2 (PB1) 4146.8 0.000000e+00 2259/2266 (99%)
EPI270477 A/California/VRDL114/2009 (A/H1N1 pdm09) segment 2 (PB1) 4146.8 0.000000e+00 2259/2266 (99%)
EPI270469 A/California/VRDL113/2009 (A/H1N1 pdm09) segment 2 (PB1) 4146.8 0.000000e+00 2259/2266 (99%)
EPI270405 A/California/VRDL105/2009 (A/H1N1 pdm09) segment 2 (PB1) 4146.8 0.000000e+00 2259/2266 (99%)
EPI258900 A/Wisconsin/629-D00830/2009 (A/H1N1 pdm09) segment 2 (PB1) 4146.8 0.000000e+00 2259/2266 (99%)
EPI258884 A/Wisconsin/629-D00692/2009 (A/H1N1 pdm09) segment 2 (PB1) 4146.8 0.000000e+00 2259/2266 (99%)
EPI258596 A/California/VRDL97/2009 (A/H1N1 pdm09) segment 2 (PB1) 4146.8 0.000000e+00 2259/2266 (99%)
EPI258476 A/California/VRDL100/2009 (A/H1N1 pdm09) segment 2 (PB1) 4146.8 0.000000e+00 2259/2266 (99%)
EPI254704 A/California/VRDL80/2009 (A/H1N1 pdm09) segment 2 (PB1) 4146.8 0.000000e+00 2259/2266 (99%)
EPI251972 A/Arkansas/09/2009 (A/H1N1 pdm09) segment 2 (PB1) 4146.8 0.000000e+00 2259/2266 (99%)
EPI249780 A/Wisconsin/629-S1431/2009 (A/H1N1 pdm09) segment 2 (PB1) 4146.8 0.000000e+00 2259/2266 (99%)
EPI249314 A/Wisconsin/629-D01582/2009 (A/H1N1 pdm09) segment 2 (PB1) 4146.8 0.000000e+00 2259/2266 (99%)
EPI249266 A/Wisconsin/629-D01015/2009 (A/H1N1 pdm09) segment 2 (PB1) 4146.8 0.000000e+00 2259/2266 (99%)
EPI249258 A/Wisconsin/629-D00996/2009 (A/H1N1 pdm09) segment 2 (PB1) 4146.8 0.000000e+00 2259/2266 (99%)
EPI248408 A/Wisconsin/629-S1350/2009 (A/H1N1 pdm09) segment 2 (PB1) 4146.8 0.000000e+00 2259/2266 (99%)
EPI248400 A/Wisconsin/629-S1348/2009 (A/H1N1 pdm09) segment 2 (PB1) 4146.8 0.000000e+00 2259/2266 (99%)
EPI248296 A/Wisconsin/629-D02090/2009 (A/H1N1 pdm09) segment 2 (PB1) 4146.8 0.000000e+00 2259/2266 (99%)
EPI248232 A/Wisconsin/629-D01749/2009 (A/H1N1 pdm09) segment 2 (PB1) 4146.8 0.000000e+00 2259/2266 (99%)
EPI247912 A/Wisconsin/629-D00557/2009 (A/H1N1 pdm09) segment 2 (PB1) 4146.8 0.000000e+00 2259/2266 (99%)
EPI247026 A/Wisconsin/629-D02133/2009 (A/H1N1 pdm09) segment 2 (PB1) 4146.8 0.000000e+00 2259/2266 (99%)
EPI245360 A/District of Columbia/INS27/2009 (A/H1N1 pdm09) segment 2 (PB1) 4146.8 0.000000e+00 2259/2266 (99%)
EPI245343 A/District of Columbia/INS24/2009 (A/H1N1 pdm09) segment 2 (PB1) 4146.8 0.000000e+00 2259/2266 (99%)
EPI237276 A/California/VRDL67/2009 (A/H1N1 pdm09) segment 2 (PB1) 4146.8 0.000000e+00 2259/2266 (99%)
EPI237116 A/California/VRDL36/2009 (A/H1N1 pdm09) segment 2 (PB1) 4146.8 0.000000e+00 2259/2266 (99%)
EPI223766 A/Texas/45071524/2009 (A/H1N1 pdm09) segment 2 (PB1) 4146.8 0.000000e+00 2259/2266 (99%)
EPI223606 A/Texas/45103998/2009 (A/H1N1 pdm09) segment 2 (PB1) 4146.8 0.000000e+00 2259/2266 (99%)
EPI304353 A/Canada-SK/RV2929/2009 (A/H1N1 pdm09) segment 2 (PB1) 4145.0 0.000000e+00 2258/2265 (99%)
EPI249410 A/Wisconsin/629-S1417/2009 (A/H1N1 pdm09) segment 2 (PB1) 4143.2 0.000000e+00 2258/2266 (99%)
EPI315489 A/Boston/650/2009 (A/H1N1) segment 2 (PB1) 4141.3 0.000000e+00 2258/2266 (99%)
EPI313133 A/Boston/694/2009 (A/H1N1) segment 2 (PB1) 4141.3 0.000000e+00 2258/2266 (99%)
EPI308799 A/San Diego/INS49/2009 (A/H1N1) segment 2 (PB1) 4141.3 0.000000e+00 2258/2266 (99%)
EPI288328 A/Boston/701/2009 (A/H1N1) segment 2 (PB1) 4141.3 0.000000e+00 2258/2266 (99%)
EPI288216 A/Boston/602/2009 (A/H1N1) segment 2 (PB1) 4141.3 0.000000e+00 2258/2266 (99%)
EPI288208 A/Boston/595/2009 (A/H1N1) segment 2 (PB1) 4141.3 0.000000e+00 2258/2266 (99%)
EPI271273 A/Bochum/INS250/2009 (A/H1N1 pdm09) segment 2 (PB1) 4141.3 0.000000e+00 2258/2266 (99%)
EPI270645 A/California/VRDL2/2010 (A/H1N1 pdm09) segment 2 (PB1) 4141.3 0.000000e+00 2258/2266 (99%)
EPI270573 A/California/VRDL126/2009 (A/H1N1 pdm09) segment 2 (PB1) 4141.3 0.000000e+00 2258/2266 (99%)
EPI270541 A/California/VRDL122/2009 (A/H1N1 pdm09) segment 2 (PB1) 4141.3 0.000000e+00 2258/2266 (99%)
EPI270517 A/California/VRDL119/2009 (A/H1N1 pdm09) segment 2 (PB1) 4141.3 0.000000e+00 2258/2266 (99%)
EPI270501 A/California/VRDL117/2009 (A/H1N1 pdm09) segment 2 (PB1) 4141.3 0.000000e+00 2258/2266 (99%)
EPI270429 A/California/VRDL108/2009 (A/H1N1 pdm09) segment 2 (PB1) 4141.3 0.000000e+00 2258/2266 (99%)
EPI270413 A/California/VRDL106/2009 (A/H1N1 pdm09) segment 2 (PB1) 4141.3 0.000000e+00 2258/2266 (99%)
EPI258908 A/Wisconsin/629-D00859/2009 (A/H1N1 pdm09) segment 2 (PB1) 4141.3 0.000000e+00 2258/2266 (99%)
EPI254009 A/Nebraska/02/2010 (A/H1N1 pdm09) segment 2 (PB1) 4141.3 0.000000e+00 2258/2266 (99%)
EPI253040 A/Texas/JMS409/2009 (A/H1N1 pdm09) segment 2 (PB1) 4141.3 0.000000e+00 2258/2266 (99%)
EPI252720 A/Texas/46241654/2009 (A/H1N1 pdm09) segment 2 (PB1) 4141.3 0.000000e+00 2258/2266 (99%)
EPI252640 A/Texas/46193632/2009 (A/H1N1 pdm09) segment 2 (PB1) 4141.3 0.000000e+00 2258/2266 (99%)
EPI252608 A/San Diego/INS102/2009 (A/H1N1 pdm09) segment 2 (PB1) 4141.3 0.000000e+00 2258/2266 (99%)
EPI252528 A/Ontario/328474/2009 (A/H1N1 pdm09) segment 2 (PB1) 4141.3 0.000000e+00 2258/2266 (99%)
EPI249700 A/Texas/JMS375/2009 (A/H1N1 pdm09) segment 2 (PB1) 4141.3 0.000000e+00 2258/2266 (99%)
EPI249692 A/Texas/46193311/2009 (A/H1N1 pdm09) segment 2 (PB1) 4141.3 0.000000e+00 2258/2266 (99%)
EPI249274 A/Wisconsin/629-D01038/2009 (A/H1N1 pdm09) segment 2 (PB1) 4141.3 0.000000e+00 2258/2266 (99%)
EPI248216 A/Wisconsin/629-D01570/2009 (A/H1N1 pdm09) segment 2 (PB1) 4141.3 0.000000e+00 2258/2266 (99%)
EPI248208 A/Wisconsin/629-D01528/2009 (A/H1N1 pdm09) segment 2 (PB1) 4141.3 0.000000e+00 2258/2266 (99%)
EPI247952 A/Wisconsin/629-D00672/2009 (A/H1N1 pdm09) segment 2 (PB1) 4141.3 0.000000e+00 2258/2266 (99%)
EPI247864 A/Wisconsin/629-D00401/2009 (A/H1N1 pdm09) segment 2 (PB1) 4141.3 0.000000e+00 2258/2266 (99%)
EPI247679 A/New York/5271/2009 (A/H1N1 pdm09) segment 2 (PB1) 4141.3 0.000000e+00 2258/2266 (99%)
EPI246970 A/San Diego/INS61/2009 (A/H1N1 pdm09) segment 2 (PB1) 4141.3 0.000000e+00 2258/2266 (99%)
EPI245285 A/California/VRDL76/2009 (A/H1N1 pdm09) segment 2 (PB1) 4141.3 0.000000e+00 2258/2266 (99%)
EPI245253 A/California/VRDL72/2009 (A/H1N1 pdm09) segment 2 (PB1) 4141.3 0.000000e+00 2258/2266 (99%)
EPI237308 A/California/VRDL70/2009 (A/H1N1 pdm09) segment 2 (PB1) 4141.3 0.000000e+00 2258/2266 (99%)
EPI227809 A/Rhode Island/18/2009 (A/H1N1 pdm09) segment 2 (PB1) 4141.3 0.000000e+00 2258/2266 (99%)
EPI304208 A/Canada-ON/RV2914/2009 (A/H1N1 pdm09) segment 2 (PB1) 4139.5 0.000000e+00 2257/2265 (99%)
EPI304145 A/Canada-ON/RV2906/2009 (A/H1N1 pdm09) segment 2 (PB1) 4139.5 0.000000e+00 2257/2265 (99%)
EPI380537 A/Singapore/ON2313/2009 (A/H1N1 pdm09) segment 2 (PB1) 4135.8 0.000000e+00 2257/2266 (99%)
EPI380456 A/Singapore/ON2383/2009 (A/H1N1) segment 2 (PB1) 4135.8 0.000000e+00 2257/2266 (99%)
EPI332543 A/Khon Kaen/INS443/2010 (A/H1N1) segment 2 (PB1) 4135.8 0.000000e+00 2257/2266 (99%)
EPI332287 A/Bangkok/INS482/2010 (A/H1N1) segment 2 (PB1) 4135.8 0.000000e+00 2257/2266 (99%)
EPI332183 A/Bangkok/INS501/2010 (A/H1N1) segment 2 (PB1) 4135.8 0.000000e+00 2257/2266 (99%)
EPI323847 A/England/876/2009 (A/H1N1 pdm09) segment 2 (PB1) 4135.8 0.000000e+00 2257/2266 (99%)
EPI317094 A/Bethesda/NIH106-D0/2009 (A/H1N1 pdm09) segment 2 (PB1) 4135.8 0.000000e+00 2257/2266 (99%)
EPI315529 A/Boston/671/2009 (A/H1N1) segment 2 (PB1) 4135.8 0.000000e+00 2257/2266 (99%)
EPI315497 A/Boston/657/2009 (A/H1N1) segment 2 (PB1) 4135.8 0.000000e+00 2257/2266 (99%)
EPI308759 A/San Diego/INS07/2009 (A/H1N1) segment 2 (PB1) 4135.8 0.000000e+00 2257/2266 (99%)
EPI308619 A/Terrassa/INS94/2009 (A/H1N1) segment 2 (PB1) 4135.8 0.000000e+00 2257/2266 (99%)
EPI288320 A/Boston/698/2009 (A/H1N1) segment 2 (PB1) 4135.8 0.000000e+00 2257/2266 (99%)
EPI288296 A/Boston/672/2009 (A/H1N1) segment 2 (PB1) 4135.8 0.000000e+00 2257/2266 (99%)
EPI283605 A/Aalborg/INS283/2009 (A/H1N1) segment 2 (PB1) 4135.8 0.000000e+00 2257/2266 (99%)
EPI277991 A/Mexico City/WR1765N/2009 (A/H1N1 pdm09) segment 2 (PB1) 4135.8 0.000000e+00 2257/2266 (99%)
EPI271521 A/San Diego/INS218/2009 (A/H1N1 pdm09) segment 2 (PB1) 4135.8 0.000000e+00 2257/2266 (99%)
EPI271097 A/Aarhus/INS240/2009 (A/H1N1 pdm09) segment 2 (PB1) 4135.8 0.000000e+00 2257/2266 (99%)
EPI270868 A/San Diego/INS199/2009 (A/H1N1 pdm09) segment 2 (PB1) 4135.8 0.000000e+00 2257/2266 (99%)
EPI270844 A/San Diego/INS195/2009 (A/H1N1 pdm09) segment 2 (PB1) 4135.8 0.000000e+00 2257/2266 (99%)
EPI270669 A/California/VRDL5/2010 (A/H1N1 pdm09) segment 2 (PB1) 4135.8 0.000000e+00 2257/2266 (99%)
EPI270653 A/California/VRDL3/2010 (A/H1N1 pdm09) segment 2 (PB1) 4135.8 0.000000e+00 2257/2266 (99%)
EPI270493 A/California/VRDL116/2009 (A/H1N1 pdm09) segment 2 (PB1) 4135.8 0.000000e+00 2257/2266 (99%)
EPI270461 A/California/VRDL112/2009 (A/H1N1 pdm09) segment 2 (PB1) 4135.8 0.000000e+00 2257/2266 (99%)
EPI258612 A/California/VRDL99/2009 (A/H1N1 pdm09) segment 2 (PB1) 4135.8 0.000000e+00 2257/2266 (99%)
EPI254768 A/New York/0352/2009 (A/H1N1 pdm09) segment 2 (PB1) 4135.8 0.000000e+00 2257/2266 (99%)
EPI254752 A/California/VRDL86/2009 (A/H1N1 pdm09) segment 2 (PB1) 4135.8 0.000000e+00 2257/2266 (99%)
EPI254744 A/California/VRDL85/2009 (A/H1N1 pdm09) segment 2 (PB1) 4135.8 0.000000e+00 2257/2266 (99%)
EPI254004 A/Louisiana/03/2010 (A/H1N1 pdm09) segment 2 (PB1) 4135.8 0.000000e+00 2257/2266 (99%)
EPI253995 A/Iowa/04/2010 (A/H1N1 pdm09) segment 2 (PB1) 4135.8 0.000000e+00 2257/2266 (99%)
EPI252792 A/Texas/JMS369/2009 (A/H1N1 pdm09) segment 2 (PB1) 4135.8 0.000000e+00 2257/2266 (99%)
EPI252736 A/Texas/JMS358/2009 (A/H1N1 pdm09) segment 2 (PB1) 4135.8 0.000000e+00 2257/2266 (99%)
EPI252664 A/Texas/46221665/2009 (A/H1N1 pdm09) segment 2 (PB1) 4135.8 0.000000e+00 2257/2266 (99%)
EPI252616 A/San Diego/INS103/2009 (A/H1N1 pdm09) segment 2 (PB1) 4135.8 0.000000e+00 2257/2266 (99%)
EPI249740 A/Wisconsin/629-D00938/2009 (A/H1N1 pdm09) segment 2 (PB1) 4135.8 0.000000e+00 2257/2266 (99%)
EPI249346 A/Wisconsin/629-D01904/2009 (A/H1N1 pdm09) segment 2 (PB1) 4135.8 0.000000e+00 2257/2266 (99%)
EPI248032 A/Wisconsin/629-D00911/2009 (A/H1N1 pdm09) segment 2 (PB1) 4135.8 0.000000e+00 2257/2266 (99%)
EPI247727 A/San Diego/INS08/2009 (A/H1N1 pdm09) segment 2 (PB1) 4135.8 0.000000e+00 2257/2266 (99%)
EPI246962 A/San Diego/INS60/2009 (A/H1N1 pdm09) segment 2 (PB1) 4135.8 0.000000e+00 2257/2266 (99%)
EPI246954 A/San Diego/INS57/2009 (A/H1N1 pdm09) segment 2 (PB1) 4135.8 0.000000e+00 2257/2266 (99%)
EPI246914 A/New York/6909/2009 (A/H1N1 pdm09) segment 2 (PB1) 4135.8 0.000000e+00 2257/2266 (99%)
EPI246826 A/New York/6668/2009 (A/H1N1 pdm09) segment 2 (PB1) 4135.8 0.000000e+00 2257/2266 (99%)
EPI246658 A/New York/5916/2009 (A/H1N1 pdm09) segment 2 (PB1) 4135.8 0.000000e+00 2257/2266 (99%)
EPI246546 A/New York/4995/2009 (A/H1N1 pdm09) segment 2 (PB1) 4135.8 0.000000e+00 2257/2266 (99%)
EPI245594 A/San Diego/INS52/2009 (A/H1N1 pdm09) segment 2 (PB1) 4135.8 0.000000e+00 2257/2266 (99%)
EPI245586 A/San Diego/INS48/2009 (A/H1N1 pdm09) segment 2 (PB1) 4135.8 0.000000e+00 2257/2266 (99%)
EPI245562 A/San Diego/INS34/2009 (A/H1N1 pdm09) segment 2 (PB1) 4135.8 0.000000e+00 2257/2266 (99%)
EPI245554 A/San Diego/INS16/2009 (A/H1N1 pdm09) segment 2 (PB1) 4135.8 0.000000e+00 2257/2266 (99%)
EPI245538 A/San Diego/INS11/2009 (A/H1N1 pdm09) segment 2 (PB1) 4135.8 0.000000e+00 2257/2266 (99%)
EPI245506 A/San Diego/INS05/2009 (A/H1N1 pdm09) segment 2 (PB1) 4135.8 0.000000e+00 2257/2266 (99%)
EPI245498 A/San Diego/INS04/2009 (A/H1N1 pdm09) segment 2 (PB1) 4135.8 0.000000e+00 2257/2266 (99%)
EPI245409 A/District of Columbia/INS46/2009 (A/H1N1 pdm09) segment 2 (PB1) 4135.8 0.000000e+00 2257/2266 (99%)
EPI245277 A/California/VRDL75/2009 (A/H1N1 pdm09) segment 2 (PB1) 4135.8 0.000000e+00 2257/2266 (99%)
EPI237260 A/California/VRDL64/2009 (A/H1N1 pdm09) segment 2 (PB1) 4135.8 0.000000e+00 2257/2266 (99%)
EPI271497 A/San Diego/INS215/2009 (A/H1N1 pdm09) segment 2 (PB1) 4132.1 0.000000e+00 2256/2266 (99%)
EPI254099 A/Texas/JMS401/2009 (A/H1N1 pdm09) segment 2 (PB1) 4132.1 0.000000e+00 2256/2266 (99%)
EPI245482 A/San Diego/INS02/2009 (A/H1N1 pdm09) segment 2 (PB1) 4132.1 0.000000e+00 2256/2266 (99%)
EPI385220 A/Singapore/TT144/2010 (A/H1N1) segment 2 (PB1) 4130.2 0.000000e+00 2256/2266 (99%)
EPI385129 A/Singapore/TT123/2010 (A/H1N1) segment 2 (PB1) 4130.2 0.000000e+00 2256/2266 (99%)
EPI385118 A/Singapore/KK100/2010 (A/H1N1) segment 2 (PB1) 4130.2 0.000000e+00 2256/2266 (99%)
EPI380436 A/Singapore/ON2326/2009 (A/H1N1) segment 2 (PB1) 4130.2 0.000000e+00 2256/2266 (99%)
EPI335592 A/Khon Kaen/INS461/2010 (A/H1N1) segment 2 (PB1) 4130.2 0.000000e+00 2256/2266 (99%)
EPI332551 A/Khon Kaen/INS441/2010 (A/H1N1) segment 2 (PB1) 4130.2 0.000000e+00 2256/2266 (99%)
EPI332511 A/Khon Kaen/INS449/2010 (A/H1N1) segment 2 (PB1) 4130.2 0.000000e+00 2256/2266 (99%)
EPI332503 A/Khon Kaen/INS450/2010 (A/H1N1) segment 2 (PB1) 4130.2 0.000000e+00 2256/2266 (99%)
EPI332495 A/Khon Kaen/INS451/2010 (A/H1N1) segment 2 (PB1) 4130.2 0.000000e+00 2256/2266 (99%)
EPI332479 A/Khon Kaen/INS453/2010 (A/H1N1) segment 2 (PB1) 4130.2 0.000000e+00 2256/2266 (99%)
EPI332471 A/Khon Kaen/INS454/2010 (A/H1N1) segment 2 (PB1) 4130.2 0.000000e+00 2256/2266 (99%)
EPI332463 A/Khon Kaen/INS455/2010 (A/H1N1) segment 2 (PB1) 4130.2 0.000000e+00 2256/2266 (99%)
EPI332455 A/Khon Kaen/INS457/2010 (A/H1N1) segment 2 (PB1) 4130.2 0.000000e+00 2256/2266 (99%)
EPI332447 A/Khon Kaen/INS458/2010 (A/H1N1) segment 2 (PB1) 4130.2 0.000000e+00 2256/2266 (99%)
EPI332439 A/Khon Kaen/INS459/2010 (A/H1N1) segment 2 (PB1) 4130.2 0.000000e+00 2256/2266 (99%)
EPI332431 A/Khon Kaen/INS460/2010 (A/H1N1) segment 2 (PB1) 4130.2 0.000000e+00 2256/2266 (99%)
EPI332423 A/Khon Kaen/INS462/2010 (A/H1N1) segment 2 (PB1) 4130.2 0.000000e+00 2256/2266 (99%)
EPI324540 A/Khon Kaen/INS456/2010 (A/H1N1) segment 2 (PB1) 4130.2 0.000000e+00 2256/2266 (99%)
EPI324532 A/Khon Kaen/INS448/2010 (A/H1N1) segment 2 (PB1) 4130.2 0.000000e+00 2256/2266 (99%)
EPI324376 A/California/VRDL364/2009 (A/H0) segment 2 (PB1) 4130.2 0.000000e+00 2256/2266 (99%)
EPI323862 A/England/854/2009 (A/H1N1 pdm09) segment 2 (PB1) 4130.2 0.000000e+00 2256/2266 (99%)
EPI323859 A/England/900/2009 (A/H1N1 pdm09) segment 2 (PB1) 4130.2 0.000000e+00 2256/2266 (99%)
EPI323850 A/England/1111/2009 (A/H1N1 pdm09) segment 2 (PB1) 4130.2 0.000000e+00 2256/2266 (99%)
EPI315537 A/Boston/673/2009 (A/H1N1) segment 2 (PB1) 4130.2 0.000000e+00 2256/2266 (99%)
EPI315521 A/Boston/670/2009 (A/H1N1) segment 2 (PB1) 4130.2 0.000000e+00 2256/2266 (99%)
EPI315473 A/Boston/635/2009 (A/H1N1) segment 2 (PB1) 4130.2 0.000000e+00 2256/2266 (99%)
EPI315457 A/Boston/632/2009 (A/H1N1) segment 2 (PB1) 4130.2 0.000000e+00 2256/2266 (99%)
EPI309145 A/New York/6537/2009 (A/H1N1) segment 2 (PB1) 4130.2 0.000000e+00 2256/2266 (99%)
EPI308627 A/Warsaw/INS99/2009 (A/H0) segment 2 (PB1) 4130.2 0.000000e+00 2256/2266 (99%)
EPI273730 A/Connecticut/02/2010 (A/H1N1 pdm09) segment 2 (PB1) 4130.2 0.000000e+00 2256/2266 (99%)
EPI271481 A/Pensacola/INS235/2009 (A/H1N1 pdm09) segment 2 (PB1) 4130.2 0.000000e+00 2256/2266 (99%)
EPI271473 A/Pensacola/INS234/2009 (A/H1N1 pdm09) segment 2 (PB1) 4130.2 0.000000e+00 2256/2266 (99%)
EPI271129 A/Aarhus/INS252/2009 (A/H1N1 pdm09) segment 2 (PB1) 4130.2 0.000000e+00 2256/2266 (99%)
EPI270629 A/California/VRDL133/2009 (A/H1N1 pdm09) segment 2 (PB1) 4130.2 0.000000e+00 2256/2266 (99%)
EPI270621 A/California/VRDL132/2009 (A/H1N1 pdm09) segment 2 (PB1) 4130.2 0.000000e+00 2256/2266 (99%)
EPI270613 A/California/VRDL131/2009 (A/H1N1 pdm09) segment 2 (PB1) 4130.2 0.000000e+00 2256/2266 (99%)
EPI270549 A/California/VRDL123/2009 (A/H1N1 pdm09) segment 2 (PB1) 4130.2 0.000000e+00 2256/2266 (99%)
EPI270453 A/California/VRDL111/2009 (A/H1N1 pdm09) segment 2 (PB1) 4130.2 0.000000e+00 2256/2266 (99%)
EPI270437 A/California/VRDL109/2009 (A/H1N1 pdm09) segment 2 (PB1) 4130.2 0.000000e+00 2256/2266 (99%)
EPI259261 A/Aalborg/INS133/2009 (A/H1N1 pdm09) segment 2 (PB1) 4130.2 0.000000e+00 2256/2266 (99%)
EPI258564 A/California/VRDL91/2009 (A/H1N1 pdm09) segment 2 (PB1) 4130.2 0.000000e+00 2256/2266 (99%)
EPI258524 A/California/VRDL14/2010 (A/H1N1 pdm09) segment 2 (PB1) 4130.2 0.000000e+00 2256/2266 (99%)
EPI255008 A/New York/7020/2009 (A/H1N1 pdm09) segment 2 (PB1) 4130.2 0.000000e+00 2256/2266 (99%)
EPI254091 A/Texas/JMS400/2009 (A/H1N1 pdm09) segment 2 (PB1) 4130.2 0.000000e+00 2256/2266 (99%)
EPI253048 A/Texas/JMS410/2009 (A/H1N1 pdm09) segment 2 (PB1) 4130.2 0.000000e+00 2256/2266 (99%)
EPI252984 A/Texas/JMS399/2009 (A/H1N1 pdm09) segment 2 (PB1) 4130.2 0.000000e+00 2256/2266 (99%)
EPI252976 A/Texas/JMS398/2009 (A/H1N1 pdm09) segment 2 (PB1) 4130.2 0.000000e+00 2256/2266 (99%)
EPI252968 A/Texas/JMS397/2009 (A/H1N1 pdm09) segment 2 (PB1) 4130.2 0.000000e+00 2256/2266 (99%)
EPI252872 A/Texas/JMS384/2009 (A/H1N1 pdm09) segment 2 (PB1) 4130.2 0.000000e+00 2256/2266 (99%)
EPI252712 A/Texas/46240925/2009 (A/H1N1 pdm09) segment 2 (PB1) 4130.2 0.000000e+00 2256/2266 (99%)
EPI252672 A/Texas/46222134/2009 (A/H1N1 pdm09) segment 2 (PB1) 4130.2 0.000000e+00 2256/2266 (99%)
EPI252520 A/Ontario/320266/2009 (A/H1N1 pdm09) segment 2 (PB1) 4130.2 0.000000e+00 2256/2266 (99%)
EPI252440 A/Ontario/314137/2009 (A/H1N1 pdm09) segment 2 (PB1) 4130.2 0.000000e+00 2256/2266 (99%)
EPI252067 A/Nevada/01/2010 (A/H1N1 pdm09) segment 2 (PB1) 4130.2 0.000000e+00 2256/2266 (99%)
EPI251898 A/Illinois/15/2009 (A/H1N1 pdm09) segment 2 (PB1) 4130.2 0.000000e+00 2256/2266 (99%)
EPI249716 A/Texas/JMS377/2009 (A/H1N1 pdm09) segment 2 (PB1) 4130.2 0.000000e+00 2256/2266 (99%)
EPI248080 A/Wisconsin/629-D01014/2009 (A/H1N1 pdm09) segment 2 (PB1) 4130.2 0.000000e+00 2256/2266 (99%)
EPI248048 A/Wisconsin/629-D00936/2009 (A/H1N1 pdm09) segment 2 (PB1) 4130.2 0.000000e+00 2256/2266 (99%)
EPI247759 A/Texas/46181235/2009 (A/H1N1 pdm09) segment 2 (PB1) 4130.2 0.000000e+00 2256/2266 (99%)
EPI247639 A/New York/5161/2009 (A/H1N1 pdm09) segment 2 (PB1) 4130.2 0.000000e+00 2256/2266 (99%)
EPI247433 A/Tennessee/01/2010 (A/H1N1 pdm09) segment 2 (PB1) 4130.2 0.000000e+00 2256/2266 (99%)
EPI246978 A/San Diego/INS63/2009 (A/H1N1 pdm09) segment 2 (PB1) 4130.2 0.000000e+00 2256/2266 (99%)
EPI246946 A/San Diego/INS55/2009 (A/H1N1 pdm09) segment 2 (PB1) 4130.2 0.000000e+00 2256/2266 (99%)
EPI246898 A/New York/6864/2009 (A/H1N1 pdm09) segment 2 (PB1) 4130.2 0.000000e+00 2256/2266 (99%)
EPI246842 A/New York/6675/2009 (A/H1N1 pdm09) segment 2 (PB1) 4130.2 0.000000e+00 2256/2266 (99%)
EPI246778 A/New York/6346/2009 (A/H1N1 pdm09) segment 2 (PB1) 4130.2 0.000000e+00 2256/2266 (99%)
EPI245626 A/San Diego/INS70/2009 (A/H1N1 pdm09) segment 2 (PB1) 4130.2 0.000000e+00 2256/2266 (99%)
EPI245602 A/San Diego/INS53/2009 (A/H1N1 pdm09) segment 2 (PB1) 4130.2 0.000000e+00 2256/2266 (99%)
EPI245522 A/San Diego/INS09/2009 (A/H1N1 pdm09) segment 2 (PB1) 4130.2 0.000000e+00 2256/2266 (99%)
EPI245514 A/San Diego/INS06/2009 (A/H1N1 pdm09) segment 2 (PB1) 4130.2 0.000000e+00 2256/2266 (99%)
EPI245293 A/California/VRDL78/2009 (A/H1N1 pdm09) segment 2 (PB1) 4130.2 0.000000e+00 2256/2266 (99%)
EPI245245 A/California/VRDL18/2009 (A/H1N1 pdm09) segment 2 (PB1) 4130.2 0.000000e+00 2256/2266 (99%)
EPI237020 A/California/VRDL23/2009 (A/H1N1 pdm09) segment 2 (PB1) 4130.2 0.000000e+00 2256/2266 (99%)
EPI223870 A/Texas/45072273/2009 (A/H1N1 pdm09) segment 2 (PB1) 4130.2 0.000000e+00 2256/2266 (99%)
EPI222985 A/Prague/197-81395/2009 (A/H1N1 pdm09) segment 2 (PB1) 4130.2 0.000000e+00 2256/2266 (99%)
EPI216972 A/Massachusetts/31/2009 (A/H1N1 pdm09) segment 2 (PB1) 4130.2 0.000000e+00 2256/2266 (99%)
EPI304241 A/Canada-ON/RV2965/2009 (A/H1N1 pdm09) segment 2 (PB1) 4128.4 0.000000e+00 2255/2265 (99%)
EPI303919 A/Canada-NFL/RV2510/2009 (A/H1N1 pdm09) segment 2 (PB1) 4128.4 0.000000e+00 2255/2265 (99%)
EPI324524 A/Khon Kaen/INS440/2010 (A/H1N1) segment 2 (PB1) 4126.5 0.000000e+00 2255/2266 (99%)
EPI308363 A/San Diego/WRAIR1665P/2009 (A/H1N1) segment 2 (PB1) 4126.5 0.000000e+00 2258/2269 (99%)
EPI308331 A/Pendleton/WRAIR1661P/2009 (A/H1N1) segment 2 (PB1) 4126.5 0.000000e+00 2258/2269 (99%)
EPI308291 A/San Diego/WRAIR1654P/2009 (A/H1N1) segment 2 (PB1) 4126.5 0.000000e+00 2258/2269 (99%)
EPI308219 A/San Diego/WRAIR1642P/2009 (A/H1N1) segment 2 (PB1) 4126.5 0.000000e+00 2258/2269 (99%)
EPI308131 A/New Jersey/WRAIR1499P/2009 (A/H1N1) segment 2 (PB1) 4126.5 0.000000e+00 2258/2269 (99%)
EPI404171 A/England/421/2009 (A/H1N1) segment 2 (PB1) 4124.7 0.000000e+00 2255/2266 (99%)
EPI403651 A/England/92980479/2009 (A/H1N1) segment 2 (PB1) 4124.7 0.000000e+00 2255/2266 (99%)
EPI403643 A/England/688/2009 (A/H1N1) segment 2 (PB1) 4124.7 0.000000e+00 2255/2266 (99%)
EPI403620 A/England/685/2009 (A/H1N1) segment 2 (PB1) 4124.7 0.000000e+00 2255/2266 (99%)
EPI403593 A/England/667/2009 (A/H1N1) segment 2 (PB1) 4124.7 0.000000e+00 2255/2266 (99%)
EPI403585 A/England/92880002/2009 (A/H1N1) segment 2 (PB1) 4124.7 0.000000e+00 2255/2266 (99%)
EPI400117 A/Kentucky/80/2009 (A/H1N1) segment 2 (PB1) 4124.7 0.000000e+00 2255/2266 (99%)
EPI397866 A/TASMANIA/2004/2009 (A/H1N1 pdm09) segment 2 (PB1) 4124.7 0.000000e+00 2255/2266 (99%)
EPI396106 A/England/271/2009 (A/H1N1 pdm09) segment 2 (PB1) 4124.7 0.000000e+00 2255/2266 (99%)
EPI396090 A/England/260/2009 (A/H1N1 pdm09) segment 2 (PB1) 4124.7 0.000000e+00 2255/2266 (99%)
EPI396003 A/England/209/2009 (A/H1N1 pdm09) segment 2 (PB1) 4124.7 0.000000e+00 2255/2266 (99%)
EPI395995 A/England/633/2009 (A/H1N1) segment 2 (PB1) 4124.7 0.000000e+00 2255/2266 (99%)
EPI395662 A/Reunion/1709-4-M2E/2009 (A/H1N1) segment 2 (PB1) 4124.7 0.000000e+00 2255/2266 (99%)
EPI395661 A/Reunion/0159-3-M1E/2009 (A/H1N1) segment 2 (PB1) 4124.7 0.000000e+00 2255/2266 (99%)
EPI390440 A/reassortant/NYMC X-205A (A/H1N1) segment 2 (PB1) 4124.7 0.000000e+00 2255/2266 (99%)
EPI390433 A/reassortant/NYMC X-205 (A/H1N1) segment 2 (PB1) 4124.7 0.000000e+00 2255/2266 (99%)
EPI390399 A/South Carolina/10/2010 (A/H1N1) segment 2 (PB1) 4124.7 0.000000e+00 2255/2266 (99%)
EPI386943 A/Scotland/Edinburgh_17715/2009 (A/H1N1) segment 2 (PB1) 4124.7 0.000000e+00 2255/2266 (99%)
EPI385314 A/Singapore/SS09/2010 (A/H1N1) segment 2 (PB1) 4124.7 0.000000e+00 2255/2266 (99%)
EPI380750 A/Singapore/ON822/2009 (A/H1N1) segment 2 (PB1) 4124.7 0.000000e+00 2255/2266 (99%)
EPI380735 A/Singapore/ON816/2009 (A/H1N1) segment 2 (PB1) 4124.7 0.000000e+00 2255/2266 (99%)
EPI380727 A/Singapore/ON812/2009 (A/H1N1) segment 2 (PB1) 4124.7 0.000000e+00 2255/2266 (99%)
EPI380691 A/Singapore/ON806/2009 (A/H1N1) segment 2 (PB1) 4124.7 0.000000e+00 2255/2266 (99%)
EPI380655 A/Singapore/ON800/2009 (A/H1N1) segment 2 (PB1) 4124.7 0.000000e+00 2255/2266 (99%)
EPI380632 A/Singapore/ON575/2009 (A/H1N1) segment 2 (PB1) 4124.7 0.000000e+00 2255/2266 (99%)
EPI380616 A/Singapore/ON520/2009 (A/H1N1) segment 2 (PB1) 4124.7 0.000000e+00 2255/2266 (99%)
EPI380608 A/Singapore/ON506/2009 (A/H1N1) segment 2 (PB1) 4124.7 0.000000e+00 2255/2266 (99%)
EPI380592 A/Singapore/ON479/2009 (A/H1N1) segment 2 (PB1) 4124.7 0.000000e+00 2255/2266 (99%)
EPI380584 A/Singapore/ON477/2009 (A/H1N1) segment 2 (PB1) 4124.7 0.000000e+00 2255/2266 (99%)
EPI380486 A/Singapore/ON313/2009 (A/H1N1) segment 2 (PB1) 4124.7 0.000000e+00 2255/2266 (99%)
EPI380295 A/Singapore/ON201/2009 (A/H1N1) segment 2 (PB1) 4124.7 0.000000e+00 2255/2266 (99%)
EPI380261 A/Singapore/ON1955/2009 (A/H1N1) segment 2 (PB1) 4124.7 0.000000e+00 2255/2266 (99%)
EPI380226 A/Singapore/ON1924/2009 (A/H1N1) segment 2 (PB1) 4124.7 0.000000e+00 2255/2266 (99%)

_________________
www.twitter.com/hniman


Top
 Profile  
 
Display posts from previous:  Sort by  
Post new topic Reply to topic  [ 14 posts ]  Go to page 1, 2  Next

All times are UTC - 5 hours [ DST ]


Who is online

Users browsing this forum: No registered users and 150 guests


You cannot post new topics in this forum
You cannot reply to topics in this forum
You cannot edit your posts in this forum
You cannot delete your posts in this forum
You cannot post attachments in this forum

Search for:
Jump to:  
Powered by phpBB® Forum Software © phpBB Group