Rhiza Labs FluTracker Forum

The place to discuss the flu
It is currently Thu Nov 27, 2014 5:10 am

All times are UTC - 5 hours [ DST ]




Post new topic Reply to topic  [ 25 posts ]  Go to page 1, 2, 3  Next
Author Message
PostPosted: Mon Dec 24, 2012 1:34 pm 
Online

Joined: Wed Aug 19, 2009 10:42 am
Posts: 48118
Location: Pittsburgh, PA USA
The CDC week 50 reported noted two H3N2 low reactors. One of the low reactors was A/Iowa/14/2012, which has lost a glycosylation site, T128A. The vaccine target for the 2003/2004 season was A/Wyoming/03/2003, whic had lost the same glycosylation site.

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Mon Dec 24, 2012 1:39 pm 
Online

Joined: Wed Aug 19, 2009 10:42 am
Posts: 48118
Location: Pittsburgh, PA USA
Influenza A (H3N2) [226]:

224 (99.1%) of the 226 H3N2 influenza viruses tested have been characterized as A/Victoria/361/2011-like, the influenza A (H3N2) component of the 2012-2013 Northern Hemisphere influenza vaccine.
Two (0.9%) of the 226 H3N2 viruses tested showed reduced titers with antiserum produced against A/Victoria/361/2011.

http://www.cdc.gov/flu/weekly/

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Mon Dec 24, 2012 1:40 pm 
Online

Joined: Wed Aug 19, 2009 10:42 am
Posts: 48118
Location: Pittsburgh, PA USA
Isolate name:

A/Iowa/14/2012

Isolate ID:

EPI_ISL_131825
Passage details/history:

C2
Type:

A / H3N2
Lineage:



Sample information

Collection date:

2012-10-18
Host

Human
Additional host information:


Zip code:


Patient status:


Last vaccinated:


In-vivo pathogenicity test:


Location:

United States / Iowa
Additional location information:


Patient age:

69 Year(s)
Gender:

Female
Outbreak:


Treatment:


Specimen source:




Institute information

Originating lab:
Iowa State Hygienic Laboratory
Sample ID given by the sample provider:

2012105150 ORIGINAL
Address:
Iowa State Hygienic Laboratory
UI Research Park
Iowa City, 52242
United States


Submitting lab:
Centers for Disease Control and Prevention
Sample ID given by the submitting laboratory:

2013704502
Authors:

Address:
Centers for Disease Control and Prevention
WHO Collaborating Center for Surveillance, Epidemiology and Control of Influenza, Influenza Division
1600 Clifton Road, N.E.
Atlanta, GA 30333
United States


Publication
Publication


In vivo antiviral resistance

Phenotype Genotype Unspecified Antiviral resistance tested by experimental procedures
Adamantanes:

Unknown
Oseltamivir:

Sensitive
Zanamivir:

Sensitive
Peramivir:

Unknown
Other:

Unknown

Antiviral resistance tested by sequence prediction
Adamantanes:

Unknown
Oseltamivir:

Unknown
Zanamivir:

Unknown
Peramivir:

Unknown
Other:

Unknown
Antiviral resistance tested by unknown method
Adamantanes:

Unknown
Oseltamivir:

Unknown
Zanamivir:

Unknown
Peramivir:

Unknown
Other:

Unknown

Additional information
Antigenic characterization:

A/VICTORIA/361/2011-LIKE (H3N2) LOW GP
Note:


Sequence

segment identifier length accession # INSDC Sequence
HA 2013704502_225241_v1_4 1701 EPI404971
NA 2013704502_225241_v1_6 1410 EPI404970
MP 2013704502_225241_v1_7 982 EPI404969

Submitter information

Submitter:

Cintron, Roxana
Submission Date:

2012-12-07
Last modifier:

Cintron, Roxana
Last modified:

2012-12-07

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Mon Dec 24, 2012 1:42 pm 
Online

Joined: Wed Aug 19, 2009 10:42 am
Posts: 48118
Location: Pittsburgh, PA USA
A430G (T128A) up
EPI407006 A/HYOGO/3059/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI406999 A/YOKOHAMA/159/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI406995 A/YAMAGUCHI/30/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI406200 A/YAMANASHI/300/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI406199 A/YAMANASHI/297/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI406198 A/YOKOHAMA/155/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI406069 A/Utah/27/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI404997 A/Idaho/23/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI404971 A/Iowa/14/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI404965 A/New York/39/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI404947 A/Rhode Island/08/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI404944 A/Alabama/18/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI404938 A/Pennsylvania/20/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI404932 A/Texas/82/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI404927 A/New York/39/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI404911 A/Iowa/15/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI401735 A/New York/37/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI400061 A/Kenya/152/2011 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI399657 A/Alabama/17/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI398030 A/Washington/50/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI397564 A/Alabama/17/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI394823 A/North Carolina/21/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI394256 A/PHILIPPINES/3/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI391234 A/Hong Kong/8118/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI390214 A/reassortant/NYMC X-165 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI390181 A/Nepal/921/2006 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI390126 A/reassortant/NYMC X-147 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI385944 A/Wyoming/3/2003 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI383669 A/Pavia/15/2007 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI383667 A/Pavia/7/2007 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI383663 A/Pavia/8/2007 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI383661 A/Pavia/5/2007 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI382778 A/Hong Kong/8146/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI382725 A/Hong Kong/8118/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI375335 A/India/K072142/2006 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI375298 A/India/K0713780/2007 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI375277 A/India/Dib0622569/2006 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI375271 A/India/D0635425/2006 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI375094 A/Alabama/08/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI374827 A/India/Dib0622568/2006 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI374824 A/India/D0635433/2006 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI374822 A/India/D0635426/2006 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI374818 A/India/D0612421/2006 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI369575 A/HaNoi/Q220/2007 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI369551 A/HaNoi/Q099/2007 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI369444 A/HungYen/HY6/2007 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI360295 A/Anhui/330/2003 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI360201 A/Henan/134-1/2001 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI357497 A/Kenya/181/2011 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI357496 A/Kenya/180/2011 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI357480 A/Kenya/177/2011 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI357477 A/Kenya/176/2011 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI357007 A/Kenya/174/2011 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI357004 A/Kenya/172/2011 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI357003 A/Kenya/171/2011 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI357001 A/Kenya/169/2011 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI356949 A/Kenya/168/2011 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI356936 A/Kenya/165/2011 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI356915 A/Kenya/163/2011 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI356907 A/Kenya/162/2011 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI356889 A/Kenya/160/2011 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI356876 A/Kenya/159/2011 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI356870 A/Kenya/157/2011 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI356816 A/Kenya/156/2011 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI356798 A/Kenya/154/2011 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI355347 A/HungYen/HY3/2007 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI353763 A/CastillaLaMancha/RR9008/2012 (A/H3) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI342368 A/Tanzania/952/2011 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI342366 A/Tanzania/952/2011 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI342363 A/Tanzania/952/2011 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI319276 A/Madagascar/0648/2011 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI319264 A/Madagascar/0094/2011 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI316191 A/Tanzania/45/2011 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI302223 A/Madagascar/7480/2010 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI302221 A/Madagascar/7477/2010 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI302213 A/Madagascar/7142/2010 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI302209 A/Madagascar/6459/2010 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI301241 A/Sichuan-Yucheng/1272/2010 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI300752 A/Kolkata/323/2006 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI300751 A/Kolkata/220/2006 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI300750 A/Kolkata/158/2005 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI300749 A/Kolkata/77/2005 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI296012 A/Kolkata/265/2006 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI296011 A/Kolkata/256/2006 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI296009 A/Kolkata/232/2006 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI296007 A/Kolkata/216/2006 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI269372 A/NYMC X-147 (Puerto Rico/8/1934-Wyoming/03/2003) (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI249465 A/Nagasaki/N052/2007 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI249464 A/Nagasaki/N05/2006 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI249463 A/Nagasaki/N04/2006 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI241911 A/NYMC X-149C6(Puerto Rico/8/1934-Wyoming/03/2003) (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI235635 A/LYON/19989/2002 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI235593 A/Berlin/43/02 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI234887 A/SYDNEY/32/2003 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI234669 A/Arizona/AZ-300637/2003 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI234661 A/Alaska/AK-V03-206/2003 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI234328 A/Cambodia/S272/2008 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI232599 A/Philippines/95/2009 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI226767 A/MIYAGI/123/2005 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI224764 A/SANTIAGO/8248/2006 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI224653 A/Hong Kong/3055/2006 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI217711 A/New York/3064/2009 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI217663 A/New York/3011/2009 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI217639 A/New York/1685/2009 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI178214 A/Kentucky/UR07-0038/2008 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI167267 A/British Columbia/0002/2007 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI167263 A/Alberta/0211/2007 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI167262 A/Alberta/0215/2007 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI167255 A/British Columbia/0433/2007 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI167253 A/British Columbia/0442/2007 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI167237 A/Quebec/1039/2007 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI167236 A/Alberta/1216/2007 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI165641 A/Pennsylvania/PIT31/2008 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI165625 A/Pennsylvania/PIT20/2008 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI165617 A/Pennsylvania/PIT12/2008 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI165609 A/Pennsylvania/PIT05/2008 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI165529 A/Pennsylvania/PIT22/2008 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI165513 A/Pennsylvania/PIT06/2008 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI160210 A/Wyoming/03/2003 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI158134 A/Singapore/89/2003 (A/H3) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI158102 A/Santiago/6764/2006 (A/H3) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI157992 A/Nepal/1445/2006 (A/H3) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI157991 A/Nepal/1440/2006 (A/H3) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI157990 A/Nepal/0997/2006 (A/H3) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI157989 A/Nepal/0921/2006 (A/H3) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI157572 A/Egypt/923226/2003 (A/H3) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI156101 A/Hong Kong/3055/2006 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI155920 A/Kenya/2444/2007 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI155916 A/Serres/77/2007 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI155914 A/Zagreb/1216/2007 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI155888 A/Egypt/3707/2006 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI155809 A/Bangladesh/1695/2007 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI155726 A/Dnipropetrovsk/324/2007 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI155678 A/Ivacevichi/115/2007 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI155520 A/Vladimir/08/2007 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI155514 A/Moscow/31/2007 (A/H3) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI155513 A/Vladimir/05/2007 (A/H3) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI155507 A/Moscow/13/2007 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI155482 A/Canada/3189/2007 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI155452 A/Kiev/111/2007 (A/H3) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI155446 A/Canada/372/2007 (A/H3) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI155444 A/Canada/363/2007 (A/H3) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI155443 A/Canada/315/2007 (A/H3) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI155442 A/Canada/309/2007 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI155439 A/Canada/281/2007 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI155437 A/Canada/280/2007 (A/H3) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI155436 A/Canada/279/2007 (A/H3) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI155435 A/Canada/277/2007 (A/H3) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI155432 A/Canada/269/2007 (A/H3) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI155429 A/Canada/266/2007 (A/H3) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI155428 A/Canada/264/2007 (A/H3) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI155427 A/Canada/125/2007 (A/H3) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI155424 A/Canada/90/2007 (A/H3) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI155423 A/Canada/85/2007 (A/H3) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI155422 A/Canada/84/2006 (A/H3) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI155420 A/Canada/63/2006 (A/H3) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI155419 A/Canada/20/2006 (A/H3) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI155418 A/Canada/19/2006 (A/H3) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI155417 A/Canada/09/2006 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI155415 A/Canada/08/2006 (A/H3) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI155414 A/Canada/1295/2006 (A/H3) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI155413 A/Canada/1214/2006 (A/H3) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI155412 A/Canada/1213/2006 (A/H3) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI155411 A/Canada/1210/2006 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI155343 A/Lyon/22/2007 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI155270 A/THAILAND/715/2006 (A/H3) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI155264 A/THAILAND/709/2006 (A/H3) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI155249 A/THAILAND/618/2006 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI155230 A/Canada/28/2007 (A/H3) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI155229 A/Canada/23/2007 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI155227 A/Canada/02/2006 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI155225 A/BANGLADESH/1999/2006 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI155223 A/Canada/1212/2006 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI155219 A/Canada/1198/2006 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI155217 A/Canada/1194/2006 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI155096 A/SANTIAGO/8248/2006 (A/H3) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI155093 A/Nepal/5486/2006 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI153475 A/Evros/17/2007 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI152388 A/Wyoming/03/2003 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI146449 A/Canada/CN-RV1213-06/2006 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI146448 A/Canada/CN-RV0020-07/2006 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI146447 A/Canada/CN-RV0019-07/2006 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI146446 A/Canada/CN-RV0009-07/2006 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI146445 A/Canada/CN-RV0008-07/2006 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI146444 A/Canada/CN-RV1295-06/2006 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI146443 A/Canada/CN-RV0063-07/2006 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI146401 A/HAMAMATU/183/2006 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI146392 A/Canada/CN-RV1198-06/2006 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI146391 A/Canada/CN-RV1194-06/2006 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI146372 A/BANGLADESH/1999/2006 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI146370 A/SAITAMA/60/2006 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI146360 A/THAILAND/715/2006 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI146359 A/THAILAND/709/2006 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI146266 A/Wyoming/WY-2003100054/2003 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI146128 A/Nepal/NP-HC91445-ORIGINAL/2006 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI146127 A/Nepal/NP-HC91440-ORIGINAL/2006 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI146126 A/Nepal/NP-HC90997-ORIGINAL/2006 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI146009 A/Egypt/EG-2002923226/2003 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI145898 A/THAILAND/618/2006 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI145834 A/Nepal/921/2006 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI145193 A/Wyoming/03/2003 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI145192 A/Human/WYOMING/2/2003 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI141988 A/Tegucigalpa/FLU8859/2007 (A/H3) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI141299 A/Champagne-Ardenne/13/2007 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI141295 A/Champagne-Ardenne/09/2007 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI139264 A/Denmark/122/2003 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI139262 A/Denmark/121/2003 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI139247 A/Denmark/119/2003 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI139237 A/Denmark/73/2006 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI139171 A/Denmark/124/2003 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI139154 A/Denmark/76/2006 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI133826 A/Alaska/05/2007 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI132895 A/USA/AF1109/2008 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI132881 A/USA/AF1099/2008 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI132105 A/Milan/22/2007 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI132079 A/Milan/03/2007 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI132077 A/Milan/04/2007 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI132073 A/Milan/06/2007 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI132063 A/Milan/11/2007 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI132061 A/Milan/12/2007 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI132059 A/Milan/13/2007 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI132057 A/Milan/14/2007 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI132049 A/Milan/18/2007 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI126681 A/Corsica/41/2007 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI126073 A/Kenya/AF5617/2007 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI125911 A/Pennsylvania/05/2007 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI125751 A/New Jersey/05/2007 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI125737 A/Wisconsin/02/2007 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI125735 A/New York/03/2007 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI123263 A/Nepal/921/2006 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI116037 A/Wyoming/3e5/2003 (A/H3) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI116034 A/Wyoming/3e8/2003 (A/H3) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI116032 A/Wyoming/3e/2003 (A/H3) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI116030 A/Wyoming/3c/2003 (A/H3) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI116028 A/Wyoming/2/2003 (A/H3) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI115849 A/Arizona/13/2003 (A/H3) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI115839 A/Alaska/3/2003 (A/H3) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI115327 A/South Africa/57/2000 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI115315 A/Oklahoma/51/06 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI106556 A/Oslo/3385/2003 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI106422 A/Wyoming/03/2003 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI99810 A/Taiwan/3640/2003 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI99220 A/Singapore/C5-7/2002 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI70906 A/Kentucky/UR06-0370/2007 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI70792 A/Alabama/UR06-0545/2007 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI70526 A/Texas/UR06-0480/2007 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI63870 A/Hungary/AF1079/2007 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI63868 A/Hungary/AF1078/2007 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI63866 A/Hungary/AF1077/2007 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI63864 A/Hungary/AF1076/2007 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI63862 A/Hungary/AF1075/2007 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI63860 A/Hungary/AF1074/2007 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI63858 A/Hungary/AF1073/2007 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI63856 A/Hungary/AF1072/2007 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI63754 A/Germany/AF1010/2007 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI63748 A/Germany/AF1019/2007 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI63742 A/Germany/AF1016/2007 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI63730 A/Germany/AF1009/2007 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI26590 A/RiodeJaneiro/28/00 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI21494 A/Kyongbuk/320/2002 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI20278 A/Denmark/37/03 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI20276 A/Denmark/39/03 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI20258 A/Denmark/41/03 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI20256 A/Denmark/20/03 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI20248 A/Denmark/24/03 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI20244 A/Denmark/07/03 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI20242 A/Denmark/58/03 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI20240 A/Denmark/59/03 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI20229 A/Wyoming/03/2003 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI3485 A/Yamagata/74/2007 (A/H3) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Mon Dec 24, 2012 1:43 pm 
Online

Joined: Wed Aug 19, 2009 10:42 am
Posts: 48118
Location: Pittsburgh, PA USA
A430G down

EPI407006 A/HYOGO/3059/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI406999 A/YOKOHAMA/159/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI406995 A/YAMAGUCHI/30/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI406200 A/YAMANASHI/300/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI406199 A/YAMANASHI/297/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI406198 A/YOKOHAMA/155/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI406069 A/Utah/27/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI404997 A/Idaho/23/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI404971 A/Iowa/14/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI404965 A/New York/39/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI404947 A/Rhode Island/08/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI404944 A/Alabama/18/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI404938 A/Pennsylvania/20/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI404932 A/Texas/82/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI404927 A/New York/39/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI404911 A/Iowa/15/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI401735 A/New York/37/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI400061 A/Kenya/152/2011 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI399657 A/Alabama/17/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI398030 A/Washington/50/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI397564 A/Alabama/17/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI394823 A/North Carolina/21/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI394256 A/PHILIPPINES/3/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI391234 A/Hong Kong/8118/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI390214 A/reassortant/NYMC X-165 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI390181 A/Nepal/921/2006 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI390126 A/reassortant/NYMC X-147 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI385944 A/Wyoming/3/2003 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI383669 A/Pavia/15/2007 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI383667 A/Pavia/7/2007 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI383663 A/Pavia/8/2007 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI383661 A/Pavia/5/2007 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI382778 A/Hong Kong/8146/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI382725 A/Hong Kong/8118/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI375336 A/India/K076499/2006 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI375335 A/India/K072142/2006 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI375298 A/India/K0713780/2007 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI375277 A/India/Dib0622569/2006 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI375094 A/Alabama/08/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI374827 A/India/Dib0622568/2006 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI374822 A/India/D0635426/2006 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI374818 A/India/D0612421/2006 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI369575 A/HaNoi/Q220/2007 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI369551 A/HaNoi/Q099/2007 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI369444 A/HungYen/HY6/2007 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI360295 A/Anhui/330/2003 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI360201 A/Henan/134-1/2001 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI357497 A/Kenya/181/2011 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI357496 A/Kenya/180/2011 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI357480 A/Kenya/177/2011 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI357477 A/Kenya/176/2011 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI357007 A/Kenya/174/2011 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI357004 A/Kenya/172/2011 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI357003 A/Kenya/171/2011 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI357001 A/Kenya/169/2011 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI356949 A/Kenya/168/2011 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI356936 A/Kenya/165/2011 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI356915 A/Kenya/163/2011 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI356907 A/Kenya/162/2011 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI356889 A/Kenya/160/2011 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI356876 A/Kenya/159/2011 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI356870 A/Kenya/157/2011 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI356816 A/Kenya/156/2011 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI356798 A/Kenya/154/2011 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI355347 A/HungYen/HY3/2007 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI353763 A/CastillaLaMancha/RR9008/2012 (A/H3) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI342368 A/Tanzania/952/2011 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI342366 A/Tanzania/952/2011 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI342363 A/Tanzania/952/2011 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI319276 A/Madagascar/0648/2011 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI319264 A/Madagascar/0094/2011 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI316191 A/Tanzania/45/2011 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI302223 A/Madagascar/7480/2010 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI302221 A/Madagascar/7477/2010 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI302213 A/Madagascar/7142/2010 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI302209 A/Madagascar/6459/2010 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI301241 A/Sichuan-Yucheng/1272/2010 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI300752 A/Kolkata/323/2006 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI300751 A/Kolkata/220/2006 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI300750 A/Kolkata/158/2005 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI300749 A/Kolkata/77/2005 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI296012 A/Kolkata/265/2006 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI296011 A/Kolkata/256/2006 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI296009 A/Kolkata/232/2006 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI296007 A/Kolkata/216/2006 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI269372 A/NYMC X-147 (Puerto Rico/8/1934-Wyoming/03/2003) (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI249465 A/Nagasaki/N052/2007 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI249464 A/Nagasaki/N05/2006 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI249463 A/Nagasaki/N04/2006 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI241911 A/NYMC X-149C6(Puerto Rico/8/1934-Wyoming/03/2003) (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI234669 A/Arizona/AZ-300637/2003 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI234661 A/Alaska/AK-V03-206/2003 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI234328 A/Cambodia/S272/2008 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI232599 A/Philippines/95/2009 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI229276 A/KOBE/3/2004 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI226767 A/MIYAGI/123/2005 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI224764 A/SANTIAGO/8248/2006 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI224653 A/Hong Kong/3055/2006 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI217711 A/New York/3064/2009 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI217663 A/New York/3011/2009 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI217639 A/New York/1685/2009 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI178214 A/Kentucky/UR07-0038/2008 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI167267 A/British Columbia/0002/2007 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI167263 A/Alberta/0211/2007 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI167262 A/Alberta/0215/2007 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI167255 A/British Columbia/0433/2007 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI167253 A/British Columbia/0442/2007 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI167237 A/Quebec/1039/2007 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI167236 A/Alberta/1216/2007 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI165641 A/Pennsylvania/PIT31/2008 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI165625 A/Pennsylvania/PIT20/2008 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI165617 A/Pennsylvania/PIT12/2008 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI165609 A/Pennsylvania/PIT05/2008 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI165529 A/Pennsylvania/PIT22/2008 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI165513 A/Pennsylvania/PIT06/2008 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI160210 A/Wyoming/03/2003 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI158134 A/Singapore/89/2003 (A/H3) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI158102 A/Santiago/6764/2006 (A/H3) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI157992 A/Nepal/1445/2006 (A/H3) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI157991 A/Nepal/1440/2006 (A/H3) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI157990 A/Nepal/0997/2006 (A/H3) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI157989 A/Nepal/0921/2006 (A/H3) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI157603 A/Germany/838/2003 (A/H3) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI156101 A/Hong Kong/3055/2006 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI155920 A/Kenya/2444/2007 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI155916 A/Serres/77/2007 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI155914 A/Zagreb/1216/2007 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI155888 A/Egypt/3707/2006 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI155809 A/Bangladesh/1695/2007 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI155726 A/Dnipropetrovsk/324/2007 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI155678 A/Ivacevichi/115/2007 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI155520 A/Vladimir/08/2007 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI155514 A/Moscow/31/2007 (A/H3) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI155513 A/Vladimir/05/2007 (A/H3) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI155507 A/Moscow/13/2007 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI155482 A/Canada/3189/2007 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI155452 A/Kiev/111/2007 (A/H3) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI155446 A/Canada/372/2007 (A/H3) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI155444 A/Canada/363/2007 (A/H3) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI155443 A/Canada/315/2007 (A/H3) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI155442 A/Canada/309/2007 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI155439 A/Canada/281/2007 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI155437 A/Canada/280/2007 (A/H3) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI155436 A/Canada/279/2007 (A/H3) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI155435 A/Canada/277/2007 (A/H3) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI155432 A/Canada/269/2007 (A/H3) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI155429 A/Canada/266/2007 (A/H3) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI155428 A/Canada/264/2007 (A/H3) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI155427 A/Canada/125/2007 (A/H3) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI155424 A/Canada/90/2007 (A/H3) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI155423 A/Canada/85/2007 (A/H3) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI155422 A/Canada/84/2006 (A/H3) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI155420 A/Canada/63/2006 (A/H3) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI155419 A/Canada/20/2006 (A/H3) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI155418 A/Canada/19/2006 (A/H3) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI155417 A/Canada/09/2006 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI155415 A/Canada/08/2006 (A/H3) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI155414 A/Canada/1295/2006 (A/H3) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI155413 A/Canada/1214/2006 (A/H3) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI155412 A/Canada/1213/2006 (A/H3) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI155411 A/Canada/1210/2006 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI155343 A/Lyon/22/2007 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI155270 A/THAILAND/715/2006 (A/H3) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI155264 A/THAILAND/709/2006 (A/H3) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI155249 A/THAILAND/618/2006 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI155230 A/Canada/28/2007 (A/H3) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI155229 A/Canada/23/2007 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI155227 A/Canada/02/2006 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI155225 A/BANGLADESH/1999/2006 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI155223 A/Canada/1212/2006 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI155219 A/Canada/1198/2006 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI155217 A/Canada/1194/2006 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI155096 A/SANTIAGO/8248/2006 (A/H3) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI155093 A/Nepal/5486/2006 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI153475 A/Evros/17/2007 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI152388 A/Wyoming/03/2003 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI146449 A/Canada/CN-RV1213-06/2006 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI146448 A/Canada/CN-RV0020-07/2006 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI146447 A/Canada/CN-RV0019-07/2006 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI146446 A/Canada/CN-RV0009-07/2006 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI146445 A/Canada/CN-RV0008-07/2006 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI146444 A/Canada/CN-RV1295-06/2006 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI146443 A/Canada/CN-RV0063-07/2006 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI146401 A/HAMAMATU/183/2006 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI146392 A/Canada/CN-RV1198-06/2006 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI146391 A/Canada/CN-RV1194-06/2006 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI146372 A/BANGLADESH/1999/2006 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI146370 A/SAITAMA/60/2006 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI146360 A/THAILAND/715/2006 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI146359 A/THAILAND/709/2006 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI146327 A/GRANADA/1420/2003 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI146266 A/Wyoming/WY-2003100054/2003 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI146128 A/Nepal/NP-HC91445-ORIGINAL/2006 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI146127 A/Nepal/NP-HC91440-ORIGINAL/2006 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI146126 A/Nepal/NP-HC90997-ORIGINAL/2006 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI146031 A/Germany/GE-838/2003 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI145898 A/THAILAND/618/2006 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI145834 A/Nepal/921/2006 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI145193 A/Wyoming/03/2003 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI145192 A/Human/WYOMING/2/2003 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI145155 A/South Australia/39/2003 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI141988 A/Tegucigalpa/FLU8859/2007 (A/H3) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI141299 A/Champagne-Ardenne/13/2007 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI141295 A/Champagne-Ardenne/09/2007 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI139264 A/Denmark/122/2003 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI139262 A/Denmark/121/2003 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI139247 A/Denmark/119/2003 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI139237 A/Denmark/73/2006 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI139171 A/Denmark/124/2003 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI139154 A/Denmark/76/2006 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI133826 A/Alaska/05/2007 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI132895 A/USA/AF1109/2008 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI132881 A/USA/AF1099/2008 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI132105 A/Milan/22/2007 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI132079 A/Milan/03/2007 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI132077 A/Milan/04/2007 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI132073 A/Milan/06/2007 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI132063 A/Milan/11/2007 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI132061 A/Milan/12/2007 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI132059 A/Milan/13/2007 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI132057 A/Milan/14/2007 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI132049 A/Milan/18/2007 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI126681 A/Corsica/41/2007 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI126073 A/Kenya/AF5617/2007 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI125911 A/Pennsylvania/05/2007 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI125751 A/New Jersey/05/2007 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI125737 A/Wisconsin/02/2007 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI125735 A/New York/03/2007 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI123263 A/Nepal/921/2006 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI116763 A/South Australia/39/2003 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI116037 A/Wyoming/3e5/2003 (A/H3) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI116034 A/Wyoming/3e8/2003 (A/H3) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI116032 A/Wyoming/3e/2003 (A/H3) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI116030 A/Wyoming/3c/2003 (A/H3) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI116028 A/Wyoming/2/2003 (A/H3) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI115849 A/Arizona/13/2003 (A/H3) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI115839 A/Alaska/3/2003 (A/H3) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI106556 A/Oslo/3385/2003 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI106422 A/Wyoming/03/2003 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI99810 A/Taiwan/3640/2003 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI99220 A/Singapore/C5-7/2002 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI70906 A/Kentucky/UR06-0370/2007 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI70792 A/Alabama/UR06-0545/2007 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI70526 A/Texas/UR06-0480/2007 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI63870 A/Hungary/AF1079/2007 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI63868 A/Hungary/AF1078/2007 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI63866 A/Hungary/AF1077/2007 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI63864 A/Hungary/AF1076/2007 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI63862 A/Hungary/AF1075/2007 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI63860 A/Hungary/AF1074/2007 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI63858 A/Hungary/AF1073/2007 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI63856 A/Hungary/AF1072/2007 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI63754 A/Germany/AF1010/2007 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI63748 A/Germany/AF1019/2007 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI63742 A/Germany/AF1016/2007 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI63730 A/Germany/AF1009/2007 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI54705 A/Queensland/32/2003 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI36916 A/Waikato/148/2003 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI21494 A/Kyongbuk/320/2002 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI20278 A/Denmark/37/03 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI20276 A/Denmark/39/03 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI20258 A/Denmark/41/03 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI20256 A/Denmark/20/03 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI20248 A/Denmark/24/03 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI20244 A/Denmark/07/03 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI20242 A/Denmark/58/03 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI20240 A/Denmark/59/03 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI20229 A/Wyoming/03/2003 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI3485 A/Yamagata/74/2007 (A/H3) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Mon Dec 24, 2012 1:50 pm 
Online

Joined: Wed Aug 19, 2009 10:42 am
Posts: 48118
Location: Pittsburgh, PA USA
Isolate name:

A/reassortant/NYMC X-147

Isolate ID:

EPI_ISL_127607
Passage details/history:

Egg
Type:

A / H3N2
Lineage:



Sample information

Collection date:

2012 (Month and day unknown)
Host

Laboratory derived
Additional host information:


Location:

North America
Additional location information:




Institute information

Originating lab:

Sample ID given by the sample provider:


Address:



Submitting lab:
Other Database Import
Sample ID given by the submitting laboratory:


Authors:
Wentworth,D.E.;
Dugan,V.;
Halpin,R.;
Lin,X.;
Bera,J.;
Ghedin,E.;
Fedorova,N.;
Overton,L.;
Tsitrin,T.;
Stockwell,T.;
Amedeo,P.;
Bishop,B.;
Chen,H.;
Edworthy,P.;
Gupta,N.;
Katzel,D.;
Li,K.;
Schobel,S.;
Shrivastava,S.;
Thovarai,V.;
Wang,S.;
Ramanunninair,M.;
Silverman,J.;
Devis,R.;
Phan,L.;
Le,J.;
Pokorny,B.A.;
Onodera,S.;
Fulvini,A.A.;
He,Y.;
Kilbourne,E.D.;
Bucher,D.;
Bao,Y.;
Sanders,R.;
Dernovoy,D.;
Kiryutin,B.;
Lipman,D.J.;
Tatusova,T.
Address:



Publication
Publication


In vivo antiviral resistance

Phenotype Genotype Unspecified Antiviral resistance tested by experimental procedures
Adamantanes:

Unknown
Oseltamivir:

Unknown
Zanamivir:

Unknown
Peramivir:

Unknown
Other:

Unknown

Antiviral resistance tested by sequence prediction
Adamantanes:

Unknown
Oseltamivir:

Unknown
Zanamivir:

Unknown
Peramivir:

Unknown
Other:

Unknown
Antiviral resistance tested by unknown method
Adamantanes:

Unknown
Oseltamivir:

Unknown
Zanamivir:

Unknown
Peramivir:

Unknown
Other:

Unknown

Additional information
Antigenic characterization:


Note:
A/Wyoming/03/2003 x Puerto Rico/8/1934

Sequence

segment identifier length accession # INSDC Sequence
PB2 A/reassortant/NYMC X-147 2316 EPI390149 CY121447
PB1 A/reassortant/NYMC X-147 2316 EPI390148 CY121446
PA A/reassortant/NYMC X-147 2208 EPI390147 CY121445
HA A/reassortant/NYMC X-147 1737 EPI390126 CY121440
NP A/reassortant/NYMC X-147 1540 EPI390145 CY121443
NA A/reassortant/NYMC X-147 1434 EPI390144 CY121442
MP A/reassortant/NYMC X-147 1002 EPI390143 CY121441
NS A/reassortant/NYMC X-147 865 EPI390146 CY121444

Submitter information

Submitter:

, EpiFluDB
Submission Date:

2012-06-20
Last modifier:

Pohlmann, Anne (EpiFlu Data Curator)
Last modified:

2012-06-20

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Mon Dec 24, 2012 1:50 pm 
Online

Joined: Wed Aug 19, 2009 10:42 am
Posts: 48118
Location: Pittsburgh, PA USA
LOCUS CY121440 1737 bp cRNA linear VRL 20-JUN-2012
DEFINITION Influenza A virus (A/reassortant/NYMC X-147(Wyoming/03/2003 x
Puerto Rico/8/1934)(H3N2)) hemagglutinin (HA) gene, complete cds.
ACCESSION CY121440
VERSION CY121440.1 GI:392352302
KEYWORDS .
SOURCE Influenza A virus (A/reassortant/NYMC X-147(Wyoming/03/2003 x
Puerto Rico/8/1934)(H3N2))
ORGANISM Influenza A virus (A/reassortant/NYMC X-147(Wyoming/03/2003 x
Puerto Rico/8/1934)(H3N2))
Viruses; ssRNA negative-strand viruses; Orthomyxoviridae;
Influenzavirus A.
REFERENCE 1 (bases 1 to 1737)
AUTHORS Wentworth,D.E., Dugan,V., Halpin,R., Lin,X., Bera,J., Ghedin,E.,
Fedorova,N., Overton,L., Tsitrin,T., Stockwell,T., Amedeo,P.,
Bishop,B., Chen,H., Edworthy,P., Gupta,N., Katzel,D., Li,K.,
Schobel,S., Shrivastava,S., Thovarai,V., Wang,S., Ramanunninair,M.,
Silverman,J., Devis,R., Phan,L., Le,J., Pokorny,B.A., Onodera,S.,
Fulvini,A.A., He,Y., Kilbourne,E.D., Bucher,D., Bao,Y., Sanders,R.,
Dernovoy,D., Kiryutin,B., Lipman,D.J. and Tatusova,T.
TITLE The NIAID Influenza Genome Sequencing Project
JOURNAL Unpublished
REFERENCE 2 (bases 1 to 1737)
CONSRTM The NIAID Influenza Genome Sequencing Consortium
TITLE Direct Submission
JOURNAL Submitted (20-JUN-2012) on behalf of JCVI/New York Medical
College/NCBI, National Center for Biotechnology Information, NIH,
Bethesda, MD 20894, USA
COMMENT This work was supported by the National Institute of Allergy and
Infectious Diseases (NIAID), Genome Sequencing Centers for
Infectious Diseases (GSCID) program.
FEATURES Location/Qualifiers
source 1..1737
/organism="Influenza A virus (A/reassortant/NYMC
X-147(Wyoming/03/2003 x Puerto Rico/8/1934)(H3N2))"
/mol_type="viral cRNA"
/strain="A/reassortant/NYMC X-147"
/serotype="H3N2"
/host="human"
/db_xref="taxon:1184545"
/segment="4"
/lab_host="Egg passage(s)"
misc_feature 1..1737
/db_xref="IRD:NIGSP_BUCA_00050.HA"
gene 18..1718
/gene="HA"
CDS 18..1718
/gene="HA"
/function="receptor binding and fusion protein"
/codon_start=1
/product="hemagglutinin"
/protein_id="AFM72301.1"
/db_xref="GI:392352303"
/translation="MKTIIALSYILCLVFSQKLPGNDNSTATLCLGHHAVPNGTIVKT
ITNDQIEVTNATELVQSSSTGGICDSPHQILDGENCTLIDALLGDPQCDGFQNKKWDL
FVERSKAYSNCYPYDVPDYASLRSLVASSGTLEFNNESFNWAGVTQNGTSSACKRRSN
KSFFSRLNWLTQLKYKYPALNVTMPNNEKFDKLYIWGVHHPVTDSDQISLYAQASGRI
TVSTKRSQQTVIPNIGYRPRVRDISSRISIYWTIVKPGDILLINSTGNLIAPRGYFKI
RSGKSSIMRSDAPIGKCNSECITPNGSIPNDKPFQNVNRITYGACPRYVKQNTLKLAT
GMRNVPEKQTRGIFGAIAGFIENGWEGMVDGWYGFRHQNSEGTGQAADLKSTQAAINQ
INGKLNRLIGKTNEKFHQIEKEFSEVEGRIQDLEKYVEDTKIDLWSYNAELLVALENQ
HTIDLTDSEMNKLFERTKKQLRENAEDMGNGCFKIYHKCDNACIESIRNGTYDHDVYR
DEALNNRFQIKGVELKSGYKDWILWISFAISCFLLCVALLGFIMWACQKGNIRCNICI
"
sig_peptide 18..65
/gene="HA"
mat_peptide 66..1052
/gene="HA"
/product="HA1"
mat_peptide 1053..1715
/gene="HA"
/product="HA2"
ORIGIN
1 ggataattct attaaccatg aagactatca ttgctttaag ctacattcta tgtctggttt
61 tctctcaaaa gcttcccgga aatgacaaca gcacggcaac gctgtgcctt gggcaccatg
121 cagtaccaaa cggaacgata gtgaaaacaa tcacgaatga ccaaattgaa gttactaatg
181 ctactgagct ggttcagagt tcctcaacag gtggaatatg cgacagtcct catcagatcc
241 ttgatggaga aaactgcaca ctaatagatg ctctattggg agaccctcag tgtgatggct
301 tccaaaataa gaaatgggac ctttttgttg aacgcagcaa agcctacagc aactgttacc
361 cttatgatgt gccggattat gcctccctta ggtcactagt tgcctcatcc ggcacactgg
421 agtttaacaa tgaaagcttc aattgggctg gagtcactca gaatggaaca agctctgctt
481 gcaaaaggag atctaataaa agtttcttta gtagattgaa ttggttgacc caattaaaat
541 acaaataccc agcattgaac gtgactatgc caaacaatga aaaatttgac aaattgtaca
601 tttggggggt tcaccacccg gttacggaca gtgaccaaat cagcctatat gctcaagcat
661 caggaagaat cacagtctct accaaaagaa gccaacaaac tgtaatcccg aatatcggat
721 atagacccag ggtaagggat atctccagca gaataagcat ctattggaca atagtaaaac
781 cgggagacat acttttgatt aacagcacag gaaatctaat tgctcctcgg ggttacttca
841 aaatacgaag tgggaaaagc tcaataatga gatcagatgc acccattggc aaatgcaatt
901 ctgaatgcat cactccaaat ggaagcattc ccaatgacaa accatttcaa aatgtaaaca
961 ggatcacata tggggcctgt cccagatatg ttaagcaaaa cactctgaaa ttggcaacag
1021 ggatgcgaaa tgtaccagag aaacaaacta gaggcatatt tggcgcaatc gcgggtttca
1081 tagaaaatgg ttgggaggga atggtggacg gttggtacgg tttcaggcat caaaattctg
1141 agggcacagg acaagcagca gatctcaaaa gcactcaagc agcaatcaac caaatcaatg
1201 ggaaactgaa taggttaatc gggaaaacaa acgagaaatt ccatcagatt gaaaaagaat
1261 tctcagaagt agaagggaga attcaggacc tcgagaaata tgttgaggac actaaaatag
1321 atctctggtc atacaacgcg gagcttcttg ttgccctgga aaaccaacat acaattgatc
1381 taactgactc agaaatgaac aaactgtttg aaagaacaaa gaagcaactg agggaaaatg
1441 ctgaggatat gggcaatggt tgtttcaaaa tataccacaa atgtgacaat gcctgcatag
1501 agtcaatcag aaatggaact tatgaccatg atgtatacag agatgaagca ttaaacaacc
1561 ggttccagat caaaggtgtt gagctgaagt caggatacaa agattggatc ctatggattt
1621 cctttgccat atcatgtttt ttgctttgtg ttgctttgtt ggggttcatc atgtgggcct
1681 gccaaaaagg caacattagg tgcaacattt gcatttgagt gcattaatta aaaacac

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Mon Dec 24, 2012 2:01 pm 
Online

Joined: Wed Aug 19, 2009 10:42 am
Posts: 48118
Location: Pittsburgh, PA USA
Influenza A (H3N2) [90]:

All 90 H3N2 influenza viruses tested so far have been characterized as A/Victoria/361/2011-like, the influenza A (H3N2) component of the 2012-2013 Northern Hemisphere influenza vaccine.
http://www.cdc.gov/flu/weekly/weeklyarc ... ekly47.htm



Influenza A (H3N2) [155]:

153 (98.7%) of the 155 H3N2 influenza viruses tested have been characterized as A/Victoria/361/2011-like, the influenza A (H3N2) component of the 2012-2013 Northern Hemisphere influenza vaccine.
2 (1.3%) of the 155 H3N2 viruses tested showed reduced titers with antiserum produced against A/Victoria/361/2011.
http://www.cdc.gov/flu/weekly/weeklyarc ... ekly48.htm

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Mon Dec 24, 2012 5:24 pm 
Online

Joined: Wed Aug 19, 2009 10:42 am
Posts: 48118
Location: Pittsburgh, PA USA
C285T up
EPI407006 A/HYOGO/3059/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI407005 A/OSAKA-C/71/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI407004 A/OSAKA-C/69/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI407003 A/SAPPORO/125/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI407002 A/SAPPORO/124/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI407001 A/SAPPORO/122/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI407000 A/NIIGATA-C/83/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI406999 A/YOKOHAMA/159/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI406998 A/SAITAMA-C/27/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI406995 A/YAMAGUCHI/30/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI406992 A/SAITAMA/86/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI406989 A/GUNMA/61/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI406928 A/PaisVasco/334/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI406927 A/Madrid/323/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI406237 A/Denmark/71/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI406235 A/Denmark/72/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI406202 A/GUNMA/64/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI406201 A/NAGANO/2376/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI406200 A/YAMANASHI/300/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI406199 A/YAMANASHI/297/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI406198 A/YOKOHAMA/155/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI406195 A/YOKOHAMA/153/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI406192 A/KYOTO-C/1/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI406191 A/HYOGO/3056/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI406188 A/TOKYO/12003/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI406182 A/SAPPORO/121/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI406179 A/OKINAWA/59/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI406176 A/OKINAWA/41/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI406173 A/OKINAWA/39/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI406069 A/Utah/27/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI406067 A/Delaware/15/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI406060 A/Wisconsin/41/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI406057 A/Prachuapkhirikhan/328/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI406051 A/Wyoming/20/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI406045 A/California/42/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI406042 A/Delaware/11/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI405894 A/England/569/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI405892 A/England/568/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI405077 A/Uppsala/3/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI405071 A/Stockholm/36/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI404999 A/Iowa/13/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI404997 A/Idaho/23/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI404980 A/Arizona/09/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI404971 A/Iowa/14/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI404965 A/New York/39/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI404962 A/Arizona/09/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI404959 A/North Dakota/05/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI404956 A/Indiana/162/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI404947 A/Rhode Island/08/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI404944 A/Alabama/18/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI404938 A/Pennsylvania/20/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI404932 A/Texas/82/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI404927 A/New York/39/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI404917 A/Indiana/161/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI404911 A/Iowa/15/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI402258 A/Colorado/18/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI402252 A/Florida/40/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI401764 A/Michigan/25/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI401755 A/Wisconsin/38/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI401746 A/Washington/52/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI401735 A/New York/37/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI399657 A/Alabama/17/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI399654 A/Kentucky/16/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI399645 A/Delaware/10/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI399643 A/Colorado/18/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI399636 A/Wyoming/18/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI399633 A/Alaska/04/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI399564 A/Gothenburg/8/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI398425 A/Texas/81/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI398030 A/Washington/50/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI398025 A/New York/35/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI398013 A/Montana/10/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI397815 A/Ostersund/2/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI397570 A/Bangladesh/2596/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI397567 A/Hawaii/24/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI397565 A/Maryland/29/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI397564 A/Alabama/17/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI397368 A/Malmoe/5/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI397117 A/Stockholm/29/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI397115 A/Gothenburg/7/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI397065 A/Hawaii/21/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI397061 A/Pennsylvania/18/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI397056 A/Michigan/22/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI396151 A/Illinois/12/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI395003 A/Micronesia/6310/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI394997 A/Alaska/21/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI394994 A/Micronesia/6307/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI394988 A/Hawaii/16/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI394967 A/AICHI/89/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI394961 A/KUMAMOTO-C/14/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI394837 A/Kentucky/12/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI394826 A/Idaho/22/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI394823 A/North Carolina/21/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI394807 A/Hawaii/13/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI394793 A/Ontario/RV2818/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI394775 A/Alaska/20/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI394772 A/Washington/33/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI394462 A/SINGAPORE/22/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI394337 A/WAIKATO/6/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI394334 A/WELLINGTON/36/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI394313 A/SYDNEY/205/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI394277 A/PHILIPPINES/26/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI394271 A/TASMANIA/51/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI394241 A/VICTORIA/448/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI394220 A/SINGAPORE/25/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI394176 A/TASMANIA/22/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI394096 A/CANBERRA/1/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI394093 A/TASMANIA/7/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI393444 A/KAWASAKI/86/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI393435 A/FUKUOKA-C/10/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI393434 A/YAMAGUCHI/23/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI392866 A/Ceuta/RR9992/2012 (A/H3) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI392272 A/Hong Kong/8152/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI392270 A/Hong Kong/8150/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI392268 A/Hong Kong/8147/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI392266 A/Hong Kong/8119/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI392264 A/Hong Kong/8117/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI391276 A/Hong Kong/8116/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI391250 A/Colorado/17/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI391243 A/Wisconsin/20/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI391240 A/Guangdong-Haizhu/1375/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI391234 A/Hong Kong/8118/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI388506 A/Anhui-Jinan/173/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI387796 A/Idaho/20/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI387778 A/California/35/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI383265 A/Hong Kong/8152/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI383254 A/Hong Kong/8151/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI383219 A/Hong Kong/8150/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI382804 A/Hong Kong/8149/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI382794 A/Hong Kong/8147/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI382778 A/Hong Kong/8146/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI382763 A/Hong Kong/8119/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI382725 A/Hong Kong/8118/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI382708 A/Hong Kong/8117/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI382696 A/Hong Kong/8116/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI382681 A/Hong Kong/8115/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI377495 A/California/31/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI376524 A/Alaska/04/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI363214 A/Jiangxi-Donghu/1174/2007 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI363121 A/Zhejiang/497/2005 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI360869 A/Tianjin/454/2005 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI355578 A/HaNoi/Q582/2007 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI347937 A/Hunan-Suxian/1370/2011 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI326351 A/Guangdong/548/2008 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI163683 A/Jiangxi/826/2007 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI158253 A/TIANJIN/454/2005 (A/H3) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI155689 A/Honduras/45/2006 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI153459 A/Washington/AF1688/2008 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI145637 A/TIANJIN/454/2005 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI145041 A/Queensland/32/2003 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI141972 A/Metapan/FLU8151/2007 (A/H3) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI63848 A/Honduras/AF1068/2006 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI57821 A/South Australia/61/2005 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Mon Dec 24, 2012 5:24 pm 
Online

Joined: Wed Aug 19, 2009 10:42 am
Posts: 48118
Location: Pittsburgh, PA USA
C285T down
EPI407006 A/HYOGO/3059/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI407005 A/OSAKA-C/71/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI407004 A/OSAKA-C/69/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI407003 A/SAPPORO/125/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI407002 A/SAPPORO/124/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI407001 A/SAPPORO/122/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI407000 A/NIIGATA-C/83/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI406999 A/YOKOHAMA/159/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI406998 A/SAITAMA-C/27/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI406995 A/YAMAGUCHI/30/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI406992 A/SAITAMA/86/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI406989 A/GUNMA/61/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI406928 A/PaisVasco/334/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI406927 A/Madrid/323/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI406237 A/Denmark/71/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI406235 A/Denmark/72/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI406202 A/GUNMA/64/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI406201 A/NAGANO/2376/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI406200 A/YAMANASHI/300/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI406199 A/YAMANASHI/297/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI406198 A/YOKOHAMA/155/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI406195 A/YOKOHAMA/153/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI406192 A/KYOTO-C/1/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI406191 A/HYOGO/3056/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI406188 A/TOKYO/12003/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI406182 A/SAPPORO/121/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI406179 A/OKINAWA/59/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI406176 A/OKINAWA/41/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI406173 A/OKINAWA/39/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI406069 A/Utah/27/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI406067 A/Delaware/15/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI406060 A/Wisconsin/41/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI406057 A/Prachuapkhirikhan/328/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI406051 A/Wyoming/20/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI406045 A/California/42/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI406042 A/Delaware/11/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI405894 A/England/569/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI405892 A/England/568/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI405077 A/Uppsala/3/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI405071 A/Stockholm/36/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI404999 A/Iowa/13/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI404997 A/Idaho/23/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI404980 A/Arizona/09/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI404971 A/Iowa/14/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI404965 A/New York/39/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI404962 A/Arizona/09/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI404959 A/North Dakota/05/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI404956 A/Indiana/162/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI404947 A/Rhode Island/08/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI404944 A/Alabama/18/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI404938 A/Pennsylvania/20/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI404932 A/Texas/82/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI404927 A/New York/39/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI404917 A/Indiana/161/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI404911 A/Iowa/15/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI402258 A/Colorado/18/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI402252 A/Florida/40/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI401764 A/Michigan/25/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI401755 A/Wisconsin/38/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI401746 A/Washington/52/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI401735 A/New York/37/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI399657 A/Alabama/17/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI399654 A/Kentucky/16/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI399645 A/Delaware/10/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI399643 A/Colorado/18/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI399636 A/Wyoming/18/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI399633 A/Alaska/04/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI399564 A/Gothenburg/8/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI398425 A/Texas/81/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI398030 A/Washington/50/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI398025 A/New York/35/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI398013 A/Montana/10/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI397815 A/Ostersund/2/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI397570 A/Bangladesh/2596/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI397567 A/Hawaii/24/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI397565 A/Maryland/29/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI397564 A/Alabama/17/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI397368 A/Malmoe/5/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI397117 A/Stockholm/29/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI397115 A/Gothenburg/7/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI397065 A/Hawaii/21/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI397061 A/Pennsylvania/18/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI397056 A/Michigan/22/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI396151 A/Illinois/12/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI395003 A/Micronesia/6310/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI394997 A/Alaska/21/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI394994 A/Micronesia/6307/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI394988 A/Hawaii/16/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI394961 A/KUMAMOTO-C/14/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI394837 A/Kentucky/12/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI394826 A/Idaho/22/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI394823 A/North Carolina/21/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI394807 A/Hawaii/13/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI394793 A/Ontario/RV2818/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI394775 A/Alaska/20/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI394772 A/Washington/33/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI394462 A/SINGAPORE/22/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI394337 A/WAIKATO/6/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI394334 A/WELLINGTON/36/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI394313 A/SYDNEY/205/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI394277 A/PHILIPPINES/26/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI394271 A/TASMANIA/51/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI394241 A/VICTORIA/448/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI394220 A/SINGAPORE/25/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI394176 A/TASMANIA/22/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI394093 A/TASMANIA/7/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI393444 A/KAWASAKI/86/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI393435 A/FUKUOKA-C/10/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI393434 A/YAMAGUCHI/23/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI392866 A/Ceuta/RR9992/2012 (A/H3) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI392272 A/Hong Kong/8152/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI392270 A/Hong Kong/8150/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI392268 A/Hong Kong/8147/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI392266 A/Hong Kong/8119/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI392264 A/Hong Kong/8117/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI391276 A/Hong Kong/8116/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI391250 A/Colorado/17/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI391243 A/Wisconsin/20/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI391240 A/Guangdong-Haizhu/1375/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI391234 A/Hong Kong/8118/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI388506 A/Anhui-Jinan/173/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI387796 A/Idaho/20/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI387778 A/California/35/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI383265 A/Hong Kong/8152/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI383254 A/Hong Kong/8151/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI383219 A/Hong Kong/8150/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI382794 A/Hong Kong/8147/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI382778 A/Hong Kong/8146/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI382763 A/Hong Kong/8119/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI382725 A/Hong Kong/8118/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI382708 A/Hong Kong/8117/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI382696 A/Hong Kong/8116/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI382681 A/Hong Kong/8115/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI377495 A/California/31/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI376524 A/Alaska/04/2012 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI369863 A/Extremadura/RR9594/2012 (A/H3) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI363214 A/Jiangxi-Donghu/1174/2007 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI363121 A/Zhejiang/497/2005 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI360869 A/Tianjin/454/2005 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI356193 A/Extremadura/RR9291/2012 (A/H3) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI355578 A/HaNoi/Q582/2007 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI347937 A/Hunan-Suxian/1370/2011 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI326351 A/Guangdong/548/2008 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI287485 A/swine/Guangdong/811/2006 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI287484 A/swine/Guangdong/423/2006 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI236420 A/swine/Guangdong/113/2002 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI236404 A/swine/Guangdong/110/2002 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI236396 A/swine/Guangdong/107/2002 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI163683 A/Jiangxi/826/2007 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI162380 A/swine/Italy/268086/2003 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI162379 A/swine/Italy/65260-11/2006 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI162378 A/swine/Italy/50127/2007 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI162377 A/swine/Italy/10659-1/2007 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI158253 A/TIANJIN/454/2005 (A/H3) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI155689 A/Honduras/45/2006 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI153459 A/Washington/AF1688/2008 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI145637 A/TIANJIN/454/2005 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI145041 A/Queensland/32/2003 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI141972 A/Metapan/FLU8151/2007 (A/H3) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI120487 A/swine/Italy/39158/2007 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI120485 A/swine/Italy/10762/2007 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI120483 A/swine/Italy/114347/2006 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI120481 A/swine/Italy/120032/2006 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI120479 A/swine/Italy/79604/2006 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI120477 A/swine/Italy/32242/2006 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI120475 A/swine/Italy/30574/2005 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI120465 A/swine/Italy/253025/2003 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI118980 A/England/864/1975 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI106816 A/swine/Italy/1367-2/1994 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI106814 A/swine/Italy/1188/1992 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI106812 A/swine/Italy/1184/1992 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI63848 A/Honduras/AF1068/2006 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI57821 A/South Australia/61/2005 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI36365 A/New York/765/1993 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI23866 A/Bilthoven/628/76 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI23792 A/Bilthoven/2271/76 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)
EPI19244 A/swine/Hong Kong/1144/02 (A/H3N2) segment 4 (HA) 27.0 9.367317e+00 14/14 (100%)

_________________
www.twitter.com/hniman


Top
 Profile  
 
Display posts from previous:  Sort by  
Post new topic Reply to topic  [ 25 posts ]  Go to page 1, 2, 3  Next

All times are UTC - 5 hours [ DST ]


Who is online

Users browsing this forum: MSN [Bot], niman and 170 guests


You cannot post new topics in this forum
You cannot reply to topics in this forum
You cannot edit your posts in this forum
You cannot delete your posts in this forum
You cannot post attachments in this forum

Search for:
Jump to:  
Powered by phpBB® Forum Software © phpBB Group