Rhiza Labs FluTracker Forum

The place to discuss the flu
It is currently Fri Aug 01, 2014 6:27 pm

All times are UTC - 5 hours [ DST ]




Post new topic Reply to topic  [ 12 posts ]  Go to page 1, 2  Next
Author Message
PostPosted: Thu Nov 15, 2012 7:04 am 
Online

Joined: Wed Aug 19, 2009 10:42 am
Posts: 40603
Location: Pittsburgh, PA USA
The USDA has released another series of H3N2v sequneces including another 2012 North Carolina swine match with human cases.

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Thu Nov 15, 2012 7:05 am 
Online

Joined: Wed Aug 19, 2009 10:42 am
Posts: 40603
Location: Pittsburgh, PA USA
LOCUS JX975021 1410 bp cRNA linear VRL 14-NOV-2012
DEFINITION Influenza A virus (A/swine/North Carolina/A01203801/2012(H3N2))
segment 6 neuraminidase (NA) gene, complete cds.
ACCESSION JX975021
VERSION JX975021.1 GI:411170179
KEYWORDS .
SOURCE Influenza A virus (A/swine/North Carolina/A01203801/2012(H3N2))
ORGANISM Influenza A virus (A/swine/North Carolina/A01203801/2012(H3N2))
Viruses; ssRNA negative-strand viruses; Orthomyxoviridae;
Influenzavirus A.
REFERENCE 1 (bases 1 to 1410)
AUTHORS Lin,K., Haney,D.M., Bade,D.D. and Zhang,J.
CONSRTM USDA Swine Surveillance
TITLE Direct Submission
JOURNAL Submitted (16-OCT-2012) Veterinary Diagnostic and Production Animal
Medicine, Iowa State University, 1600 South 16th Street, Ames, IA
50011, USA
FEATURES Location/Qualifiers
source 1..1410
/organism="Influenza A virus (A/swine/North
Carolina/A01203801/2012(H3N2))"
/mol_type="viral cRNA"
/strain="A/swine/North Carolina/A01203801/2012"
/serotype="H3N2"
/host="swine"
/db_xref="taxon:1243886"
/segment="6"
/country="USA"
/collection_date="Sep-2012"
gene 1..1410
/gene="NA"
CDS 1..1410
/gene="NA"
/codon_start=1
/product="neuraminidase"
/protein_id="AFW16012.1"
/db_xref="GI:411170180"
/translation="MNPNQKIITIGSVSLIIATICFLMQVAILVTTVTLHFKQHDCDS
SPNNQVMLCEPTIIERNKTEIVYLTNTTVEKEICPKPAEYRNWSKPQCNITGFAPFSK
DNSIRLSAGGDIWVTREPYVSCDPDKCYQFALGQGTTLNNGHSNDTVHDRTPYRTLLM
NELGVPFHLGTRQVCIAWSSSSCHDGKAWLHVCITGDDKNATASFIYNGRLADSIGSW
SKNILRTQESECVCINGTCTVVMTDGSASGKADTKILFIEEGKIIHISTLSGSAQHVE
ECSCYPRYPGVRCVCRDNWKGSNRPIVDINVKDYSIVSSYVCSGLVGDTPRKNDSFSS
SHCLDPNNEEGGHGVKGWAFDDGNDVWMGRTISEKSRLGYETFKVIKGWSKPNSKLQT
NRQVIVGRGNRSGYSGIFSVEGKNCINRCFYVELIRGRKEETKVWWTSNSIVVFCGTS
GTYGTGSWPDGADINLMPI"
misc_feature 1..1410
/db_xref="IRD:IRD-A01203801.6"
ORIGIN
1 atgaatccaa atcaaaagat aataacaatt ggctctgttt ctctcatcat tgccacaata
61 tgcttcctta tgcaagttgc catcctggtg actactgtaa cactgcattt caagcaacat
121 gattgcgact cctccccaaa caaccaagta atgctttgtg aaccaacaat aatagaaaga
181 aacaaaacgg agattgtgta tctgaccaac accactgtag agaaggaaat atgccccaaa
241 ccagcagaat acagaaattg gtcaaagcct caatgtaaca ttacaggatt tgcacctttt
301 tctaaggaca attcgattcg gctttctgct ggtggggaca tctgggtgac aagagaacct
361 tatgtgtcat gcgatcccga caagtgttat caatttgccc ttgggcaggg aacaacacta
421 aacaacgggc attcaaatga cactgtacat gataggaccc cttaccgaac cctattgatg
481 aatgaattgg gtgttccatt tcatttggga accaggcaag tgtgcatagc atggtccagt
541 tcaagttgtc acgatgggaa agcatggctg catgtttgta taactgggga tgataaaaat
601 gcaactgcta gcttcattta caatgggagg ctagcagata gtattggttc atggtccaaa
661 aatatactaa gaacccagga gtcggaatgc gtttgtatta atggaacttg tacagtagtc
721 atgactgatg gaagcgcttc cggaaaagct gatactaaaa tattattcat tgaggagggg
781 aaaatcattc atattagcac gttgtcagga agtgcgcagc atgtcgagga gtgctcttgt
841 tatcctcgat atcctggtgt cagatgcgtc tgcagagaca actggaaagg ctccaatagg
901 cccatagttg atataaatgt aaaggattat agcattgttt ccagttatgt atgctctgga
961 cttgttggag acacacccag aaaaaacgac agcttcagca gtagtcattg cctagatcct
1021 aacaatgagg aaggtggtca tggggtgaaa ggctgggcct ttgatgatgg aaatgacgtg
1081 tggatgggaa gaacgatcag cgagaagtca cgcttaggct atgaaacctt caaagtcatc
1141 aaaggatggt ccaaacccaa ctccaaatta cagacaaata ggcaagttat agttggtaga
1201 ggtaacaggt ccggttattc tggtattttc tccgttgaag gcaaaaactg catcaatagg
1261 tgcttttatg tggagttgat aaggggaagg aaagaggaaa ctaaagtctg gtggacctca
1321 aacagtattg ttgtgttttg tggcacctca ggtacgtatg gaacaggctc atggcctgat
1381 ggggcggata tcaatctcat gcctatataa

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Thu Nov 15, 2012 7:06 am 
Online

Joined: Wed Aug 19, 2009 10:42 am
Posts: 40603
Location: Pittsburgh, PA USA
EPI397946 A/Ohio/84/2012 (A/H3N2) segment 6 (NA) 2599.4 0.000000e+00 1409/1410 (99%)
EPI397904 A/Hawaii/03/2012 (A/H3N2) segment 6 (NA) 2599.4 0.000000e+00 1409/1410 (99%)
EPI397626 A/Ohio/57/2012 (A/H3N2) segment 6 (NA) 2599.4 0.000000e+00 1409/1410 (99%)
EPI397554 A/Ohio/86/2012 (A/H3N2) segment 6 (NA) 2599.4 0.000000e+00 1409/1410 (99%)
EPI397425 A/Minnesota/15/2012 (A/H3N2) segment 6 (NA) 2599.4 0.000000e+00 1409/1410 (99%)
EPI396191 A/Ohio/77/2012 (A/H3N2) segment 6 (NA) 2599.4 0.000000e+00 1409/1410 (99%)
EPI394925 A/Illinois/11/2012 (A/H3N2) segment 6 (NA) 2599.4 0.000000e+00 1409/1410 (99%)
EPI393701 A/Ohio/64/2012 (A/H3N2) segment 6 (NA) 2599.4 0.000000e+00 1409/1410 (99%)
EPI383539 A/swine/Indiana/A01203509/2012 (A/H3N2) segment 6 (NA) 2599.4 0.000000e+00 1409/1410 (99%)
EPI398034 A/Maryland/22/2012 (A/H3N2) segment 6 (NA) 2593.8 0.000000e+00 1408/1410 (99%)
EPI397931 A/Ohio/19/2012 (A/H3N2) segment 6 (NA) 2593.8 0.000000e+00 1408/1410 (99%)
EPI397918 A/Ohio/17/2012 (A/H3N2) segment 6 (NA) 2593.8 0.000000e+00 1408/1410 (99%)
EPI397750 A/Ohio/87/2012 (A/H3N2) segment 6 (NA) 2593.8 0.000000e+00 1408/1410 (99%)
EPI397661 A/Maryland/28/2012 (A/H3N2) segment 6 (NA) 2593.8 0.000000e+00 1408/1410 (99%)
EPI397627 A/Ohio/63/2012 (A/H3N2) segment 6 (NA) 2593.8 0.000000e+00 1408/1410 (99%)
EPI397625 A/Ohio/43/2012 (A/H3N2) segment 6 (NA) 2593.8 0.000000e+00 1408/1410 (99%)
EPI397624 A/Ohio/80/2012 (A/H3N2) segment 6 (NA) 2593.8 0.000000e+00 1408/1410 (99%)
EPI397621 A/Ohio/79/2012 (A/H3N2) segment 6 (NA) 2593.8 0.000000e+00 1408/1410 (99%)
EPI397620 A/Maryland/25/2012 (A/H3N2) segment 6 (NA) 2593.8 0.000000e+00 1408/1410 (99%)
EPI397547 A/Ohio/83/2012 (A/H3N2) segment 6 (NA) 2593.8 0.000000e+00 1408/1410 (99%)
EPI397539 A/Ohio/56/2012 (A/H3N2) segment 6 (NA) 2593.8 0.000000e+00 1408/1410 (99%)
EPI397531 A/Ohio/47/2012 (A/H3N2) segment 6 (NA) 2593.8 0.000000e+00 1408/1410 (99%)
EPI397523 A/Ohio/44/2012 (A/H3N2) segment 6 (NA) 2593.8 0.000000e+00 1408/1410 (99%)
EPI397515 A/Ohio/36/2012 (A/H3N2) segment 6 (NA) 2593.8 0.000000e+00 1408/1410 (99%)
EPI397431 A/Ohio/81/2012 (A/H3N2) segment 6 (NA) 2593.8 0.000000e+00 1408/1410 (99%)
EPI397395 A/Indiana/93/2012 (A/H3N2) segment 6 (NA) 2593.8 0.000000e+00 1408/1410 (99%)
EPI397377 A/Indiana/123/2012 (A/H3N2) segment 6 (NA) 2593.8 0.000000e+00 1408/1410 (99%)
EPI397363 A/Ohio/23/2012 (A/H3N2) segment 6 (NA) 2593.8 0.000000e+00 1408/1410 (99%)
EPI397350 A/Ohio/37/2012 (A/H3N2) segment 6 (NA) 2593.8 0.000000e+00 1408/1410 (99%)
EPI397208 A/Ohio/78/2012 (A/H3N2) segment 6 (NA) 2593.8 0.000000e+00 1408/1410 (99%)
EPI397088 A/Indiana/52/2012 (A/H3N2) segment 6 (NA) 2593.8 0.000000e+00 1408/1410 (99%)
EPI396276 A/Indiana/135/2012 (A/H3N2) segment 6 (NA) 2593.8 0.000000e+00 1408/1410 (99%)
EPI396269 A/Indiana/133/2012 (A/H3N2) segment 6 (NA) 2593.8 0.000000e+00 1408/1410 (99%)
EPI396261 A/Indiana/127/2012 (A/H3N2) segment 6 (NA) 2593.8 0.000000e+00 1408/1410 (99%)
EPI396253 A/Indiana/126/2012 (A/H3N2) segment 6 (NA) 2593.8 0.000000e+00 1408/1410 (99%)
EPI396234 A/Ohio/34/2012 (A/H3N2) segment 6 (NA) 2593.8 0.000000e+00 1408/1410 (99%)
EPI395336 A/Indiana/21/2012 (A/H3N2) segment 6 (NA) 2593.8 0.000000e+00 1408/1410 (99%)
EPI395330 A/West Virginia/06/2011 (A/H3N2) segment 6 (NA) 2593.8 0.000000e+00 1408/1410 (99%)
EPI395327 A/West Virginia/06/2011 (A/H3N2) segment 6 (NA) 2593.8 0.000000e+00 1408/1410 (99%)
EPI395266 A/Ohio/65/2012 (A/H3N2) segment 6 (NA) 2593.8 0.000000e+00 1408/1410 (99%)
EPI395258 A/Ohio/35/2012 (A/H3N2) segment 6 (NA) 2593.8 0.000000e+00 1408/1410 (99%)
EPI394936 A/Ohio/75/2012 (A/H3N2) segment 6 (NA) 2593.8 0.000000e+00 1408/1410 (99%)
EPI394932 A/Wisconsin/23/2012 (A/H3N2) segment 6 (NA) 2593.8 0.000000e+00 1408/1410 (99%)
EPI394920 A/Ohio/69/2012 (A/H3N2) segment 6 (NA) 2593.8 0.000000e+00 1408/1410 (99%)
EPI394912 A/Indiana/132/2012 (A/H3N2) segment 6 (NA) 2593.8 0.000000e+00 1408/1410 (99%)
EPI394905 A/Ohio/62/2012 (A/H3N2) segment 6 (NA) 2593.8 0.000000e+00 1408/1410 (99%)
EPI394062 A/Indiana/21/2012 (A/H3N2) segment 6 (NA) 2593.8 0.000000e+00 1408/1410 (99%)
EPI393696 A/Indiana/20/2012 (A/H3N2) segment 6 (NA) 2593.8 0.000000e+00 1408/1410 (99%)
EPI393694 A/West Virginia/16/2012 (A/H3N2) segment 6 (NA) 2593.8 0.000000e+00 1408/1410 (99%)
EPI393687 A/Ohio/23/2012 (A/H3N2) segment 6 (NA) 2593.8 0.000000e+00 1408/1410 (99%)
EPI393680 A/West Virginia/10/2012 (A/H3N2) segment 6 (NA) 2593.8 0.000000e+00 1408/1410 (99%)
EPI393672 A/Ohio/71/2012 (A/H3N2) segment 6 (NA) 2593.8 0.000000e+00 1408/1410 (99%)
EPI393666 A/Ohio/28/2012 (A/H3N2) segment 6 (NA) 2593.8 0.000000e+00 1408/1410 (99%)
EPI393510 A/Ohio/52/2012 (A/H3N2) segment 6 (NA) 2593.8 0.000000e+00 1408/1410 (99%)
EPI393316 A/Ohio/38/2012 (A/H3N2) segment 6 (NA) 2593.8 0.000000e+00 1408/1410 (99%)
EPI393310 A/West Virginia/09/2012 (A/H3N2) segment 6 (NA) 2593.8 0.000000e+00 1408/1410 (99%)
EPI393305 A/Indiana/18/2012 (A/H3N2) segment 6 (NA) 2593.8 0.000000e+00 1408/1410 (99%)
EPI393294 A/Ohio/24/2012 (A/H3N2) segment 6 (NA) 2593.8 0.000000e+00 1408/1410 (99%)
EPI392704 A/Indiana/52/2012 (A/H3N2) segment 6 (NA) 2593.8 0.000000e+00 1408/1410 (99%)
EPI392683 A/Indiana/13/2012 (A/H3N2) segment 6 (NA) 2593.8 0.000000e+00 1408/1410 (99%)
EPI392677 A/Ohio/13/2012 (A/H3N2) segment 6 (NA) 2593.8 0.000000e+00 1408/1410 (99%)
EPI388365 A/Ohio/17/2012 (A/H3N2) segment 6 (NA) 2593.8 0.000000e+00 1408/1410 (99%)
EPI388345 A/Indiana/15/2012 (A/H3N2) segment 6 (NA) 2593.8 0.000000e+00 1408/1410 (99%)
EPI388338 A/Ohio/16/2012 (A/H3N2) segment 6 (NA) 2593.8 0.000000e+00 1408/1410 (99%)
EPI388329 A/Ohio/20/2012 (A/H3N2) segment 6 (NA) 2593.8 0.000000e+00 1408/1410 (99%)
EPI388320 A/Ohio/18/2012 (A/H3N2) segment 6 (NA) 2593.8 0.000000e+00 1408/1410 (99%)
EPI388318 A/Ohio/20/2012 (A/H3N2) segment 6 (NA) 2593.8 0.000000e+00 1408/1410 (99%)
EPI388311 A/Ohio/15/2012 (A/H3N2) segment 6 (NA) 2593.8 0.000000e+00 1408/1410 (99%)
EPI388304 A/Ohio/14/2012 (A/H3N2) segment 6 (NA) 2593.8 0.000000e+00 1408/1410 (99%)
EPI378522 A/Indiana/09/2012 (A/H3N2) segment 6 (NA) 2593.8 0.000000e+00 1408/1410 (99%)
EPI378514 A/Indiana/07/2012 (A/H3N2) segment 6 (NA) 2593.8 0.000000e+00 1408/1410 (99%)
EPI397924 A/Ohio/18/2012 (A/H3N2) segment 6 (NA) 2590.1 0.000000e+00 1407/1410 (99%)
EPI397623 A/Indiana/150/2012 (A/H3N2) segment 6 (NA) 2588.3 0.000000e+00 1407/1410 (99%)
EPI397561 A/Wisconsin/29/2012 (A/H3N2) segment 6 (NA) 2588.3 0.000000e+00 1407/1410 (99%)
EPI397502 A/Indiana/104/2012 (A/H3N2) segment 6 (NA) 2588.3 0.000000e+00 1407/1410 (99%)
EPI397445 A/Wisconsin/31/2012 (A/H3N2) segment 6 (NA) 2588.3 0.000000e+00 1407/1410 (99%)
EPI397439 A/Wisconsin/30/2012 (A/H3N2) segment 6 (NA) 2588.3 0.000000e+00 1407/1410 (99%)
EPI397411 A/Michigan/16/2012 (A/H3N2) segment 6 (NA) 2588.3 0.000000e+00 1407/1410 (99%)
EPI397403 A/Indiana/99/2012 (A/H3N2) segment 6 (NA) 2588.3 0.000000e+00 1407/1410 (99%)
EPI397387 A/Indiana/49/2012 (A/H3N2) segment 6 (NA) 2588.3 0.000000e+00 1407/1410 (99%)
EPI397214 A/Pennsylvania/17/2012 (A/H3N2) segment 6 (NA) 2588.3 0.000000e+00 1407/1410 (99%)
EPI397212 A/Indiana/115/2012 (A/H3N2) segment 6 (NA) 2588.3 0.000000e+00 1407/1410 (99%)
EPI397124 A/Pennsylvania/11/2012 (A/H3N2) segment 6 (NA) 2588.3 0.000000e+00 1407/1410 (99%)
EPI396298 A/Maryland/23/2012 (A/H3N2) segment 6 (NA) 2588.3 0.000000e+00 1407/1410 (99%)
EPI396245 A/Indiana/125/2012 (A/H3N2) segment 6 (NA) 2588.3 0.000000e+00 1407/1410 (99%)
EPI396229 A/Indiana/147/2012 (A/H3N2) segment 6 (NA) 2588.3 0.000000e+00 1407/1410 (99%)
EPI396222 A/Indiana/57/2012 (A/H3N2) segment 6 (NA) 2588.3 0.000000e+00 1407/1410 (99%)
EPI396207 A/Indiana/149/2012 (A/H3N2) segment 6 (NA) 2588.3 0.000000e+00 1407/1410 (99%)
EPI396182 A/Indiana/77/2012 (A/H3N2) segment 6 (NA) 2588.3 0.000000e+00 1407/1410 (99%)
EPI395269 A/Pennsylvania/11/2012 (A/H3N2) segment 6 (NA) 2588.3 0.000000e+00 1407/1410 (99%)
EPI394076 A/Wisconsin/27/2012 (A/H3N2) segment 6 (NA) 2588.3 0.000000e+00 1407/1410 (99%)
EPI394068 A/Pennsylvania/11/2012 (A/H3N2) segment 6 (NA) 2588.3 0.000000e+00 1407/1410 (99%)
EPI394065 A/Indiana/60/2012 (A/H3N2) segment 6 (NA) 2588.3 0.000000e+00 1407/1410 (99%)
EPI394059 A/Indiana/38/2012 (A/H3N2) segment 6 (NA) 2588.3 0.000000e+00 1407/1410 (99%)
EPI393518 A/Indiana/65/2012 (A/H3N2) segment 6 (NA) 2588.3 0.000000e+00 1407/1410 (99%)
EPI393297 A/Indiana/21/2012 (A/H3N2) segment 6 (NA) 2588.3 0.000000e+00 1407/1410 (99%)
EPI393291 A/Indiana/38/2012 (A/H3N2) segment 6 (NA) 2588.3 0.000000e+00 1407/1410 (99%)
EPI392754 A/Indiana/14/2012 (A/H3N2) segment 6 (NA) 2588.3 0.000000e+00 1407/1410 (99%)
EPI392752 A/Indiana/16/2012 (A/H3N2) segment 6 (NA) 2588.3 0.000000e+00 1407/1410 (99%)
EPI392710 A/Indiana/60/2012 (A/H3N2) segment 6 (NA) 2588.3 0.000000e+00 1407/1410 (99%)

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Thu Nov 15, 2012 7:08 am 
Online

Joined: Wed Aug 19, 2009 10:42 am
Posts: 40603
Location: Pittsburgh, PA USA
EPI391413 A/swine/North Carolina/A01203272/2012 (A/H3N2) segment 4 (HA) 3109.0 0.000000e+00 1695/1701 (99%)
EPI397426 A/Minnesota/15/2012 (A/H3N2) segment 4 (HA) 3103.5 0.000000e+00 1694/1701 (99%)
EPI396270 A/Indiana/133/2012 (A/H3N2) segment 4 (HA) 3103.5 0.000000e+00 1694/1701 (99%)
EPI394913 A/Indiana/132/2012 (A/H3N2) segment 4 (HA) 3103.5 0.000000e+00 1694/1701 (99%)
EPI388327 A/Indiana/14/2012 (A/H3N2) segment 4 (HA) 3103.5 0.000000e+00 1694/1701 (99%)
EPI397913 A/Indiana/123/2012 (A/H3N2) segment 4 (HA) 3098.0 0.000000e+00 1693/1701 (99%)
EPI397906 A/Illinois/11/2012 (A/H3N2) segment 4 (HA) 3098.0 0.000000e+00 1693/1701 (99%)
EPI397662 A/Maryland/28/2012 (A/H3N2) segment 4 (HA) 3098.0 0.000000e+00 1693/1701 (99%)
EPI397396 A/Indiana/93/2012 (A/H3N2) segment 4 (HA) 3098.0 0.000000e+00 1693/1701 (99%)
EPI397210 A/Maryland/25/2012 (A/H3N2) segment 4 (HA) 3098.0 0.000000e+00 1693/1701 (99%)
EPI397006 A/Ohio/78/2012 (A/H3N2) segment 4 (HA) 3098.0 0.000000e+00 1693/1701 (99%)
EPI396262 A/Indiana/127/2012 (A/H3N2) segment 4 (HA) 3098.0 0.000000e+00 1693/1701 (99%)
EPI396254 A/Indiana/126/2012 (A/H3N2) segment 4 (HA) 3098.0 0.000000e+00 1693/1701 (99%)
EPI395259 A/Ohio/35/2012 (A/H3N2) segment 4 (HA) 3098.0 0.000000e+00 1693/1701 (99%)
EPI394944 A/Maryland/22/2012 (A/H3N2) segment 4 (HA) 3098.0 0.000000e+00 1693/1701 (99%)
EPI393306 A/Indiana/18/2012 (A/H3N2) segment 4 (HA) 3098.0 0.000000e+00 1693/1701 (99%)
EPI392926 A/Maryland/20/2012 (A/H3N2) segment 4 (HA) 3098.0 0.000000e+00 1693/1701 (99%)
EPI391404 A/swine/Ohio/A01203186/2012 (A/H3N2) segment 4 (HA) 3098.0 0.000000e+00 1693/1701 (99%)
EPI388352 A/Indiana/20/2012 (A/H3N2) segment 4 (HA) 3098.0 0.000000e+00 1693/1701 (99%)
EPI388346 A/Indiana/15/2012 (A/H3N2) segment 4 (HA) 3098.0 0.000000e+00 1693/1701 (99%)
EPI388298 A/Indiana/19/2012 (A/H3N2) segment 4 (HA) 3098.0 0.000000e+00 1693/1701 (99%)
EPI388282 A/Indiana/13/2012 (A/H3N2) segment 4 (HA) 3098.0 0.000000e+00 1693/1701 (99%)
EPI383528 A/swine/Indiana/A01203509/2012 (A/H3N2) segment 4 (HA) 3098.0 0.000000e+00 1693/1701 (99%)
EPI378523 A/Indiana/09/2012 (A/H3N2) segment 4 (HA) 3098.0 0.000000e+00 1693/1701 (99%)
EPI378515 A/Indiana/07/2012 (A/H3N2) segment 4 (HA) 3098.0 0.000000e+00 1693/1701 (99%)
EPI378502 A/Indiana/07/2012 (A/H3N2) segment 4 (HA) 3098.0 0.000000e+00 1693/1701 (99%)
EPI366030 A/Utah/10/2012 (A/H3N2) segment 4 (HA) 3098.0 0.000000e+00 1693/1701 (99%)
EPI346493 A/West Virginia/06/2011 (A/H3N2) segment 4 (HA) 3098.0 0.000000e+00 1693/1701 (99%)
EPI395328 A/West Virginia/06/2011 (A/H3N2) segment 4 (HA) 3094.3 0.000000e+00 1692/1701 (99%)
EPI397969 A/Wisconsin/34/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI397962 A/Wisconsin/30/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI397954 A/Ohio/85/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI397939 A/Ohio/41/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI397548 A/Ohio/84/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI397540 A/Ohio/56/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI397532 A/Ohio/47/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI397524 A/Ohio/44/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI397516 A/Ohio/36/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI397503 A/Indiana/104/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI397446 A/Wisconsin/31/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI397432 A/Ohio/81/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI397385 A/Indiana/138/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI397351 A/Ohio/37/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI397340 A/Indiana/150/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI397089 A/Indiana/52/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI396299 A/Maryland/23/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI396280 A/Indiana/144/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI396208 A/Indiana/149/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI396192 A/Ohio/77/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI396183 A/Indiana/77/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI396175 A/Ohio/80/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI395357 A/Pennsylvania/17/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI395344 A/Wisconsin/28/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI395270 A/Pennsylvania/11/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI395267 A/Ohio/65/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI394937 A/Ohio/75/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI394933 A/Wisconsin/23/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI394921 A/Ohio/69/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI394077 A/Wisconsin/27/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI393914 A/swine/Indiana/A00968380/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI393782 A/Ohio/74/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI393702 A/Ohio/64/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI393695 A/West Virginia/16/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI393681 A/West Virginia/10/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI393673 A/Ohio/71/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI393519 A/Indiana/65/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI393317 A/Ohio/38/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI393311 A/West Virginia/09/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI393299 A/Indiana/31/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI393298 A/Indiana/21/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI392748 A/Wisconsin/22/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI392735 A/Pennsylvania/13/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI392696 A/Indiana/43/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI392693 A/Indiana/38/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI388362 A/Indiana/16/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI388332 A/Utah/10/2012 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI342603 A/swine/NY/A01104005/2011 (A/H3N2) segment 4 (HA) 3092.4 0.000000e+00 1692/1701 (99%)
EPI397562 A/Wisconsin/29/2012 (A/H3N2) segment 4 (HA) 3088.7 0.000000e+00 1691/1701 (99%)
EPI397206 A/Ohio/34/2012 (A/H3N2) segment 4 (HA) 3088.7 0.000000e+00 1691/1701 (99%)
EPI396277 A/Indiana/135/2012 (A/H3N2) segment 4 (HA) 3088.7 0.000000e+00 1691/1701 (99%)
EPI396200 A/Ohio/79/2012 (A/H3N2) segment 4 (HA) 3088.7 0.000000e+00 1691/1701 (99%)
EPI395331 A/West Virginia/06/2011 (A/H3N2) segment 4 (HA) 3088.7 0.000000e+00 1691/1701 (99%)
EPI394060 A/Indiana/38/2012 (A/H3N2) segment 4 (HA) 3088.7 0.000000e+00 1691/1701 (99%)
EPI392699 A/Indiana/46/2012 (A/H3N2) segment 4 (HA) 3088.7 0.000000e+00 1691/1701 (99%)
EPI388290 A/Indiana/17/2012 (A/H3N2) segment 4 (HA) 3088.7 0.000000e+00 1691/1701 (99%)
EPI398040 A/Ohio/57/2012 (A/H3N2) segment 4 (HA) 3086.9 0.000000e+00 1691/1701 (99%)
EPI397912 A/Indiana/114/2012 (A/H3N2) segment 4 (HA) 3086.9 0.000000e+00 1691/1701 (99%)
EPI397905 A/Hawaii/03/2012 (A/H3N2) segment 4 (HA) 3086.9 0.000000e+00 1691/1701 (99%)
EPI397654 A/Indiana/90/2012 (A/H3N2) segment 4 (HA) 3086.9 0.000000e+00 1691/1701 (99%)
EPI397555 A/Ohio/86/2012 (A/H3N2) segment 4 (HA) 3086.9 0.000000e+00 1691/1701 (99%)
EPI397404 A/Indiana/99/2012 (A/H3N2) segment 4 (HA) 3086.9 0.000000e+00 1691/1701 (99%)
EPI397211 A/Indiana/113/2012 (A/H3N2) segment 4 (HA) 3086.9 0.000000e+00 1691/1701 (99%)
EPI396291 A/Ohio/63/2012 (A/H3N2) segment 4 (HA) 3086.9 0.000000e+00 1691/1701 (99%)
EPI396239 A/Indiana/103/2012 (A/H3N2) segment 4 (HA) 3086.9 0.000000e+00 1691/1701 (99%)
EPI395251 A/Indiana/152/2012 (A/H3N2) segment 4 (HA) 3086.9 0.000000e+00 1691/1701 (99%)
EPI394069 A/Pennsylvania/11/2012 (A/H3N2) segment 4 (HA) 3086.9 0.000000e+00 1691/1701 (99%)
EPI394063 A/Indiana/21/2012 (A/H3N2) segment 4 (HA) 3086.9 0.000000e+00 1691/1701 (99%)
EPI381873 A/Hawaii/03/2012 (A/H3N2) segment 4 (HA) 3086.9 0.000000e+00 1691/1701 (99%)
EPI339171 A/Maine/06/2011 (A/H3N2) segment 4 (HA) 3086.9 0.000000e+00 1691/1701 (99%)
EPI392705 A/Indiana/52/2012 (A/H3N2) segment 4 (HA) 3085.0 0.000000e+00 1690/1701 (99%)

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Thu Nov 15, 2012 7:09 am 
Online

Joined: Wed Aug 19, 2009 10:42 am
Posts: 40603
Location: Pittsburgh, PA USA
EPI395329 A/West Virginia/06/2011 (A/H3N2) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI395324 A/West Virginia/06/2011 (A/H3N2) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI391475 A/swine/Ohio/A01203186/2012 (A/H3N2) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI391470 A/swine/North Carolina/A01203272/2012 (A/H3N2) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI397957 A/Ohio/88/2012 (A/H3N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI397943 A/Ohio/84/2012 (A/H3N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI397902 A/Hawaii/03/2012 (A/H3N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI397551 A/Ohio/86/2012 (A/H3N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI397535 A/Ohio/56/2012 (A/H3N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI397435 A/Wisconsin/30/2012 (A/H3N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI397421 A/Minnesota/15/2012 (A/H3N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI396197 A/Ohio/79/2012 (A/H3N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI396187 A/Ohio/77/2012 (A/H3N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI396172 A/Ohio/80/2012 (A/H3N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI395354 A/Pennsylvania/17/2012 (A/H3N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI395340 A/Wisconsin/28/2012 (A/H3N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI395268 A/Pennsylvania/11/2012 (A/H3N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI394928 A/Wisconsin/23/2012 (A/H3N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI393916 A/swine/Indiana/A00968380/2012 (A/H3N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI393699 A/Ohio/64/2012 (A/H3N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI391459 A/swine/Wisconsin/A01203142/2012 (A/H1N1) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI390675 A/swine/Indiana/A01243254/2012 (A/H1N1) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI383548 A/swine/Iowa/A01203503/2012 (A/H3N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI347602 A/Iowa/07/2011 (A/H3N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI346435 A/Iowa/08/2011 (A/H3N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI346427 A/Iowa/07/2011 (A/H3N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI346419 A/Iowa/09/2011 (A/H3N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI341736 A/swine/Iowa/A01049970/2011 (A/H1N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI394067 A/Pennsylvania/11/2012 (A/H3N2) segment 7 (MP) 1801.6 0.000000e+00 979/981 (99%)
EPI394917 A/Ohio/69/2012 (A/H3N2) segment 7 (MP) 1799.8 0.000000e+00 979/982 (99%)
EPI398039 A/West Virginia/09/2012 (A/H3N2) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI398038 A/Ohio/38/2012 (A/H3N2) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI397940 A/Ohio/81/2012 (A/H3N2) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI397921 A/Ohio/18/2012 (A/H3N2) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI397754 A/Wisconsin/35/2012 (A/H3N2) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI397746 A/Ohio/87/2012 (A/H3N2) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI397558 A/Wisconsin/29/2012 (A/H3N2) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI397543 A/Ohio/83/2012 (A/H3N2) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI397527 A/Ohio/47/2012 (A/H3N2) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI397519 A/Ohio/44/2012 (A/H3N2) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI397499 A/Indiana/104/2012 (A/H3N2) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI397414 A/Michigan/23/2012 (A/H3N2) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI397407 A/Michigan/16/2012 (A/H3N2) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI397399 A/Indiana/99/2012 (A/H3N2) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI397391 A/Indiana/93/2012 (A/H3N2) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI397380 A/Indiana/138/2012 (A/H3N2) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI397373 A/Indiana/123/2012 (A/H3N2) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI397342 A/Michigan/19/2012 (A/H3N2) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI397218 A/Indiana/144/2012 (A/H3N2) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI397087 A/Indiana/52/2012 (A/H3N2) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI396287 A/Ohio/57/2012 (A/H3N2) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI396282 A/Ohio/43/2012 (A/H3N2) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI396273 A/Indiana/135/2012 (A/H3N2) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI396257 A/Indiana/127/2012 (A/H3N2) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI396249 A/Indiana/126/2012 (A/H3N2) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI396236 A/Indiana/103/2012 (A/H3N2) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI396216 A/Indiana/150/2012 (A/H3N2) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI396178 A/Indiana/77/2012 (A/H3N2) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI395346 A/Michigan/20/2012 (A/H3N2) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI395262 A/Ohio/65/2012 (A/H3N2) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI395246 A/Indiana/152/2012 (A/H3N2) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI394935 A/Ohio/75/2012 (A/H3N2) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI394072 A/Wisconsin/27/2012 (A/H3N2) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI394064 A/Indiana/60/2012 (A/H3N2) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI394061 A/Indiana/21/2012 (A/H3N2) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI394058 A/Indiana/38/2012 (A/H3N2) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI393691 A/West Virginia/16/2012 (A/H3N2) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI393677 A/West Virginia/10/2012 (A/H3N2) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI393658 A/Ohio/62/2012 (A/H3N2) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI393514 A/Indiana/65/2012 (A/H3N2) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI393506 A/Ohio/52/2012 (A/H3N2) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI393302 A/Indiana/18/2012 (A/H3N2) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI392697 A/Indiana/46/2012 (A/H3N2) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI392694 A/Indiana/43/2012 (A/H3N2) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI392692 A/Indiana/38/2012 (A/H3N2) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI392680 A/Ohio/18/2012 (A/H3N2) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI392679 A/Ohio/17/2012 (A/H3N2) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI392676 A/Ohio/13/2012 (A/H3N2) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI391144 A/swine/Indiana/A01202621/2011 (A/H3N2) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI391142 A/swine/Indiana/A01202632/2011 (A/H1N2) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI390882 A/swine/Michigan/A01203374/2012 (A/H1N1) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI390881 A/swine/Indiana/A01203372/2012 (A/H3N2) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI390671 A/swine/Indiana/A01243255/2012 (A/H1N1) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI388364 A/Ohio/17/2012 (A/H3N2) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI388359 A/Indiana/16/2012 (A/H3N2) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI388355 A/Indiana/21/2012 (A/H3N2) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI388349 A/Indiana/20/2012 (A/H3N2) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI388342 A/Indiana/15/2012 (A/H3N2) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI388335 A/Ohio/16/2012 (A/H3N2) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI388330 A/Utah/10/2012 (A/H3N2) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI388328 A/Ohio/20/2012 (A/H3N2) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI388315 A/Ohio/20/2012 (A/H3N2) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI383550 A/swine/Indiana/A01203509/2012 (A/H3N2) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI378518 A/Indiana/09/2012 (A/H3N2) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI378510 A/Indiana/07/2012 (A/H3N2) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI347605 A/Iowa/08/2011 (A/H3N2) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI396290 A/Ohio/63/2012 (A/H3N2) segment 7 (MP) 1794.2 0.000000e+00 978/982 (99%)
EPI392703 A/Indiana/52/2012 (A/H3N2) segment 7 (MP) 1794.2 0.000000e+00 977/980 (99%)
EPI388308 A/Ohio/15/2012 (A/H3N2) segment 7 (MP) 1794.2 0.000000e+00 977/980 (99%)
EPI397928 A/Ohio/19/2012 (A/H3N2) segment 7 (MP) 1792.4 0.000000e+00 978/982 (99%)

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Thu Nov 15, 2012 9:10 am 
Online

Joined: Wed Aug 19, 2009 10:42 am
Posts: 40603
Location: Pittsburgh, PA USA
Thread on first Nortn Carolina swine match with 2012 cases

viewtopic.php?f=5&t=8128

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Thu Nov 15, 2012 9:11 am 
Online

Joined: Wed Aug 19, 2009 10:42 am
Posts: 40603
Location: Pittsburgh, PA USA
Thread on second North Carolina match with 2012 cases

viewtopic.php?f=5&t=8618

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Sat Nov 17, 2012 12:49 pm 
Online

Joined: Wed Aug 19, 2009 10:42 am
Posts: 40603
Location: Pittsburgh, PA USA
JX975021.1 Influenza A virus (A/swine/North Carolina/A01203801/2012(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 2544 2544 100% 0.0 100%
JX163279.1 Influenza A virus (A/swine/Indiana/A01203509/2012(H3N2)) segment 6 neuraminidase (NA) gene, complete cds >gb|JX565499.1| Influenza A virus (A/swine/Ohio/12TOSU447/2012(H3N2)) segment 6 neuraminidase (NA) gene, complete cds >gb|JX565491.1| Influenza A virus (A/swine/Ohio/12TOSU450/2012(H3N2)) segment 6 neuraminidase (NA) gene, complete cds >gb|JX952145.1| Influenza A virus (A/swine/North Carolina/A01270394/2012(H3N2)) segment 6 neuraminidase (NA) gene, complete cds >gb|JX964980.1| Influenza A virus (A/swine/Ohio/A00152576/2012(H3N2)) neuraminidase (NA) gene, complete cds >gb|JX964972.1| Influenza A virus (A/swine/Ohio/A01208457/2012(H3N2)) neuraminidase (NA) gene, complete cds 2538 2538 100% 0.0 99%
JX565475.1 Influenza A virus (A/swine/Ohio/12TOSU467/2012(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 2535 2535 100% 0.0 99%
JX565483.1 Influenza A virus (A/swine/Ohio/12TOSU464/2012(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 2535 2535 100% 0.0 99%
JX565507.1 Influenza A virus (A/swine/Ohio/12TOSU307/2012(H3N2)) segment 6 neuraminidase (NA) gene, complete cds >gb|JX869493.1| Influenza A virus (A/swine/Indiana/A00968390/2012(H3N2)) segment 6 neuraminidase (NA) gene, complete cds >gb|JX869502.1| Influenza A virus (A/swine/Indiana/A00968308/2012(H3N2)) segment 6 neuraminidase (NA) gene, complete cds >gb|JX964956.1| Influenza A virus (A/swine/Ohio/A01133464/2012(H3N2)) neuraminidase (NA) gene, complete cds >gb|JX964948.1| Influenza A virus (A/swine/Ohio/A01133466/2012(H3N2)) neuraminidase (NA) gene, complete cds >gb|JX964940.1| Influenza A virus (A/swine/Maryland/A01104048/2012(H3N2)) neuraminidase (NA) gene, complete cds >gb|JX964932.1| Influenza A virus (A/swine/Maryland/A01104040/2012(H3N2)) neuraminidase (NA) gene, complete cds 2535 2535 100% 0.0 99%
JX534976.1 Influenza A virus (A/swine/Indiana/A00968370/2012(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 2535 2535 100% 0.0 99%
JX534992.1 Influenza A virus (A/swine/Indiana/A00968376/2012(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 2535 2535 100% 0.0 99%
JX535000.1 Influenza A virus (A/swine/Indiana/A00968379/2012(H3N2)) segment 6 neuraminidase (NA) gene, complete cds >gb|JX534963.1| Influenza A virus (A/swine/Ohio/12TOSU268/2012(H3N2)) segment 6 neuraminidase (NA) gene, complete cds >gb|JX549147.1| Influenza A virus (A/swine/Indiana/A00968386/2012(H3N2)) segment 6 neuraminidase (NA) gene, complete cds >gb|JX869499.1| Influenza A virus (A/swine/Indiana/A00968397/2012(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 2535 2535 100% 0.0 99%
JX905418.1 Influenza A virus (A/Utah/10/2012(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 2529 2529 100% 0.0 99%
JX565515.1 Influenza A virus (A/swine/Ohio/12TOSU420/2012(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 2529 2529 100% 0.0 99%
JX534971.1 Influenza A virus (A/swine/Ohio/12TOSU293/2012(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 2529 2529 100% 0.0 99%
JX534984.1 Influenza A virus (A/swine/Indiana/A00968373/2012(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 2529 2529 100% 0.0 99%
JX092607.1 Influenza A virus (A/swine/North Carolina/A01203272/2012(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 2529 2529 100% 0.0 99%
JX549139.1 Influenza A virus (A/swine/Indiana/A01104030/2012(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 2526 2526 100% 0.0 99%
JX494413.1 Influenza A virus (A/swine/Indiana/A00968380/2012(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 2526 2526 100% 0.0 99%
JX163280.1 Influenza A virus (A/swine/Minnesota/A01203517/2012(H3N2)) segment 6 neuraminidase (NA) gene, complete cds >gb|JX422520.1| Influenza A virus (A/swine/Minnesota/A01327922/2012(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 2526 2526 100% 0.0 99%
JX549117.1 Influenza A virus (A/swine/Indiana/A01104016/2012(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 2522 2522 100% 0.0 99%
JX964964.1 Influenza A virus (A/swine/Wisconsin/A00677500/2012(H3N2)) neuraminidase (NA) gene, complete cds 2520 2520 100% 0.0 99%
JX422373.1 Influenza A virus (A/swine/Minnesota/A01327921/2012(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 2520 2520 100% 0.0 99%
JQ290163.1 Influenza A virus (A/West Virginia/06/2011(H3N2)) segment 6 neuraminidase (NA) gene, partial cds 2518 2518 99% 0.0 99%
JX092606.1 Influenza A virus (A/swine/Iowa/A01203248/2012(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 2507 2507 100% 0.0 99%
JX080561.1 Influenza A virus (A/swine/Iowa/A01203304/2012(H3N2)) segment 6 neuraminidase (NA) gene, complete cds >gb|JX092589.1| Influenza A virus (A/swine/Iowa/A01203104/2011(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 2493 2493 100% 0.0 99%
JX656972.1 Influenza A virus (A/swine/Minnesota/A01300160/2012(H3N2)) segment 6 cRNA sequence 2489 2489 100% 0.0 99%
JX163275.1 Influenza A virus (A/swine/Iowa/A01203492/2012(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 2489 2489 100% 0.0 99%
JX657002.1 Influenza A virus (A/swine/Iowa/A01300194/2012(H3N2)) segment 6 cRNA sequence 2484 2484 100% 0.0 99%
JX080583.1 Influenza A virus (A/swine/Iowa/A01203459/2012(H3N2)) segment 6 neuraminidase (NA) gene, complete cds >gb|JX080587.1| Influenza A virus (A/swine/Iowa/A01243311/2012(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 2484 2484 100% 0.0 99%
JX657017.1 Influenza A virus (A/swine/Iowa/A01300195/2012(H3N2)) segment 6 cRNA sequence 2480 2480 100% 0.0 99%
JX080584.1 Influenza A virus (A/swine/Iowa/A01203463/2012(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 2480 2480 100% 0.0 99%
JX905416.1 Influenza A virus (A/Utah/10/2012(H3N2)) segment 6 neuraminidase (NA) gene, partial cds 2468 2468 97% 0.0 99%
JX908498.1 Influenza A virus (A/swine/Minnesota/A01301665/2012(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 2464 2464 100% 0.0 99%
JX163273.1 Influenza A virus (A/swine/Iowa/A01203482/2012(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 2464 2464 100% 0.0 99%
JX177668.1 Influenza A virus (A/swine/Minnesota/A01203412/2012(mixed)) clone N2 segment 6 neuraminidase (NA) gene, complete cds 2462 2462 100% 0.0 99%
JX422409.1 Influenza A virus (A/swine/Minnesota/A01328452/2012(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 2448 2448 100% 0.0 99%
JX422577.1 Influenza A virus (A/swine/Minnesota/A01328451/2012(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 2444 2444 100% 0.0 98%
JX422430.1 Influenza A virus (A/swine/Minnesota/A01125992/2012(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 2444 2444 100% 0.0 98%
JX422256.1 Influenza A virus (A/swine/Minnesota/A01125993/2012(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 2444 2444 100% 0.0 98%
JN162016.1 Influenza A virus (A/swine/Minnesota/A01049346/2010(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 2430 2430 100% 0.0 98%
JX657029.1 Influenza A virus (A/swine/Minnesota/A01300213/2012(H3N2)) segment 6 cRNA sequence 2421 2421 100% 0.0 98%
JN162015.1 Influenza A virus (A/swine/Iowa/A01049317/2010(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 2417 2417 100% 0.0 98%
JN652544.1 Influenza A virus (A/swine/Minnesota/A01049936/2011(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 2403 2403 100% 0.0 98%
JX657014.1 Influenza A virus (A/swine/Minnesota/A01300992/2012(H3N2)) segment 6 cRNA sequence 2399 2399 100% 0.0 98%
HQ825184.1 Influenza A virus (A/swine/QC/414/2009(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 2394 2394 100% 0.0 98%
JQ783097.1 Influenza A virus (A/swine/Minnesota/A01116200/2011(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 2390 2390 100% 0.0 98%
JQ783096.1 Influenza A virus (A/swine/Minnesota/A01116195/2011(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 2390 2390 100% 0.0 98%
JX122440.1 Influenza A virus (A/swine/Minnesota/A01076193/2010(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 2381 2381 100% 0.0 97%
CY107030.1 Influenza A virus (A/swine/Minnesota/A01076196/2010(H3N2)) neuraminidase (NA) gene, complete cds 2372 2372 100% 0.0 97%
JX092581.1 Influenza A virus (A/swine/Iowa/A01202905/2011(H3N2)) segment 6 neuraminidase (NA) gene, complete cds >gb|JX092582.1| Influenza A virus (A/swine/Iowa/A01202906/2011(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 2367 2367 100% 0.0 97%
CY114593.1 Influenza A virus (A/swine/Minnesota/A01201424/2010(H3N2)) neuraminidase (NA) gene, partial cds 2349 2349 99% 0.0 97%
JF812297.1 Influenza A virus (A/swine/Iowa/A01049031/2010(H3N2)) segment 6 neuraminidase (NA) gene, complete cds >gb|JQ689126.1| Influenza A virus (A/swine/Iowa/A01049033/2010(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 2349 2349 100% 0.0 97%
JF812298.1 Influenza A virus (A/swine/Iowa/A01049032/2010(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 2349 2349 100% 0.0 97%
DQ469976.1 Influenza A virus (A/swine/British Columbia/28103/2005(H3N2)) neuraminidase (NA) gene, complete cds 2347 2347 99% 0.0 97%
CY099249.1 Influenza A virus (A/swine/Minnesota/00484/2005(H3N2)) neuraminidase (NA) gene, complete cds 2345 2345 100% 0.0 97%
CY099145.1 Influenza A virus (A/swine/Minnesota/00611/2005(H3N2)) neuraminidase (NA) gene, complete cds 2345 2345 100% 0.0 97%
CY099088.1 Influenza A virus (A/swine/Nebraska/00722/2005(mixed)) neuraminidase (NA) gene, complete cds 2345 2345 100% 0.0 97%
EU826544.2 Influenza A virus (A/swine/Quebec/4001/2005(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 2340 2340 100% 0.0 97%
JX565428.1 Influenza A virus (A/swine/Minnesota/16/2012(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 2336 2336 100% 0.0 97%
HQ825168.1 Influenza A virus (A/turkey/BC/1529-3/2005(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 2336 2336 100% 0.0 97%
DQ469992.1 Influenza A virus (A/swine/Ontario/33853/2005(H3N2)) neuraminidase (NA) gene, complete cds 2336 2336 100% 0.0 97%
DQ469960.1 Influenza A virus (A/Ontario/RV1273/2005(H3N2)) neuraminidase (NA) gene, complete cds 2336 2336 100% 0.0 97%
CY099037.1 Influenza A virus (A/swine/Minnesota/01146/2006(H3N2)) neuraminidase (NA) gene, complete cds 2331 2331 100% 0.0 97%
DQ470000.1 Influenza A virus (A/turkey/Ontario/31232/2005(H3N2)) neuraminidase (NA) gene, complete cds 2329 2329 99% 0.0 97%
EU735820.2 Influenza A virus (A/turkey/Ohio/313053/2004(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 2327 2327 100% 0.0 97%
DQ335773.1 Influenza A virus (A/turkey/Ohio/313053/04(H3N2)) neuraminidase (NA) gene, complete cds 2327 2327 100% 0.0 97%
EU735828.2 Influenza A virus (A/turkey/North Carolina/353568/2005(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 2313 2313 100% 0.0 96%
EF551055.1 Influenza A virus (A/swine/North Carolina/2003(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 2313 2313 100% 0.0 96%
EF551047.1 Influenza A virus (A/turkey/Illinois/2004(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 2313 2313 100% 0.0 96%
DQ469984.1 Influenza A virus (A/swine/Manitoba/12707/2005(H3N2)) neuraminidase (NA) gene, complete cds 2309 2309 100% 0.0 96%
CY107037.1 Influenza A virus (A/swine/North Carolina/A01076199/2010(H3N2)) neuraminidase (NA) gene, complete cds 2304 2304 100% 0.0 96%
CY099054.1 Influenza A virus (A/swine/Illinois/02450/2008(mixed)) neuraminidase (NA) gene, complete cds 2304 2304 100% 0.0 96%
DQ469968.1 Influenza A virus (A/swine/Alberta/14722/2005(H3N2)) neuraminidase (NA) gene, complete cds 2304 2304 100% 0.0 96%
EU697211.2 Influenza A virus (A/turkey/North Carolina/353568/2005(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 2300 2300 100% 0.0 96%
CY099029.1 Influenza A virus (A/swine/Iowa/01700/2007(H3N2)) neuraminidase (NA) gene, complete cds 2300 2300 100% 0.0 96%
FJ519961.1 Influenza A virus (A/swine/Minnesota/66853/2006(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 2300 2300 100% 0.0 96%
CY107180.1 Influenza A virus (A/England/584/2003(H3N2)) neuraminidase (NA) gene, complete cds 2291 2291 100% 0.0 96%
CY088440.1 Influenza A virus (A/England/584/2003(H3N2)) neuraminidase (NA) gene, complete cds 2291 2291 100% 0.0 96%
CY099063.1 Influenza A virus (A/swine/Minnesota/00709/2005(H3N2)) neuraminidase (NA) gene, complete cds 2291 2291 100% 0.0 96%
JF833346.1 Influenza A virus (A/swine/Iowa/A01049113/2010(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 2291 2291 100% 0.0 96%
FJ519965.1 Influenza A virus (A/swine/Minnesota/1300/2007(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 2291 2291 100% 0.0 96%
FJ410142.1 Influenza A virus (A/swine/Minnesota/1145/2007(H3N2)) segment 6, complete sequence 2291 2291 100% 0.0 96%
EU743212.1 Influenza A virus (A/turkey/MN/366767/2005(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 2291 2291 100% 0.0 96%
CY013447.1 Influenza A virus (A/Dunedin/38/2003(H3N2)) segment 6, complete sequence 2291 2291 100% 0.0 96%
CY001223.1 Influenza A virus (A/New York/65/2003(H3N2)) segment 6, complete sequence 2291 2291 100% 0.0 96%
CY001114.1 Influenza A virus (A/New York/27/2003(H3N2)) segment 6, complete sequence 2291 2291 100% 0.0 96%
CY001098.1 Influenza A virus (A/New York/39/2003(H3N2)) segment 6, complete sequence 2291 2291 100% 0.0 96%
CY007829.1 Influenza A virus (A/Canterbury/429/2003(H3N2)) segment 6, complete sequence 2291 2291 100% 0.0 96%
CY007261.1 Influenza A virus (A/Canterbury/443/2003(H3N2)) segment 6, complete sequence 2291 2291 100% 0.0 96%
CY007237.1 Influenza A virus (A/Canterbury/440/2003(H3N2)) segment 6, complete sequence 2291 2291 100% 0.0 96%
CY007173.1 Influenza A virus (A/Canterbury/431/2003(H3N2)) segment 6, complete sequence 2291 2291 100% 0.0 96%
CY006941.1 Influenza A virus (A/Canterbury/386/2003(H3N2)) segment 6, complete sequence 2291 2291 100% 0.0 96%
CY000523.1 Influenza A virus (A/New York/29/2003(H3N2)) segment 6, complete sequence 2291 2291 100% 0.0 96%
CY000379.1 Influenza A virus (A/New York/49/2003(H3N2)) segment 6, complete sequence 2291 2291 100% 0.0 96%
CY000267.1 Influenza A virus (A/New York/53/2003(H3N2)) segment 6, complete sequence 2291 2291 100% 0.0 96%
CY000179.1 Influenza A virus (A/New York/44/2003(H3N2)) segment 6, complete sequence 2291 2291 100% 0.0 96%
CY000043.1 Influenza A virus (A/New York/34/2003(H3N2)) segment 6, complete sequence 2291 2291 100% 0.0 96%
EU100572.1 Influenza A virus (A/New Mexico/17/2003(N2)) segment 6 neuraminidase (NA) gene, complete cds 2287 2287 99% 0.0 96%
CY118676.1 Influenza A virus (A/Malaysia/25920/2003(H3N2)) neuraminidase (NA) gene, complete cds 2286 2286 100% 0.0 96%
CY088328.1 Influenza A virus (A/England/508/2003(H3N2)) neuraminidase (NA) gene, complete cds 2286 2286 100% 0.0 96%
EU697206.2 Influenza A virus (A/turkey/Minnesota/366767/2005(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 2286 2286 100% 0.0 96%
CY091463.1 Influenza A virus (A/California/NHRC0006/2003(H3N2)) neuraminidase (NA) gene, complete cds 2286 2286 100% 0.0 96%
CY091303.1 Influenza A virus (A/Australia/NHRC0002/2003(H3N2)) neuraminidase (NA) gene, complete cds 2286 2286 100% 0.0 96%

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Sat Nov 17, 2012 12:52 pm 
Online

Joined: Wed Aug 19, 2009 10:42 am
Posts: 40603
Location: Pittsburgh, PA USA
JX975022.1 Influenza A virus (A/swine/North Carolina/A01203801/2012(H3N2)) segment 4 hemagglutinin (HA) gene, complete cds 3142 3142 100% 0.0 100%
JX092570.1 Influenza A virus (A/swine/North Carolina/A01203272/2012(H3N2)) segment 4 hemagglutinin (HA) gene, complete cds >gb|JX952146.1| Influenza A virus (A/swine/North Carolina/A01270394/2012(H3N2)) segment 4 hemagglutinin (HA) gene, complete cds 3109 3109 100% 0.0 99%
JX565505.1 Influenza A virus (A/swine/Ohio/12TOSU307/2012(H3N2)) segment 4 hemagglutinin (HA) gene, complete cds 3097 3097 100% 0.0 99%
JX534974.1 Influenza A virus (A/swine/Indiana/A00968370/2012(H3N2)) segment 4 hemagglutinin (HA) gene, complete cds 3097 3097 100% 0.0 99%
JX534982.1 Influenza A virus (A/swine/Indiana/A00968373/2012(H3N2)) segment 4 hemagglutinin (HA) gene, complete cds 3097 3097 100% 0.0 99%
JX534990.1 Influenza A virus (A/swine/Indiana/A00968376/2012(H3N2)) segment 4 hemagglutinin (HA) gene, complete cds 3097 3097 100% 0.0 99%
JX534998.1 Influenza A virus (A/swine/Indiana/A00968379/2012(H3N2)) segment 4 hemagglutinin (HA) gene, complete cds >gb|JX549145.1| Influenza A virus (A/swine/Indiana/A00968386/2012(H3N2)) segment 4 hemagglutinin (HA) gene, complete cds 3097 3097 100% 0.0 99%
JX163268.1 Influenza A virus (A/swine/Indiana/A01203509/2012(H3N2)) segment 4 hemagglutinin (HA) gene, complete cds 3097 3097 100% 0.0 99%
JX092561.1 Influenza A virus (A/swine/Ohio/A01203186/2012(H3N2)) segment 4 hemagglutinin (HA) gene, complete cds >gb|JX905414.1| Influenza A virus (A/Utah/10/2012(H3N2)) segment 4 hemagglutinin (HA) gene, complete cds 3097 3097 100% 0.0 99%
JQ290164.1 Influenza A virus (A/West Virginia/06/2011(H3N2)) segment 4 hemagglutinin (HA) gene, complete cds 3097 3097 100% 0.0 99%
JX964938.1 Influenza A virus (A/swine/Maryland/A01104048/2012(H3N2)) hemagglutinin (HA) gene, complete cds 3094 3094 100% 0.0 99%
JX964930.1 Influenza A virus (A/swine/Maryland/A01104040/2012(H3N2)) hemagglutinin (HA) gene, complete cds 3092 3092 100% 0.0 99%
JX964946.1 Influenza A virus (A/swine/Ohio/A01133466/2012(H3N2)) hemagglutinin (HA) gene, complete cds 3092 3092 100% 0.0 99%
JX964954.1 Influenza A virus (A/swine/Ohio/A01133464/2012(H3N2)) hemagglutinin (HA) gene, complete cds 3092 3092 100% 0.0 99%
JX905419.1 Influenza A virus (A/Utah/10/2012(H3N2)) segment 4 hemagglutinin (HA) gene, complete cds 3092 3092 100% 0.0 99%
JX869501.1 Influenza A virus (A/swine/Indiana/A00968308/2012(H3N2)) segment 4 hemagglutinin (HA) gene, complete cds 3092 3092 100% 0.0 99%
JX869498.1 Influenza A virus (A/swine/Indiana/A00968397/2012(H3N2)) segment 4 hemagglutinin (HA) gene, complete cds 3092 3092 100% 0.0 99%
JX565489.1 Influenza A virus (A/swine/Ohio/12TOSU450/2012(H3N2)) segment 4 hemagglutinin (HA) gene, complete cds 3092 3092 100% 0.0 99%
JX565497.1 Influenza A virus (A/swine/Ohio/12TOSU447/2012(H3N2)) segment 4 hemagglutinin (HA) gene, complete cds >gb|JX964978.1| Influenza A virus (A/swine/Ohio/A00152576/2012(H3N2)) hemagglutinin (HA) gene, complete cds >gb|JX964970.1| Influenza A virus (A/swine/Ohio/A01208457/2012(H3N2)) hemagglutinin (HA) gene, complete cds >gb|JX964962.1| Influenza A virus (A/swine/Wisconsin/A00677500/2012(H3N2)) hemagglutinin (HA) gene, complete cds 3092 3092 100% 0.0 99%
JX549115.1 Influenza A virus (A/swine/Indiana/A01104016/2012(H3N2)) segment 4 hemagglutinin (HA) gene, complete cds 3092 3092 100% 0.0 99%
JX549123.1 Influenza A virus (A/swine/Indiana/A01104023/2012(H3N2)) segment 4 hemagglutinin (HA) gene, complete cds 3092 3092 100% 0.0 99%
JX494412.1 Influenza A virus (A/swine/Indiana/A00968380/2012(H3N2)) segment 4 hemagglutinin (HA) gene, complete cds 3092 3092 100% 0.0 99%
JN940422.1 Influenza A virus (A/swine/NY/A01104005/2011(H3N2)) segment 4 hemagglutinin (HA) gene, complete cds 3092 3092 100% 0.0 99%
JX869492.1 Influenza A virus (A/swine/Indiana/A00968390/2012(H3N2)) segment 4 hemagglutinin (HA) gene, complete cds 3086 3086 100% 0.0 99%
JN866186.1 Influenza A virus (A/Maine/06/2011(H3N2)) segment 4 hemagglutinin (HA) gene, complete cds 3086 3086 100% 0.0 99%
JX565432.1 Influenza A virus (A/mink/Wisconsin/31512-7/2012(H3N2)) segment 4 hemagglutinin (HA) gene, complete cds 3081 3081 100% 0.0 99%
JX565473.1 Influenza A virus (A/swine/Ohio/12TOSU467/2012(H3N2)) segment 4 hemagglutinin (HA) gene, complete cds 3081 3081 100% 0.0 99%
JX565481.1 Influenza A virus (A/swine/Ohio/12TOSU464/2012(H3N2)) segment 4 hemagglutinin (HA) gene, complete cds 3081 3081 100% 0.0 99%
JX565513.1 Influenza A virus (A/swine/Ohio/12TOSU420/2012(H3N2)) segment 4 hemagglutinin (HA) gene, complete cds 3081 3081 100% 0.0 99%
JX549130.1 Influenza A virus (A/swine/Indiana/A01104029/2012(H3N2)) segment 4 hemagglutinin (HA) gene, complete cds 3081 3081 100% 0.0 99%
JX549137.1 Influenza A virus (A/swine/Indiana/A01104030/2012(H3N2)) segment 4 hemagglutinin (HA) gene, complete cds 3081 3081 100% 0.0 99%
JX534961.1 Influenza A virus (A/swine/Ohio/12TOSU268/2012(H3N2)) segment 4 hemagglutinin (HA) gene, complete cds 3081 3081 100% 0.0 99%
JX534969.1 Influenza A virus (A/swine/Ohio/12TOSU293/2012(H3N2)) segment 4 hemagglutinin (HA) gene, complete cds 3081 3081 100% 0.0 99%
JQ738147.1 Influenza A virus (A/swine/Illinois/A00857300/2011(H3N2)) segment 4 hemagglutinin (HA) gene, complete cds 3081 3081 100% 0.0 99%
JQ738155.1 Influenza A virus (A/swine/Illinois/A00857138a/2011(H3N2)) segment 4 hemagglutinin (HA) gene, complete cds 3081 3081 100% 0.0 99%
JQ738163.1 Influenza A virus (A/swine/Illinois/A00857138b/2011(H3N2)) segment 4 hemagglutinin (HA) gene, complete cds >gb|JX092297.1| Influenza A virus (A/swine/Iowa/A01202529/2011(H3N2)) segment 4 hemagglutinin (HA) gene, complete cds >gb|JX092298.1| Influenza A virus (A/swine/Iowa/A01202530/2011(H3N2)) segment 4 hemagglutinin (HA) gene, complete cds >gb|JX092300.1| Influenza A virus (A/swine/Iowa/A01202573/2011(H3N2)) segment 4 hemagglutinin (HA) gene, complete cds 3081 3081 100% 0.0 99%
JQ738171.1 Influenza A virus (A/swine/Illinois/A00857304a/2012(H3N2)) segment 4 hemagglutinin (HA) gene, complete cds 3081 3081 100% 0.0 99%
JQ738179.1 Influenza A virus (A/swine/Illinois/A00857304b/2012(H3N2)) segment 4 hemagglutinin (HA) gene, complete cds 3081 3081 100% 0.0 99%
JQ070776.1 Influenza A virus (A/Iowa/09/2011(H3N2)) segment 4 hemagglutinin (HA) gene, complete cds >gb|JQ290172.1| Influenza A virus (A/Iowa/08/2011(H3N2)) segment 4 hemagglutinin (HA) gene, complete cds >gb|JQ290180.1| Influenza A virus (A/Iowa/07/2011(H3N2)) segment 4 hemagglutinin (HA) gene, complete cds >gb|JQ290188.1| Influenza A virus (A/Iowa/09/2011(H3N2)) segment 4 hemagglutinin (HA) gene, complete cds 3081 3081 100% 0.0 99%
JF812289.1 Influenza A virus (A/swine/Indiana/A01049091/2010(H3N2)) segment 4 hemagglutinin (HA) gene, complete cds 3081 3081 100% 0.0 99%
JQ070768.1 Influenza A virus (A/Iowa/08/2011(H3N2)) segment 4 hemagglutinin (HA) gene, complete cds 3077 3077 100% 0.0 99%
JX092537.1 Influenza A virus (A/swine/Iowa/A01202878/2011(H3N2)) segment 4 hemagglutinin (HA) gene, complete cds >gb|JX092538.1| Influenza A virus (A/swine/Iowa/A01202879/2011(H3N2)) segment 4 hemagglutinin (HA) gene, complete cds 3075 3075 100% 0.0 99%
JQ350522.1 Influenza A virus (A/swine/Iowa/A01202640/2011(H3N2)) segment 4 hemagglutinin (HA) gene, complete cds 3075 3075 100% 0.0 99%
JQ350530.1 Influenza A virus (A/swine/Iowa/A01202659/2011(H3N2)) segment 4 hemagglutinin (HA) gene, complete cds 3075 3075 100% 0.0 99%
JX092316.1 Influenza A virus (A/swine/Iowa/A01202639/2011(H3N2)) segment 4 hemagglutinin (HA) gene, complete cds 3072 3072 100% 0.0 99%
JN992750.1 Influenza A virus (A/Indiana/10/2011(H3N2)) segment 4 hemagglutinin (HA) gene, complete cds >gb|JQ070784.1| Influenza A virus (A/Indiana/10/2011(H3N2)) segment 4 hemagglutinin (HA) gene, complete cds 3070 3070 100% 0.0 99%
JN162059.1 Influenza A virus (A/swine/North Carolina/A01049436/2011(H3N2)) segment 4 hemagglutinin (HA) gene, complete cds 3070 3070 100% 0.0 99%
JX422335.1 Influenza A virus (A/swine/Illinois/A01240891/2012(H3N2)) segment 4 hemagglutinin (HA) gene, complete cds >gb|JX422359.1| Influenza A virus (A/swine/Illinois/A01240835/2012(H3N2)) segment 4 hemagglutinin (HA) gene, complete cds 3066 3066 99% 0.0 99%
JX422566.1 Influenza A virus (A/swine/Illinois/A01240836/2012(H3N2)) segment 4 hemagglutinin (HA) gene, complete cds 3066 3066 99% 0.0 99%
JX280450.1 Influenza A virus (A/swine/Texas/A01104013/2012(H3N2)) segment 4 hemagglutinin (HA) gene, complete cds 3064 3064 100% 0.0 99%
JX099413.1 Influenza A virus (A/swine/Illinois/A00857318a/2012(H3N2)) segment 4 hemagglutinin (HA) gene, complete cds 3064 3064 100% 0.0 99%
JQ791012.1 Influenza A virus (A/swine/Minnesota/A01076999/2010(H3N2)) segment 4 hemagglutinin (HA) gene, complete cds 3064 3064 100% 0.0 99%
JQ070792.1 Influenza A virus (A/Indiana/10/2011(H3N2)) segment 4 hemagglutinin (HA) gene, complete cds 3064 3064 100% 0.0 99%
JX422416.1 Influenza A virus (A/swine/Indiana/A01327213/2012(H3N2)) segment 4 hemagglutinin (HA) gene, complete cds 3061 3061 99% 0.0 99%
JX422341.1 Influenza A virus (A/swine/Indiana/A01327215/2012(H3N2)) segment 4 hemagglutinin (HA) gene, complete cds >gb|JX422554.1| Influenza A virus (A/swine/Illinois/A01241840/2012(H3N2)) segment 4 hemagglutinin (HA) gene, complete cds 3061 3061 99% 0.0 99%
JX092549.1 Influenza A virus (A/swine/Illinois/A01202978/2011(H3N2)) segment 4 hemagglutinin (HA) gene, complete cds 3061 3061 99% 0.0 99%
JN652492.1 Influenza A virus (A/swine/Indiana/A01049745/2011(H3N2)) segment 4 hemagglutinin (HA) gene, complete cds 3061 3061 100% 0.0 99%
CY124833.1 Influenza A virus (A/swine/Ohio/7/2012(H3N2)) hemagglutinin (HA) gene, complete cds 3059 3059 100% 0.0 99%
CY124830.1 Influenza A virus (A/swine/Ohio/9/2012(H3N2)) hemagglutinin (HA) gene, complete cds 3059 3059 100% 0.0 99%
JX092311.1 Influenza A virus (A/swine/Indiana/A01202621/2011(H3N2)) segment 4 hemagglutinin (HA) gene, complete cds 3059 3059 100% 0.0 99%
JX080538.1 Influenza A virus (A/swine/Indiana/A01203372/2012(H3N2)) segment 4 hemagglutinin (HA) gene, complete cds 3059 3059 100% 0.0 99%
CY121886.1 Influenza A virus (A/swine/Ohio/1/2012(H3N2)) hemagglutinin (HA) gene, complete cds 3059 3059 100% 0.0 99%
JQ689155.1 Influenza A virus (A/swine/Indiana/A00968322/2010(H3N2)) segment 4 hemagglutinin (HA) gene, complete cds 3059 3059 100% 0.0 99%
JN652491.1 Influenza A virus (A/swine/Indiana/A01049744/2011(H3N2)) segment 4 hemagglutinin (HA) gene, complete cds 3059 3059 100% 0.0 99%
JX422524.1 Influenza A virus (A/swine/Illinois/A01241842/2012(H3N2)) segment 4 hemagglutinin (HA) gene, complete cds 3055 3055 99% 0.0 99%
JX422497.1 Influenza A virus (A/swine/Illinois/A01241469/2012(H3N2)) segment 4 hemagglutinin (HA) gene, complete cds 3055 3055 99% 0.0 99%
JX543519.1 Influenza A virus (A/swine/Illinois/A01203672/2012(H3N2)) segment 4 hemagglutinin (HA) gene, complete cds 3053 3053 100% 0.0 99%
JQ756376.1 Influenza A virus (A/swine/Minnesota/A01134337/2010(H3N2)) segment 4 hemagglutinin (HA) gene, complete cds 3053 3053 100% 0.0 99%
JQ689165.1 Influenza A virus (A/swine/Illinois/A01076719/2010(H3N2)) segment 4 hemagglutinin (HA) gene, complete cds 3053 3053 100% 0.0 99%
JQ689153.1 Influenza A virus (A/swine/Indiana/A00968321/2010(H3N2)) segment 4 hemagglutinin (HA) gene, complete cds 3053 3053 100% 0.0 99%
JN652415.1 Influenza A virus (A/swine/Indiana/A01049653/2011(H3N2)) segment 4 hemagglutinin (HA) gene, complete cds 3053 3053 100% 0.0 99%
JX422248.1 Influenza A virus (A/swine/Illinois/A01241916/2012(H3N2)) segment 4 hemagglutinin (HA) gene, partial cds 3051 3051 99% 0.0 99%
JX422338.1 Influenza A virus (A/swine/Illinois/A01241871/2012(H3N2)) segment 4 hemagglutinin (HA) gene, partial cds 3049 3049 99% 0.0 99%
JX647377.1 Influenza A virus (A/swine/Iowa/A01243736/2012(H3N2)) segment 4 hemagglutinin (HA) gene, complete cds 3040 3040 99% 0.0 99%
JX422551.1 Influenza A virus (A/swine/Illinois/A01241876/2012(H3N2)) segment 4 hemagglutinin (HA) gene, partial cds 3040 3040 99% 0.0 99%
JX657039.1 Influenza A virus (A/swine/North Carolina/A01300820/2012(H3N2)) segment 4 cRNA sequence 3037 3037 100% 0.0 99%
JN638733.1 Influenza A virus (A/Indiana/08/2011(H3N2)) segment 4 hemagglutinin (HA) gene, complete cds >gb|JQ070800.1| Influenza A virus (A/Indiana/08/2011(H3N2)) segment 4 hemagglutinin (HA) gene, complete cds 3037 3037 100% 0.0 99%
JX422428.1 Influenza A virus (A/swine/Illinois/A01327905/2012(H3N2)) segment 4 hemagglutinin (HA) gene, complete cds 3033 3033 99% 0.0 99%
JX422413.1 Influenza A virus (A/swine/Illinois/A01327903/2012(H3N2)) segment 4 hemagglutinin (HA) gene, complete cds 3033 3033 99% 0.0 99%
JN655537.1 Influenza A virus (A/Pennsylvania/09/2011(H3N2)) segment 4 hemagglutinin (HA) gene, complete cds 3033 3033 100% 0.0 99%
JX163270.1 Influenza A virus (A/swine/Indiana/A01203521/2012(H3N2)) segment 4 hemagglutinin (HA) gene, complete cds >gb|JX163271.1| Influenza A virus (A/swine/Indiana/A01203522/2012(H3N2)) segment 4 hemagglutinin (HA) gene, complete cds 3031 3031 100% 0.0 99%
JX975010.1 Influenza A virus (A/swine/Illinois/A01203812/2012(H3N2)) segment 4 hemagglutinin (HA) gene, complete cds 3022 3022 99% 0.0 99%
JX444787.1 Influenza A virus (A/swine/Ohio/A01203624/2012(H3N2)) segment 4 hemagglutinin (HA) gene, complete cds 3020 3020 100% 0.0 99%
JX442056.1 Influenza A virus (A/swine/Michigan/A01259000/2012(H3N2)) segment 4 hemagglutinin (HA) gene, complete cds 3020 3020 100% 0.0 99%
JX163266.1 Influenza A virus (A/swine/Iowa/A01203503/2012(H3N2)) segment 4 hemagglutinin (HA) gene, complete cds 3000 3000 100% 0.0 98%
CY122327.1 Influenza A virus (A/swine/Ohio/6/2012(H3N2)) hemagglutinin (HA) gene, complete cds 2909 2909 100% 0.0 98%
FJ519977.1 Influenza A virus (A/swine/Minnesota/7931/2007(H3N2)) segment 4 hemagglutinin (HA) gene, complete cds 2881 2881 100% 0.0 97%
CY099143.1 Influenza A virus (A/swine/Minnesota/00611/2005(H3N2)) hemagglutinin (HA) gene, complete cds 2870 2870 100% 0.0 97%
HQ825166.1 Influenza A virus (A/turkey/BC/1529-3/2005(H3N2)) segment 4 hemagglutinin (HA) gene, complete cds 2854 2854 100% 0.0 97%
DQ469994.1 Influenza A virus (A/swine/Ontario/33853/2005(H3N2)) hemagglutinin (HA) gene, complete cds 2854 2854 100% 0.0 97%
DQ469962.1 Influenza A virus (A/Ontario/RV1273/2005(H3N2)) hemagglutinin (HA) gene, complete cds 2854 2854 100% 0.0 97%
EU735818.2 Influenza A virus (A/turkey/Ohio/313053/2004(H3N2)) segment 4 hemagglutinin (HA) gene, complete cds 2848 2848 100% 0.0 97%
DQ469986.1 Influenza A virus (A/swine/Manitoba/12707/2005(H3N2)) hemagglutinin (HA) gene, complete cds 2848 2848 100% 0.0 97%
DQ469970.1 Influenza A virus (A/swine/Alberta/14722/2005(H3N2)) hemagglutinin (HA) gene, complete cds 2848 2848 100% 0.0 97%
DQ335771.1 Influenza A virus (A/turkey/Ohio/313053/04(H3N2)) hemagglutinin (HA) gene, complete cds 2843 2843 100% 0.0 97%
EU743210.2 Influenza A virus (A/turkey/Minnesota/366767/2005(H3N2)) segment 4 hemagglutinin (HA) gene, complete cds 2832 2832 100% 0.0 97%
HQ315643.1 Influenza A virus (A/swine/Minnesota/1300/2007(H3N2)) segment 4 hemagglutinin (HA) gene, complete cds 2832 2832 100% 0.0 97%
CY099086.1 Influenza A virus (A/swine/Nebraska/00722/2005(mixed)) hemagglutinin (HA) gene, complete cds 2820 2820 100% 0.0 97%
EU697209.2 Influenza A virus (A/turkey/North Carolina/353568/2005(H3N2)) segment 4 hemagglutinin (HA) gene, complete cds 2815 2815 100% 0.0 97%
EU697204.2 Influenza A virus (A/turkey/Minnesota/366767/2005(H3N2)) segment 4 hemagglutinin (HA) gene, complete cds 2815 2815 100% 0.0 97%

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Sat Nov 17, 2012 12:54 pm 
Online

Joined: Wed Aug 19, 2009 10:42 am
Posts: 40603
Location: Pittsburgh, PA USA
JX975020.1 Influenza A virus (A/swine/North Carolina/A01203801/2012(H3N2)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1814 1814 100% 0.0 100%
JX092635.1 Influenza A virus (A/swine/Ohio/A01203186/2012(H3N2)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds >gb|JX092644.1| Influenza A virus (A/swine/North Carolina/A01203272/2012(H3N2)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds >gb|JX952147.1| Influenza A virus (A/swine/North Carolina/A01270266/2012(H1N2)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1808 1808 100% 0.0 99%
JX656944.1 Influenza A virus (A/swine/North Carolina/A01300819/2012(H1N2)) segment 7 cRNA sequence 1803 1803 100% 0.0 99%
JX565435.1 Influenza A virus (A/mink/Wisconsin/31512-7/2012(H3N2)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1803 1803 100% 0.0 99%
JX534972.1 Influenza A virus (A/swine/Ohio/12TOSU293/2012(H3N2)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds >gb|JX565500.1| Influenza A virus (A/swine/Ohio/12TOSU447/2012(H3N2)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds >gb|JX565492.1| Influenza A virus (A/swine/Ohio/12TOSU450/2012(H3N2)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds >gb|JX964981.1| Influenza A virus (A/swine/Ohio/A00152576/2012(H3N2)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds >gb|JX964973.1| Influenza A virus (A/swine/Ohio/A01208457/2012(H3N2)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1803 1803 100% 0.0 99%
JX494414.1 Influenza A virus (A/swine/Indiana/A00968380/2012(H3N2)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1803 1803 100% 0.0 99%
JN863560.1 Influenza A virus (A/swine/Iowa/A01049970/2011(H1N2)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds >gb|JQ290167.1| Influenza A virus (A/Iowa/08/2011(H3N2)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds >gb|JQ290177.1| Influenza A virus (A/Iowa/07/2011(H3N2)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds >gb|JQ290183.1| Influenza A virus (A/Iowa/09/2011(H3N2)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds >gb|JX030380.1| Influenza A virus (A/swine/Indiana/A01243254/2012(H1N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds >gb|JX092632.1| Influenza A virus (A/swine/Wisconsin/A01203142/2012(H1N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds >gb|JX163288.1| Influenza A virus (A/swine/Iowa/A01203503/2012(H3N2)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1803 1803 100% 0.0 99%
JX975048.1 Influenza A virus (A/swine/Ohio/25/2012(H1N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1797 1797 100% 0.0 99%
JX964965.1 Influenza A virus (A/swine/Wisconsin/A00677500/2012(H3N2)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1797 1797 100% 0.0 99%
JX952144.1 Influenza A virus (A/swine/North Carolina/A01270394/2012(H3N2)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1797 1797 100% 0.0 99%
JX905417.1 Influenza A virus (A/Utah/10/2012(H3N2)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1797 1797 100% 0.0 99%
JX869500.1 Influenza A virus (A/swine/Indiana/A00968397/2012(H3N2)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1797 1797 100% 0.0 99%
JX549118.1 Influenza A virus (A/swine/Indiana/A01104016/2012(H3N2)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1797 1797 100% 0.0 99%
JX549125.1 Influenza A virus (A/swine/Indiana/A01104023/2012(H3N2)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds >gb|JX869503.1| Influenza A virus (A/swine/Indiana/A00968308/2012(H3N2)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds >gb|JX964949.1| Influenza A virus (A/swine/Ohio/A01133466/2012(H3N2)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1797 1797 100% 0.0 99%
JX534977.1 Influenza A virus (A/swine/Indiana/A00968370/2012(H3N2)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1797 1797 100% 0.0 99%
JX534985.1 Influenza A virus (A/swine/Indiana/A00968373/2012(H3N2)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1797 1797 100% 0.0 99%
JX534993.1 Influenza A virus (A/swine/Indiana/A00968376/2012(H3N2)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1797 1797 100% 0.0 99%
JX535001.1 Influenza A virus (A/swine/Indiana/A00968379/2012(H3N2)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds >gb|JX534964.1| Influenza A virus (A/swine/Ohio/12TOSU268/2012(H3N2)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds >gb|JX549148.1| Influenza A virus (A/swine/Indiana/A00968386/2012(H3N2)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1797 1797 100% 0.0 99%
JX163290.1 Influenza A virus (A/swine/Indiana/A01203509/2012(H3N2)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds >gb|JX565516.1| Influenza A virus (A/swine/Ohio/12TOSU420/2012(H3N2)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds >gb|JX565484.1| Influenza A virus (A/swine/Ohio/12TOSU464/2012(H3N2)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds >gb|JX565476.1| Influenza A virus (A/swine/Ohio/12TOSU467/2012(H3N2)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1797 1797 100% 0.0 99%
JX092413.1 Influenza A virus (A/swine/Indiana/A01202632/2011(H1N2)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1797 1797 100% 0.0 99%
JX092409.1 Influenza A virus (A/swine/Indiana/A01202621/2011(H3N2)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1797 1797 100% 0.0 99%
JX080599.1 Influenza A virus (A/swine/Michigan/A01203374/2012(H1N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1797 1797 100% 0.0 99%
JX080598.1 Influenza A virus (A/swine/Indiana/A01203372/2012(H3N2)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1797 1797 100% 0.0 99%
JX030381.1 Influenza A virus (A/swine/Indiana/A01243255/2012(H1N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1797 1797 100% 0.0 99%
JX964933.1 Influenza A virus (A/swine/Maryland/A01104040/2012(H3N2)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1792 1792 100% 0.0 99%
JX964941.1 Influenza A virus (A/swine/Maryland/A01104048/2012(H3N2)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1792 1792 100% 0.0 99%
JX964957.1 Influenza A virus (A/swine/Ohio/A01133464/2012(H3N2)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1792 1792 100% 0.0 99%
JX869494.1 Influenza A virus (A/swine/Indiana/A00968390/2012(H3N2)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1792 1792 100% 0.0 99%
JX657037.1 Influenza A virus (A/swine/North Carolina/A01300820/2012(H3N2)) segment 7 cRNA sequence 1792 1792 100% 0.0 99%
JX549132.1 Influenza A virus (A/swine/Indiana/A01104029/2012(H3N2)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1792 1792 100% 0.0 99%
JX549140.1 Influenza A virus (A/swine/Indiana/A01104030/2012(H3N2)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1792 1792 100% 0.0 99%
JX092621.1 Influenza A virus (A/swine/Iowa/A01202937/2011(H1N2)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1792 1792 100% 0.0 99%
JX092500.1 Influenza A virus (A/swine/Iowa/A01202687/2011(H1N2)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1792 1792 100% 0.0 99%
JX092412.1 Influenza A virus (A/swine/Indiana/A01202631/2011(H1N2)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1792 1792 100% 0.0 99%
JQ738174.1 Influenza A virus (A/swine/Illinois/A00857304a/2012(H3N2)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1792 1792 100% 0.0 99%
JQ738182.1 Influenza A virus (A/swine/Illinois/A00857304b/2012(H3N2)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds >gb|JX099416.1| Influenza A virus (A/swine/Illinois/A00857318a/2012(H3N2)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds >gb|JX543527.1| Influenza A virus (A/swine/Illinois/A01203672/2012(H3N2)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1792 1792 100% 0.0 99%
JX422246.1 Influenza A virus (A/swine/Illinois/A01241916/2012(H3N2)) segment 7 matrix protein 2 (M2) gene, partial cds; and matrix protein 1 (M1) gene, complete cds 1790 1790 99% 0.0 99%
JQ290159.1 Influenza A virus (A/West Virginia/06/2011(H3N2)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, partial cds 1790 1790 98% 0.0 99%
JX869497.1 Influenza A virus (A/swine/Indiana/A00968318/2012(H1N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1786 1786 100% 0.0 99%
JX565508.1 Influenza A virus (A/swine/Ohio/12TOSU307/2012(H3N2)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1786 1786 100% 0.0 99%
JX163292.1 Influenza A virus (A/swine/Indiana/A01203521/2012(H3N2)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds >gb|JX163293.1| Influenza A virus (A/swine/Indiana/A01203522/2012(H3N2)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1786 1786 100% 0.0 99%
JX092518.1 Influenza A virus (A/swine/Indiana/A01202792/2011(H1N2)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1786 1786 100% 0.0 99%
CY121888.1 Influenza A virus (A/swine/Ohio/1/2012(H3N2)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds >gb|CY124832.1| Influenza A virus (A/swine/Ohio/9/2012(H3N2)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds >gb|CY124835.1| Influenza A virus (A/swine/Ohio/7/2012(H3N2)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1786 1786 100% 0.0 99%
JQ398753.1 Influenza A virus (A/swine/Iowa/A01202794/2011(H1N2)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds >gb|JX657755.1| Influenza A virus (A/swine/Illinois/A01240326/2011(H1N2)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1786 1786 100% 0.0 99%
JX267188.1 Influenza A virus (A/swine/Indiana/A01203541/2012(H1N2)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1781 1781 100% 0.0 99%
JQ756383.1 Influenza A virus (A/swine/Missouri/A01240017/2011(H3N2)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds >gb|JQ922344.1| Influenza A virus (A/swine/Missouri/A01240016/2011(H3N2)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1781 1781 100% 0.0 99%
JQ739708.1 Influenza A virus (A/swine/Iowa/A01243102/2012(H1N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1781 1781 100% 0.0 99%
JQ398754.1 Influenza A virus (A/swine/Iowa/A01202795/2011(H1N2)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1781 1781 100% 0.0 99%
CY095834.1 Influenza A virus (A/Shenzhen/63/2009(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1781 1781 100% 0.0 99%
JN652562.1 Influenza A virus (A/swine/Iowa/A01049765/2011(H1N2)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds >gb|JN652563.1| Influenza A virus (A/swine/Iowa/A01049766/2011(H1N2)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds >gb|JN863564.1| Influenza A virus (A/swine/Iowa/A01202033/2011(H1N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds >gb|JN863565.1| Influenza A virus (A/swine/Iowa/A01202034/2011(H1N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds >gb|JN940425.1| Influenza A virus (A/swine/NY/A01104005/2011(H3N2)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds >gb|JQ689119.1| Influenza A virus (A/swine/Missouri/A01047969/2010(H3N2)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1781 1781 100% 0.0 99%
JN652560.1 Influenza A virus (A/swine/Iowa/A01049755/2011(H1N2)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1781 1781 100% 0.0 99%
CY060745.1 Influenza A virus (A/Ontario/9698/2009(H1N1)) segment 7 sequence 1781 1781 100% 0.0 99%
CY045981.1 Influenza A virus (A/Toronto/T9842/2009(H1N1)) segment 7 sequence 1781 1781 100% 0.0 99%
CY045973.1 Influenza A virus (A/Toronto/T5362/2009(H1N1)) segment 7 sequence 1781 1781 100% 0.0 99%
GQ402207.1 Influenza A virus (A/Canada-MB/RV2023/2009(H1N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1781 1781 100% 0.0 99%
GQ402220.1 Influenza A virus (A/Canada-MB/RV1964/2009(H1N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds >gb|GQ402222.1| Influenza A virus (A/Canada-MB/RV1977/2009(H1N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds >gb|GQ402223.1| Influenza A virus (A/Canada-MB/RV1982/2009(H1N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds >gb|GQ402224.1| Influenza A virus (A/Canada-MB/RV2013/2009(H1N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds >gb|GQ402226.1| Influenza A virus (A/Canada-MB/RV2020/2009(H1N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1781 1781 100% 0.0 99%
GQ200293.1 Influenza A virus (A/Shandong/1/2009(H1N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds >gb|JF714039.1| Influenza A virus (A/swine/MB/10422/2009(H1N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds >gb|JF714055.1| Influenza A virus (A/swine/MB/31/2009(H1N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1781 1781 100% 0.0 99%
JX422390.1 Influenza A virus (A/swine/Illinois/A01327226/2012(H1N1)) segment 7 matrix protein 2 (M2) gene, partial cds; and matrix protein 1 (M1) gene, complete cds 1779 1779 99% 0.0 99%
JX422354.1 Influenza A virus (A/swine/Illinois/A01327221/2012(H1N1)) segment 7 matrix protein 2 (M2) gene, partial cds; and matrix protein 1 (M1) gene, complete cds 1779 1779 99% 0.0 99%
JX422225.1 Influenza A virus (A/swine/Illinois/A01241173/2012(H1N2)) segment 7 matrix protein 2 (M2) gene, partial cds; and matrix protein 1 (M1) gene, complete cds 1779 1779 99% 0.0 99%
JQ070771.1 Influenza A virus (A/Iowa/09/2011(H3N2)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, partial cds 1779 1779 98% 0.0 99%
CY052211.1 Influenza A virus (A/Texas/42163291/2009(H1N1)) segment 7, complete sequence 1777 1777 100% 0.0 99%
JX952159.1 Influenza A virus (A/swine/North Carolina/A01270264/2012(H1N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1775 1775 100% 0.0 99%
JX952156.1 Influenza A virus (A/swine/North Carolina/A01270245/2012(H1N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1775 1775 100% 0.0 99%
JX952153.1 Influenza A virus (A/swine/North Carolina/A01270265 /2012(H1N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1775 1775 100% 0.0 99%
CY069840.1 Influenza A virus (A/England/XFL00364/2009(H1N1)) segment 7 sequence 1775 1775 100% 0.0 99%
CY124074.1 Influenza A virus (A/Singapore/ON804/2009(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1775 1775 100% 0.0 99%
CY122998.1 Influenza A virus (A/Singapore/GP3021/2009(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds >gb|CY123543.1| Influenza A virus (A/Singapore/ON1811/2009(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1775 1775 100% 0.0 99%
CY114852.1 Influenza A virus (A/swine/Illinois/A01201633/2011(H3N2)) matrix protein 2 (M2) gene, partial cds; and matrix protein 1 (M1) gene, complete cds 1775 1775 99% 0.0 99%
CY114851.1 Influenza A virus (A/swine/Illinois/A01201631/2011(H3N2)) matrix protein 2 (M2) gene, partial cds; and matrix protein 1 (M1) gene, complete cds 1775 1775 99% 0.0 99%
CY114848.1 Influenza A virus (A/swine/Illinois/A01201629/2011(H3N2)) matrix protein 2 (M2) gene, partial cds; and matrix protein 1 (M1) gene, complete cds 1775 1775 99% 0.0 99%
CY114687.1 Influenza A virus (A/swine/USA/10_182/2010(H3N2)) matrix protein 2 (M2) gene, partial cds; and matrix protein 1 (M1) gene, complete cds 1775 1775 99% 0.0 99%
JX092508.1 Influenza A virus (A/swine/Iowa/A01202745/2011(H1N2)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds >gb|JX092509.1| Influenza A virus (A/swine/Iowa/A01202747/2011(H1N2)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1775 1775 100% 0.0 99%
JX092499.1 Influenza A virus (A/swine/Iowa/A01202677/2011(H1N2)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1775 1775 100% 0.0 99%
CY112060.1 Influenza A virus (A/Hong Kong/H090-779-V22/2009(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1775 1775 100% 0.0 99%
CY112052.1 Influenza A virus (A/Hong Kong/H090-779-V21/2009(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds >gb|CY120438.1| Influenza A virus (A/Hong Kong/H090-779-V12/2009(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds >gb|CY120454.1| Influenza A virus (A/Hong Kong/H090-779-V22/2009(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds >gb|CY121681.1| Influenza A virus (A/California/07/2009(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1775 1775 100% 0.0 99%
CY112044.1 Influenza A virus (A/Hong Kong/H090-779-V20/2009(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1775 1775 100% 0.0 99%
CY112036.1 Influenza A virus (A/Hong Kong/H090-779-V12/2009(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1775 1775 100% 0.0 99%
CY112028.1 Influenza A virus (A/Hong Kong/H090-779-V10/2009(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds >gb|CY120093.1| Influenza A virus (A/Hong Kong/H090-779-V20/2009(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds >gb|CY120430.1| Influenza A virus (A/Hong Kong/H090-779-V10/2009(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds >gb|CY120446.1| Influenza A virus (A/Hong Kong/H090-779-V21/2009(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds >gb|CY120716.1| Influenza A virus (A/Brazil/AVS03/2009(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1775 1775 100% 0.0 99%
JQ689111.1 Influenza A virus (A/swine/Missouri/A01047968/2010(H3N2)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1775 1775 100% 0.0 99%
CY107069.1 Influenza A virus (A/swine/Illinois/A01201606/2011(H3N2)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1775 1775 100% 0.0 99%
JQ070780.1 Influenza A virus (A/Indiana/10/2011(H3N2)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds >gb|JX647381.1| Influenza A virus (A/swine/Iowa/A01243736/2012(H3N2)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds >gb|JX657836.1| Influenza A virus (A/swine/Illinois/A01240908/2012(H3N2)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1775 1775 100% 0.0 99%
JQ070787.1 Influenza A virus (A/Indiana/10/2011(H3N2)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds >gb|JQ350525.1| Influenza A virus (A/swine/Iowa/A01202640/2011(H3N2)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds >gb|JQ738166.1| Influenza A virus (A/swine/Illinois/A00857138b/2011(H3N2)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds >gb|JQ738150.1| Influenza A virus (A/swine/Illinois/A00857300/2011(H3N2)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds >gb|JX092395.1| Influenza A virus (A/swine/Iowa/A01202529/2011(H3N2)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds >gb|JX092396.1| Influenza A virus (A/swine/Iowa/A01202530/2011(H3N2)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds >gb|JX092414.1| Influenza A virus (A/swine/Iowa/A01202639/2011(H3N2)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds >gb|JX092611.1| Influenza A virus (A/swine/Iowa/A01202878/2011(H3N2)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds >gb|JX092612.1| Influenza A virus (A/swine/Iowa/A01202879/2011(H3N2)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds >gb|JX092623.1| Influenza A virus (A/swine/Illinois/A01202978/2011(H3N2)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1775 1775 100% 0.0 99%
JN193424.1 Influenza A virus (A/swine/MN/25618/2011(H1N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1775 1775 100% 0.0 99%
JF714085.1 Influenza A virus (A/swine/MB/36/2009(H1N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1775 1775 100% 0.0 99%
JF714079.1 Influenza A virus (A/swine/MB/22/2009(H1N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1775 1775 100% 0.0 99%
JF714075.1 Influenza A virus (A/swine/MB/54/2009(H1N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1775 1775 100% 0.0 99%
JF714063.1 Influenza A virus (A/swine/MB/32-2/2009(H1N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1775 1775 100% 0.0 99%
JF714031.1 Influenza A virus (A/swine/MB/46/2009(H1N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1775 1775 100% 0.0 99%
CY050370.1 Influenza A virus (A/Korea/S1/2009(H1N1)) segment 7 sequence 1775 1775 100% 0.0 99%
HQ239662.1 Influenza A virus (A/Canada-MB/RV2013-10/2009(H1N1)) segment 7 matrix protein 2 (M2) gene, partial cds; and matrix protein 1 (M1) gene, complete cds 1775 1775 99% 0.0 99%
HQ695923.1 Influenza A virus (A/Taiwan/14/2009(H1N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1775 1775 100% 0.0 99%
CY076758.1 Influenza A virus (A/Ontario/142358/2009(H1N1)) segment 7 sequence 1775 1775 100% 0.0 99%
CY069637.1 Influenza A virus (A/Singapore/478/2009(H1N1)) segment 7 sequence 1775 1775 100% 0.0 99%
CY069622.1 Influenza A virus (A/Singapore/276/2009(H1N1)) segment 7 sequence 1775 1775 100% 0.0 99%
CY067812.1 Influenza A virus (A/Lisboa/35/2009(H1N1)) segment 7 sequence 1775 1775 100% 0.0 99%
CY046588.1 Influenza A virus (A/Wisconsin/629-D02452/2009(H1N1)) segment 7, complete sequence >gb|CY067806.1| Influenza A virus (A/Lisboa/31/2009(H1N1)) segment 7 sequence 1775 1775 100% 0.0 99%
CY050207.1 Influenza A virus (A/Mexico City/002/2009(H1N1)) segment 7, complete sequence 1775 1775 100% 0.0 99%
CY090058.1 Influenza A virus (A/Managua/4606.07/2009(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1772 1772 100% 0.0 99%
CY050952.1 Influenza A virus (A/Wisconsin/629-D00724/2009(H1N1)) segment 7, complete sequence 1772 1772 100% 0.0 99%

_________________
www.twitter.com/hniman


Top
 Profile  
 
Display posts from previous:  Sort by  
Post new topic Reply to topic  [ 12 posts ]  Go to page 1, 2  Next

All times are UTC - 5 hours [ DST ]


Who is online

Users browsing this forum: Google [Bot], niman, saraseer and 147 guests


You cannot post new topics in this forum
You cannot reply to topics in this forum
You cannot edit your posts in this forum
You cannot delete your posts in this forum
You cannot post attachments in this forum

Search for:
Jump to:  
cron
Powered by phpBB® Forum Software © phpBB Group