Rhiza Labs FluTracker Forum

The place to discuss the flu
It is currently Thu Oct 19, 2017 6:39 am

All times are UTC - 5 hours [ DST ]




Post new topic Reply to topic  [ 7 posts ] 
Author Message
PostPosted: Wed Jul 11, 2012 1:30 pm 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
ISU /USDA have recently released a series of HA, NA, MP sequences from 2012 swine collections. Included were four June 2012 collections from Ohio swine which matched the initial 2011 confirmed human H3N2v cases. Although all four of these isolates were closely related to each other, the N2 sequences from A/swine/Ohio/9/2012 had acquired additional sequences via recombination.

The new acquisitions have been seen in prior human H3n2 sequences from 2003, as well as more recent swine H1N2v swine sequences.

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Wed Jul 11, 2012 1:33 pm 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
LOCUS CY124831 1410 bp cRNA linear VRL 05-JUL-2012
DEFINITION Influenza A virus (A/swine/Ohio/9/2012(H3N2)) neuraminidase (NA)
gene, complete cds.
ACCESSION CY124831
VERSION CY124831.1 GI:393728113
KEYWORDS .
SOURCE Influenza A virus (A/swine/Ohio/9/2012(H3N2))
ORGANISM Influenza A virus (A/swine/Ohio/9/2012(H3N2))
Viruses; ssRNA negative-strand viruses; Orthomyxoviridae;
Influenzavirus A.
REFERENCE 1 (bases 1 to 1410)
CONSRTM USDA Swine Surveillance
TITLE Unpublished
JOURNAL Unpublished
REFERENCE 2 (bases 1 to 1410)
CONSRTM USDA Swine Surveillance
TITLE Direct Submission
JOURNAL Submitted (05-JUL-2012) USDA Swine Surveillance, National
Veterinary Services Laboratories, 1920 Dayton Ave, Ames, IA 50010,
USA
FEATURES Location/Qualifiers
source 1..1410
/organism="Influenza A virus (A/swine/Ohio/9/2012(H3N2))"
/mol_type="viral cRNA"
/strain="A/swine/Ohio/9/2012"
/serotype="H3N2"
/isolation_source="oral fluid"
/host="swine"
/db_xref="taxon:1206569"
/segment="6"
/lab_host="P2 passage(s)"
/country="USA: Ohio"
/collection_date="Jun-2012"
gene 1..1410
/gene="NA"
CDS 1..1410
/gene="NA"
/codon_start=1
/product="neuraminidase"
/protein_id="AFN22004.1"
/db_xref="GI:393728114"
/translation="MNPNQKIITIGSVSLIIATICFLMQIAILVTTVTLHFKQHDYNS
PPNNQAMLCEPTIIERNTTKIVYLTNTTIEKEICPKLAEYRSWSKPQCNITGFAPFSK
DNSIRLSAGGDIWVTREPYVSCDPGKCYQFALGQGTTLNNGHSNNTVHDRTPYRTLLM
NELGVPFHLGTRQVCMAWSSSSCHDGKAWLHVCITGNDNNATASFIYNGRLVDSIGSW
SKNILRTQESECVCINGTCTVVMTDGSASGKADTKILFVEEGKIVHISTLSGSAQHVE
ECSCYPRFPGVRCVCRDNWKGSNRPIVDINVKNYSIVSTYVCSGLVGDTPRKSDSVSS
SYCLDPNNEKGGHGVKGWAFDDGNDVWMGRTINETLRLGYETFKVIEGWSKANSKLQT
NRQVIVEKGDRSGYSGIFSVEGKRCINRCFYVELIRGRKEETKVWWTSNSIVVFCGTS
GTYGTGSWPDGADINLMPI"
ORIGIN
1 atgaatccaa atcagaagat aataacaatt ggctctgttt ctctcatcat tgccacaata
61 tgcttcctaa tgcaaatcgc catcctggta actactgtaa cattgcattt caagcagcat
121 gactacaact cccccccaaa caaccaagca atgctgtgtg aaccaacaat aatagaaaga
181 aacaccacaa agattgtgta tttgaccaac accaccatag agaaggagat atgccccaaa
241 ctagcagaat atagaagttg gtcaaagccg caatgtaaca ttacaggatt tgcacctttt
301 tctaaggaca attcaattag gctttctgct ggtggggaca tatgggtgac aagagaacct
361 tatgtgtcat gtgatcctgg caagtgctat caatttgctc ttgggcaggg aacaacatta
421 aacaacggac attcaaataa cactgtacat gataggaccc cttatcgaac cctattgatg
481 aatgaattgg gtgttccatt tcatttagga accaggcaag tgtgcatggc atggtcaagc
541 tcaagttgtc acgatggaaa agcatggctg catgtttgta taactgggaa tgataacaat
601 gcaacagcta gcttcattta caatgggagg cttgtagata gtattggttc atggtccaaa
661 aatatactca gaacccagga gtcggaatgc gtctgtatca atggaacctg tacagtagta
721 atgactgatg gaagcgcttc aggaaaagct gatactaaaa tactattcgt tgaggagggg
781 aagatcgttc atattagcac attgtcagga agtgctcagc atgttgagga gtgctcctgt
841 tatcctcgat ttcctggtgt cagatgtgtt tgcagagaca actggaaagg ctccaatagg
901 cccatcgtag atataaatgt aaagaattat agcattgttt ccacttatgt atgctcagga
961 cttgttggag acacacccag aaaaagtgac agcgtcagca gtagttattg cttagatcct
1021 aacaatgaga aaggtggtca tggggtgaaa ggctgggcct ttgatgatgg aaatgacgtg
1081 tggatgggaa ggacaatcaa cgagacgtta cgcttaggtt atgaaacctt caaagtcatt
1141 gaaggctggt ccaaagctaa ctccaaatta cagacaaata ggcaagtcat agttgaaaaa
1201 ggtgacaggt ccggttattc tggtattttc tccgttgaag gtaaaagatg catcaatcgg
1261 tgcttttatg tggagttgat aaggggaagg aaagaggaaa ctaaagtctg gtggacctca
1321 aacagtattg ttgtgttttg tggcacctca ggtacatatg gaacaggctc atggcctgat
1381 ggagcggata tcaatctcat gcctatataa

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Wed Jul 11, 2012 2:08 pm 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
T63A at Genbank (partial list)


JQ023764.1 Influenza A virus (A/swine/Minnesota/0745/2010(H1N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY124831.1 Influenza A virus (A/swine/Ohio/9/2012(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JX138511.1 Influenza A virus (A/swine/Zhejiang/01/2008(H1N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY116594.1 Influenza A virus (A/Netherlands/399/1993(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY116590.1 Influenza A virus (A/Netherlands/178/1995(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY116585.1 Influenza A virus (A/Guizhou/54/1989(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY116583.1 Influenza A virus (A/England/261/1991(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY116582.1 Influenza A virus (A/Eindhoven/3447/1989(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY114885.1 Influenza A virus (A/swine/Illinois/A01116190/2011(H3N2)) neuraminidase (NA) gene, partial cds 28.2 28.2 100% 1.8 100%
CY114858.1 Influenza A virus (A/swine/Minnesota/A01201895/2011(H3N2)) neuraminidase (NA) gene, partial cds 28.2 28.2 100% 1.8 100%
CY114850.1 Influenza A virus (A/swine/Illinois/A01201631/2011(H3N2)) neuraminidase (NA) gene, partial cds 28.2 28.2 100% 1.8 100%
CY114847.1 Influenza A virus (A/swine/Illinois/A01201629/2011(H3N2)) neuraminidase (NA) gene, partial cds 28.2 28.2 100% 1.8 100%
CY114841.1 Influenza A virus (A/swine/Illinois/A01201606/2011(H3N2)) neuraminidase (NA) gene, partial cds 28.2 28.2 100% 1.8 100%
CY114717.1 Influenza A virus (A/swine/North Carolina/A01076184/2010(H1N2)) neuraminidase (NA) gene, partial cds 28.2 28.2 100% 1.8 100%
CY114593.1 Influenza A virus (A/swine/Minnesota/A01201424/2010(H3N2)) neuraminidase (NA) gene, partial cds 28.2 28.2 100% 1.8 100%
CY114579.1 Influenza A virus (A/swine/Minnesota/A01076335/2010(H1N2)) neuraminidase (NA) gene, partial cds >gb|CY114758.1| Influenza A virus (A/swine/Minnesota/A01076326/2010(H1N2)) neuraminidase (NA) gene, partial cds 28.2 28.2 100% 1.8 100%
JX122445.1 Influenza A virus (A/swine/Minnesota/A01076197/2010(H1N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JX122440.1 Influenza A virus (A/swine/Minnesota/A01076193/2010(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY122319.1 Influenza A virus (A/swine/South Dakota/3/2012(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY122317.1 Influenza A virus (A/Memphis/8/2003(H1N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY122053.1 Influenza A virus (A/swine/Minnesota/2/2012(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JX092607.1 Influenza A virus (A/swine/North Carolina/A01203272/2012(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JX092606.1 Influenza A virus (A/swine/Iowa/A01203248/2012(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JX092599.1 Influenza A virus (A/swine/Iowa/A01203194/2012(H1N2)) segment 6 neuraminidase (NA) gene, complete cds >gb|JX092600.1| Influenza A virus (A/swine/Iowa/A01203195/2012(H1N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JX092596.1 Influenza A virus (A/swine/Iowa/A01203153/2012(H1N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JX092579.1 Influenza A virus (A/swine/Iowa/A01202889/2011(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JX092573.1 Influenza A virus (A/swine/Indiana/A01202867/2011(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JX092572.1 Influenza A virus (A/swine/Indiana/A01202866/2011(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JX092475.1 Influenza A virus (A/swine/Iowa/A01202786/2011(H1N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JX092466.1 Influenza A virus (A/swine/Iowa/A01202742/2011(H1N2)) segment 6 neuraminidase (NA) gene, complete cds >gb|JX092467.1| Influenza A virus (A/swine/Iowa/A01202743/2011(H1N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JX092458.1 Influenza A virus (A/swine/Iowa/A01202671/2011(H1N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JX092357.1 Influenza A virus (A/swine/Iowa/A01202614/2011(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JX092356.1 Influenza A virus (A/swine/Iowa/A01202613/2011(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JX092351.1 Influenza A virus (A/swine/Iowa/A01202581/2011(H1N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JX092344.1 Influenza A virus (A/swine/Nebraska/A01202501/2011(H1N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JX092343.1 Influenza A virus (A/swine/Oklahoma/A01202498/2011(H1N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JX092339.1 Influenza A virus (A/swine/Iowa/A01202455/2011(H1N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JX092329.1 Influenza A virus (A/swine/Oklahoma/A01202415/2011(H1N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JX092328.1 Influenza A virus (A/swine/Oklahoma/A01202413/2011(H1N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JX092327.1 Influenza A virus (A/swine/Iowa/A01202411/2011(H1N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JX092321.1 Influenza A virus (A/swine/Iowa/A01202089/2011(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JX080661.1 Influenza A virus (A/swine/Iowa/A01049020/2010(mixed)) clone N2 segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JX080657.1 Influenza A virus (A/swine/Iowa/A01049694/2011(mixed)) clone N2 segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JX080649.1 Influenza A virus (A/swine/Iowa/A01049263/2010(H1N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JX080644.1 Influenza A virus (A/swine/Iowa/A01049000/2010(H1N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JX080584.1 Influenza A virus (A/swine/Iowa/A01203463/2012(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JX080583.1 Influenza A virus (A/swine/Iowa/A01203459/2012(H3N2)) segment 6 neuraminidase (NA) gene, complete cds >gb|JX080587.1| Influenza A virus (A/swine/Iowa/A01243311/2012(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JX080561.1 Influenza A virus (A/swine/Iowa/A01203304/2012(H3N2)) segment 6 neuraminidase (NA) gene, complete cds >gb|JX092589.1| Influenza A virus (A/swine/Iowa/A01203104/2011(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY121474.1 Influenza A virus (A/reassortant/NYMC X-153A(Texas/40/2003 x Puerto Rico/8/1934)(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY121434.1 Influenza A virus (A/reassortant/X-145(California/32/1999 x Puerto Rico/8/1934)(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY121426.1 Influenza A virus (A/California/32/1999(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY121418.1 Influenza A virus (A/reassortant/X-143(Ulan Ude/01/2000 x Puerto Rico/8/1934)(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY121410.1 Influenza A virus (A/Ulan Ude/01/2000(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY121402.1 Influenza A virus (A/reassortant/X-141(Panama/2007/1999 x Puerto Rico/8/1934)(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY121383.1 Influenza A virus (A/reassortant/X-137(Moscow/10/1999 x Puerto Rico/8/1934)(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY121375.1 Influenza A virus (A/Moscow/10/1999(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY121367.1 Influenza A virus (A/reassortant/X-129(South Africa/1147/1996 x Puerto Rico/8/1934)(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY121359.1 Influenza A virus (A/South Africa/1147/1996(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY121351.1 Influenza A virus (A/reassortant/X-123A(Johannesburg/33/1994 x Puerto Rico/8/1934)(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY121343.1 Influenza A virus (A/Johannesburg/33/1994(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY121335.1 Influenza A virus (A/reassortant/X-121(Shangdong/9/1993 x Puerto Rico/8/1934)(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY121327.1 Influenza A virus (A/Harbin/15/1992(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY121311.1 Influenza A virus (A/Shanghai/11/1987(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY121303.1 Influenza A virus (A/reassortant/X-97(Sichuan/2/1987 x Puerto Rico/8/1934)(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY121295.1 Influenza A virus (A/Sichuan/2/1987(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY121034.1 Influenza A virus (A/reassortant/X-119(Harbin/15/1992 x Puerto Rico/8/1934)(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY121026.1 Influenza A virus (A/Beijing/353/1989(H3N2)) neuraminidase (NA) gene, complete cds >gb|CY121319.1| Influenza A virus (A/reassortant/X-109(Beijing/353/1989 x Puerto Rico/8/1934)(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY121018.1 Influenza A virus (A/reassortant/X-99(Shanghai/11/1987 x Puerto Rico/8/1934)(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JX048064.1 Influenza A virus (A/swine/Illinois/A01201633/2011(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JX048057.1 Influenza A virus (A/swine/Illinois/A01076768/2010(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JX048054.1 Influenza A virus (A/swine/Illinois/A01076724/2010(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JX048052.1 Influenza A virus (A/swine/Minnesota/A01076531/2010(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JX048051.1 Influenza A virus (A/swine/Iowa/A01076508/2010(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JX048050.1 Influenza A virus (A/swine/Iowa/A01076507/2010(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JX048035.1 Influenza A virus (A/swine/Illinois/A01076121/2010(H1N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY041849.2 Influenza A virus (A/swine/North Carolina/R08-001877-D08-013371/2008 (H3N2)) segment 6 sequence 28.2 28.2 100% 1.8 100%
CY118676.1 Influenza A virus (A/Malaysia/25920/2003(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY118668.1 Influenza A virus (A/Malaysia/25849/2003(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY118652.1 Influenza A virus (A/Malaysia/18128/1998(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY118644.1 Influenza A virus (A/Malaysia/18121/1998(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY118628.1 Influenza A virus (A/Malaysia/17998/1998(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY118620.1 Influenza A virus (A/Malaysia/17392/1998(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY118612.1 Influenza A virus (A/Malaysia/17332/1998(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY118580.1 Influenza A virus (A/Malaysia/13002/1997(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY118572.1 Influenza A virus (A/Malaysia/12990/1997(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY118564.1 Influenza A virus (A/Malaysia/12974/1997(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY118556.1 Influenza A virus (A/Malaysia/12942/1997(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY118548.1 Influenza A virus (A/Malaysia/12904/1997(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY118540.1 Influenza A virus (A/Malaysia/12766/1997(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY118524.1 Influenza A virus (A/Malaysia/12550/1997(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY118500.1 Influenza A virus (A/Malaysia/10997/1996(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY118492.1 Influenza A virus (A/Malaysia/10969/1996(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY118484.1 Influenza A virus (A/Malaysia/10877/1996(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY118476.1 Influenza A virus (A/Malaysia/10717/1996(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY118468.1 Influenza A virus (A/Malaysia/10807/1996(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY118460.1 Influenza A virus (A/Malaysia/10370/1996(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY118452.1 Influenza A virus (A/Malaysia/10360/1996(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY118444.1 Influenza A virus (A/Malaysia/10111/1996(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY118436.1 Influenza A virus (A/Malaysia/07832/1995(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY118428.1 Influenza A virus (A/Malaysia/07831/1995(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY118420.1 Influenza A virus (A/Malaysia/07145/1995(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY118277.1 Influenza A virus (A/Malaysia/25750/2003(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY117990.1 Influenza A virus (A/Malaysia/29997/2004(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY117973.1 Influenza A virus (A/Malaysia/25890/2003(mixed)) neuraminidase (NA) gene, complete cds >gb|CY118684.1| Influenza A virus (A/Malaysia/25957/2003(H3N2)) neuraminidase (NA) gene, complete cds >gb|CY118692.1| Influenza A virus (A/Malaysia/26003/2003(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY117962.1 Influenza A virus (A/Malaysia/25804/2003(mixed)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY117889.1 Influenza A virus (A/Malaysia/23637/2002(mixed)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY117822.1 Influenza A virus (A/Malaysia/22387/2002(mixed)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY117786.1 Influenza A virus (A/Malaysia/14712/1997(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY117754.1 Influenza A virus (A/Malaysia/13241/1997(H3N2)) neuraminidase (NA) gene, complete cds >gb|CY118532.1| Influenza A virus (A/Malaysia/12726/1997(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY117738.1 Influenza A virus (A/Malaysia/10970/1996(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY117730.1 Influenza A virus (A/Malaysia/10879/1996(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY117708.1 Influenza A virus (A/Malaysia/10135/1996(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY117700.1 Influenza A virus (A/Malaysia/10081/1996(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JQ906927.1 Influenza A virus (A/swine/Minnesota/A01201429/2011(H1N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JQ906922.1 Influenza A virus (A/swine/Minnesota/A01134528/2010(H1N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JQ906921.1 Influenza A virus (A/swine/Minnesota/A01134357/2011(H1N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JQ906920.1 Influenza A virus (A/swine/Minnesota/A01134353/2011(H1N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JQ906915.1 Influenza A virus (A/swine/Minnesota/A01116285/2011(H1N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JQ906914.1 Influenza A virus (A/swine/Minnesota/A01116140/2011(H1N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JQ906913.1 Influenza A virus (A/swine/Minnesota/A01076998/2010(H1N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JQ906912.1 Influenza A virus (A/swine/Minnesota/A01076764/2010(H1N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JQ906911.1 Influenza A virus (A/swine/Minnesota/A01076763/2010(H1N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JQ906909.1 Influenza A virus (A/swine/Minnesota/A01076331/2010(H1N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JQ906908.1 Influenza A virus (A/swine/Minnesota/A01076210/2010(H1N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JQ906907.1 Influenza A virus (A/swine/Minnesota/A01076209/2010(H1N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JQ906906.1 Influenza A virus (A/swine/Minnesota/A01076205/2010(H1N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JQ906905.1 Influenza A virus (A/swine/Minnesota/A01047913/2010(H1N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JQ906902.1 Influenza A virus (A/swine/Iowa/A01076186/2010(H1N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JQ906900.1 Influenza A virus (A/swine/Iowa/A01076148/2010(H1N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JQ906899.1 Influenza A virus (A/swine/Indiana/A01076177/2009(H1N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JQ858434.1 Influenza A virus (A/swine/Illinois/A01076221/2010(H1N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JQ858435.1 Influenza A virus (A/swine/Illinois/A01076223/2010(H1N2)) segment 6 neuraminidase (NA) gene, complete cds >gb|JQ906901.1| Influenza A virus (A/swine/Iowa/A01076157/2010(H1N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JQ790998.1 Influenza A virus (A/swine/Illinois/A01047009/2010(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JQ791006.1 Influenza A virus (A/swine/Illinois/A01047014/2010(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JQ783103.1 Influenza A virus (A/swine/Minnesota/A01201894/2011(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JQ783102.1 Influenza A virus (A/swine/Illinois/A01201770/2011(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JQ783101.1 Influenza A virus (A/swine/Pennsylvania/A01201666/2011(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JQ783098.1 Influenza A virus (A/swine/Nebraska/A01116980/2011(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JQ783097.1 Influenza A virus (A/swine/Minnesota/A01116200/2011(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JQ783096.1 Influenza A virus (A/swine/Minnesota/A01116195/2011(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JQ783095.1 Influenza A virus (A/swine/Illinois/A01076859/2010(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JQ783094.1 Influenza A virus (A/swine/Minnesota/A01076701/2010(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JQ783093.1 Influenza A virus (A/swine/Iowa/A01076632/2010(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JQ783092.1 Influenza A virus (A/swine/Iowa/A01076630/2010(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JQ783090.1 Influenza A virus (A/swine/North Carolina/A01076214/2010(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JQ783089.1 Influenza A virus (A/swine/North Carolina/A01047914/2011(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JQ783087.1 Influenza A virus (A/swine/Iowa/A01047906/2010(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JQ756391.1 Influenza A virus (A/swine/Minnesota/A01240095/2011(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JQ756390.1 Influenza A virus (A/swine/Minnesota/A01240088/2011(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JQ756389.1 Influenza A virus (A/swine/Missouri/A01240017/2011(H3N2)) segment 6 neuraminidase (NA) gene, complete cds >gb|JQ922362.1| Influenza A virus (A/swine/Missouri/A01240016/2011(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JQ756387.1 Influenza A virus (A/swine/Illinois/A01076865/2010(H3N2)) segment 6 neuraminidase (NA) gene, complete cds >gb|JQ922347.1| Influenza A virus (A/swine/Illinois/A01076708/2010(H3N2)) segment 6 neuraminidase (NA) gene, complete cds >gb|JX048053.1| Influenza A virus (A/swine/Illinois/A01076709/2010(H3N2)) segment 6 neuraminidase (NA) gene, complete cds >gb|JX048055.1| Influenza A virus (A/swine/Illinois/A01076730/2010(H3N2)) segment 6 neuraminidase (NA) gene, complete cds >gb|JX048056.1| Influenza A virus (A/swine/Illinois/A01076735/2010(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JQ739710.1 Influenza A virus (A/swine/Iowa/A01203197/2012(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JQ739709.1 Influenza A virus (A/swine/Iowa/A01203196/2012(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY114495.1 Influenza A virus (A/Netherlands/301/1999(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY114487.1 Influenza A virus (A/Netherlands/5/1998(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY114479.1 Influenza A virus (A/Brisbane/8/1996(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY114471.1 Influenza A virus (A/United Kingdom/261/1991(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY114463.1 Influenza A virus (A/Beijing/353/1989(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY114455.1 Influenza A virus (A/Oklahoma/5/1988(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY114447.1 Influenza A virus (A/Victoria/1/1988(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY114367.1 Influenza A virus (A/Netherlands/312/2003(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY114351.1 Influenza A virus (A/Finland/170/2003(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY114343.1 Influenza A virus (A/Netherlands/120/2002(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY114335.1 Influenza A virus (A/Netherlands/126/2001(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY114319.1 Influenza A virus (A/Netherlands/3/2000(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY114311.1 Influenza A virus (A/Netherlands/462/1998(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY114303.1 Influenza A virus (A/Netherlands/300/1997(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY114295.1 Influenza A virus (A/Auckland/10/1997(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY114279.1 Influenza A virus (A/Lyon/1781/1996(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY114271.1 Influenza A virus (A/Hong Kong/434/1996(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY114263.1 Influenza A virus (A/Hong Kong/358/1996(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY114255.1 Influenza A virus (A/Hong Kong/357/1996(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY114247.1 Influenza A virus (A/Hong Kong/42/1996(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY114239.1 Influenza A virus (A/Hong Kong/20/1996(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY114231.1 Influenza A virus (A/Geneva/3958/1996(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY114223.1 Influenza A virus (A/Netherlands/1/1995(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY114215.1 Influenza A virus (A/Lyon/2279/1995(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY114207.1 Influenza A virus (A/Hong Kong/49/1995(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY114199.1 Influenza A virus (A/Hong Kong/3/1995(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY114191.1 Influenza A virus (A/Geneva/A9509/1995(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY114183.1 Influenza A virus (A/Finland/381/1995(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY114175.1 Influenza A virus (A/Finland/339/1995(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY114167.1 Influenza A virus (A/Finland/338/1995(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY114159.1 Influenza A virus (A/Netherlands/18/1994(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY114151.1 Influenza A virus (A/Hong Kong/56/1994(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY114119.1 Influenza A virus (A/Shangdong/9/1993(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY114111.1 Influenza A virus (A/Scotland/160/1993(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY114103.1 Influenza A virus (A/Scotland/142/1993(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY114095.1 Influenza A virus (A/Paris/287/1993(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY114087.1 Influenza A virus (A/Netherlands/398/1993(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY114079.1 Influenza A virus (A/Netherlands/372/1993(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY114071.1 Influenza A virus (A/Netherlands/357/1993(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY114055.1 Influenza A virus (A/Netherlands/126/1993(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY114047.1 Influenza A virus (A/Netherlands/101/1993(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY114007.1 Influenza A virus (A/Madrid/G122/1993(H3N2)) neuraminidase (NA) gene, complete cds >gb|CY114023.1| Influenza A virus (A/Madrid/G109/1993(H3N2)) neuraminidase (NA) gene, complete cds >gb|CY114039.1| Influenza A virus (A/Madrid/G252/1993(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY113999.1 Influenza A virus (A/Lyon/23602/1993(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY113991.1 Influenza A virus (A/Lyon/1815/1993(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY113983.1 Influenza A virus (A/Lyon/672/1993(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY113975.1 Influenza A virus (A/Guangdong/25/1993(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY113967.1 Influenza A virus (A/Enschede/5458/1993(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY113959.1 Influenza A virus (A/Akita/4/1993(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY113951.1 Influenza A virus (A/Victoria/68/1992(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY113943.1 Influenza A virus (A/Umea/2000/1992(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY113935.1 Influenza A virus (A/Umea/1982/1992(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY113919.1 Influenza A virus (A/Stockholm/13/1992(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY113903.1 Influenza A virus (A/Stockholm/7/1992(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY113895.1 Influenza A virus (A/South Austalia/27/1992(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY113887.1 Influenza A virus (A/South Austalia/23/1992(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY113879.1 Influenza A virus (A/Paris/614/1992(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY113871.1 Influenza A virus (A/Paris/597/1991(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY113863.1 Influenza A virus (A/Paris/583/1992(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY113847.1 Influenza A virus (A/Paris/548/1991(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY113831.1 Influenza A virus (A/Paris/467/1991(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY113799.1 Influenza A virus (A/Paris/407/1991(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY113791.1 Influenza A virus (A/Paris/325/1991(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY113767.1 Influenza A virus (A/Nijmegen/3129/1992(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY113751.1 Influenza A virus (A/Netherlands/938/1991(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY113743.1 Influenza A virus (A/Netherlands/935/1992(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY113727.1 Influenza A virus (A/Netherlands/819/1992(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY113719.1 Influenza A virus (A/Madrid/G58/1992(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY113687.1 Influenza A virus (A/Geneva/5113/1992(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY113679.1 Influenza A virus (A/Beijing/32/1992(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY113671.1 Influenza A virus (A/Netherlands/891/1991(H3N2)) neuraminidase (NA) gene, complete cds >gb|CY113927.1| Influenza A virus (A/Tilburg/5957/1991(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY113663.1 Influenza A virus (A/Netherlands/816/1991(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY113655.1 Influenza A virus (A/Madrid/G12/1991(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY113647.1 Influenza A virus (A/Lyon/24222/1991(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY113639.1 Influenza A virus (A/Lyon/24103/1991(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY113631.1 Influenza A virus (A/Lyon/23672/1991(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY113623.1 Influenza A virus (A/Lyon/1594/1991(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY113607.1 Influenza A virus (A/Lyon/1337/1991(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY113599.1 Influenza A virus (A/Lyon/1276/1991(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY113591.1 Influenza A virus (A/Lyon/1189/1991(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY113583.1 Influenza A virus (A/Lyon/1182/1991(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY113567.1 Influenza A virus (A/Geneva/5366/1991(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY113559.1 Influenza A virus (A/England/260/1991(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY113551.1 Influenza A virus (A/Canberra/1/1991(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY113543.1 Influenza A virus (A/Wellington/3/1990(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY113535.1 Influenza A virus (A/Victoria/2/1990(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY113527.1 Influenza A virus (A/Suita/1/1990(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY113519.1 Influenza A virus (A/Shanghai/24/1990(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY113511.1 Influenza A virus (A/Memphis/5/1990(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY113503.1 Influenza A virus (A/Memphis/2/1990(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY113495.1 Influenza A virus (A/Waikato/1/1989(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY113487.1 Influenza A virus (A/Wellington/5/1989(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY113479.1 Influenza A virus (A/Victoria/1/1989(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY113471.1 Influenza A virus (A/Singapore/40/1989(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY113463.1 Influenza A virus (A/Singapore/35/1989(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY113455.1 Influenza A virus (A/Singapore/34/1989(H3N2)) neuraminidase (NA) gene, complete cds >gb|CY114127.1| Influenza A virus (A/Singapore/36/1989(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY113447.1 Influenza A virus (A/Singapore/3/1993(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY113439.1 Influenza A virus (A/Netherlands/738/1989(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY113431.1 Influenza A virus (A/Netherlands/650/1989(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY113423.1 Influenza A virus (A/Netherlands/620/1989(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY113415.1 Influenza A virus (A/England/138/1989(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY113407.1 Influenza A virus (A/Atlanta/211/1989(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY113399.1 Influenza A virus (A/Stockholm/12/1988(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY113375.1 Influenza A virus (A/Atlanta/3572/1988(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY113367.1 Influenza A virus (A/Shanghai/11/1987(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY112967.1 Influenza A virus (A/Netherlands/88/2003(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY112951.1 Influenza A virus (A/Netherlands/20/2003(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY112943.1 Influenza A virus (A/Netherlands/1/2002(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY112927.1 Influenza A virus (A/Netherlands/118/2001(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY112919.1 Influenza A virus (A/Panama/2007/1999(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY112911.1 Influenza A virus (A/Moscow/10/1999(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY112903.1 Influenza A virus (A/Netherlands/427/1998(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY112895.1 Influenza A virus (A/Netherlands/414/1998(H3N2)) neuraminidase (NA) gene, complete cds >gb|CY118604.1| Influenza A virus (A/Malaysia/17230/1998(H3N2)) neuraminidase (NA) gene, complete cds >gb|CY118636.1| Influenza A virus (A/Malaysia/10759/1999(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY112887.1 Influenza A virus (A/Sydney/5/1997(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY112879.1 Influenza A virus (A/Oslo/2352/1993(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY112863.1 Influenza A virus (A/Nice/491/1996(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY112847.1 Influenza A virus (A/Hong Kong/280/1997(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY112831.1 Influenza A virus (A/Singapore/1/1996(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY112823.1 Influenza A virus (A/Wuhan/359/1995(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY112815.1 Influenza A virus (A/Victoria/75/1995(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY112807.1 Influenza A virus (A/Stockholm/5/1995(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY112799.1 Influenza A virus (A/Netherlands/271/1995(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY112791.1 Influenza A virus (A/Nanchang/933/1995(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY112775.1 Influenza A virus (A/Hong Kong/38/1995(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY112767.1 Influenza A virus (A/Hong Kong/32/1995(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY112759.1 Influenza A virus (A/South Austalia/25/1994(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY112751.1 Influenza A virus (A/South Austalia/15/1994(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY112743.1 Influenza A virus (A/Johannesburg/47/1994(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY112735.1 Influenza A virus (A/Johannesburg/33/1994(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY112727.1 Influenza A virus (A/Hong Kong/55/1994(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY112719.1 Influenza A virus (A/Hong Kong/2/1994(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY112711.1 Influenza A virus (A/Hong Kong/1/1994(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY112703.1 Influenza A virus (A/England/7/1994(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY112695.1 Influenza A virus (A/Yamagata/62/1993(H3N2)) neuraminidase (NA) gene, complete cds >gb|CY114135.1| Influenza A virus (A/Yamagata/56/1993(H3N2)) neuraminidase (NA) gene, complete cds >gb|CY114143.1| Influenza A virus (A/Yamagata/61/1993(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY112679.1 Influenza A virus (A/Victoria/104/1993(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY112671.1 Influenza A virus (A/Stockholm/20/1993(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY112663.1 Influenza A virus (A/Singapore/19/1993(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY112655.1 Influenza A virus (A/Shiga/6/1993(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY112639.1 Influenza A virus (A/Oslo/2219/1993(H3N2)) neuraminidase (NA) gene, complete cds >gb|CY112687.1| Influenza A virus (A/Wellington/59/1993(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY112623.1 Influenza A virus (A/Netherlands/371/1993(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY112615.1 Influenza A virus (A/Netherlands/241/1993(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY112607.1 Influenza A virus (A/Netherlands/179/1993(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY112599.1 Influenza A virus (A/Netherlands/115/1993(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY112583.1 Influenza A virus (A/Netherlands/3/1992(H3N2)) neuraminidase (NA) gene, complete cds >gb|CY112591.1| Influenza A virus (A/Netherlands/17/1993(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY112575.1 Influenza A virus (A/Madrid/G130/1993(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY112567.1 Influenza A virus (A/Madrid/G102/1993(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY112558.1 Influenza A virus (A/Lyon/22686/1993(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY112550.1 Influenza A virus (A/Lyon/1803/1993(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY112542.1 Influenza A virus (A/Victoria/33/1992(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY112534.1 Influenza A virus (A/Stockholm/8/1992(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY112526.1 Influenza A virus (A/South Austalia/8/1992(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY112518.1 Influenza A virus (A/Sendai/C273/1992(H3N2)) neuraminidase (NA) gene, complete cds >gb|CY113911.1| Influenza A virus (A/Stockholm/12/1992(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY112510.1 Influenza A virus (A/Rotterdam/100540/1992(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY112502.1 Influenza A virus (A/Paris/490/1991(H3N2)) neuraminidase (NA) gene, complete cds >gb|CY113575.1| Influenza A virus (A/Lyon/1149/1991(H3N2)) neuraminidase (NA) gene, complete cds >gb|CY113695.1| Influenza A virus (A/Houston/56798/1992(H3N2)) neuraminidase (NA) gene, complete cds >gb|CY113703.1| Influenza A virus (A/Houston/56829/1992(H3N2)) neuraminidase (NA) gene, complete cds >gb|CY113711.1| Influenza A virus (A/Houston/56941/1992(H3N2)) neuraminidase (NA) gene, complete cds >gb|CY113735.1| Influenza A virus (A/Netherlands/823/1992(H3N2)) neuraminidase (NA) gene, complete cds >gb|CY113759.1| Influenza A virus (A/Nijmegen/3126/1992(H3N2)) neuraminidase (NA) gene, complete cds >gb|CY113783.1| Influenza A virus (A/Paris/320/1991(H3N2)) neuraminidase (NA) gene, complete cds >gb|CY113807.1| Influenza A virus (A/Paris/417/1991(H3N2)) neuraminidase (NA) gene, complete cds >gb|CY113815.1| Influenza A virus (A/Paris/424/1991(H3N2)) neuraminidase (NA) gene, complete cds >gb|CY113823.1| Influenza A virus (A/Paris/457/1991(H3N2)) neuraminidase (NA) gene, complete cds >gb|CY113839.1| Influenza A virus (A/Paris/512/1991(H3N2)) neuraminidase (NA) gene, complete cds >gb|CY113855.1| Influenza A virus (A/Paris/564/1991(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY112494.1 Influenza A virus (A/Finland/247/1992(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY112486.1 Influenza A virus (A/Finland/220/1992(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY112478.1 Influenza A virus (A/Finland/218/1992(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY112470.1 Influenza A virus (A/Enschede/1285/1992(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY112462.1 Influenza A virus (A/Amsterdam/4112/1992(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY112454.1 Influenza A virus (A/Stockholm/20/1991(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY112446.1 Influenza A virus (A/Geneva/6447/1991(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY112438.1 Influenza A virus (A/Singapore/53/1989(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY112422.1 Influenza A virus (A/Geneva/5007/1989(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY112406.1 Influenza A virus (A/Beijing/352/1989(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY112398.1 Influenza A virus (A/Sichuan/2/1987(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY016222.1 Influenza A virus (A/Western Australia/33/2002(H3N2)) 28.2 28.2 100% 1.8 100%
CY111524.1 Influenza A virus (A/Western Australia/6/2000(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JQ689102.1 Influenza A virus (A/swine/Illinois/A01047529/2010(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JQ689118.1 Influenza A virus (A/swine/Missouri/A01047969/2010(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JQ689110.1 Influenza A virus (A/swine/Missouri/A01047968/2010(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JQ689150.1 Influenza A virus (A/swine/Iowa/A01202088/2011(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JQ689158.1 Influenza A virus (A/swine/Illinois/A01047183/2010(H3N2)) segment 6 neuraminidase (NA) gene, complete cds >gb|JQ689086.1| Influenza A virus (A/swine/Illinois/A01047188/2010(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JQ689161.1 Influenza A virus (A/swine/Illinois/A01047528/2010(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JQ689164.1 Influenza A virus (A/swine/Indiana/A01049349/2010(H3N2)) segment 6 neuraminidase (NA) gene, complete cds >gb|JX080651.1| Influenza A virus (A/swine/Indiana/A01049349/2010(H1N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY107180.1 Influenza A virus (A/England/584/2003(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY107132.1 Influenza A virus (A/England/484/2003(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY107116.1 Influenza A virus (A/England/516/2003(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY107108.1 Influenza A virus (A/England/786/2003(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY107092.1 Influenza A virus (A/Scotland/79/2003(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY107084.1 Influenza A virus (A/England/754/2003(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY088477.1 Influenza A virus (A/England/4024313/2003(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY088440.1 Influenza A virus (A/England/584/2003(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY088408.1 Influenza A virus (A/England/547/2003(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY088400.1 Influenza A virus (A/England/909/2003(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY088360.1 Influenza A virus (A/England/805/2003(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY088352.1 Influenza A virus (A/England/567/2003(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY088328.1 Influenza A virus (A/England/508/2003(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY088272.1 Influenza A virus (A/England/585/2003(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY088264.1 Influenza A virus (A/England/484/2003(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY088216.1 Influenza A virus (A/England/787/2003(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY088200.1 Influenza A virus (A/England/516/2003(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY088168.1 Influenza A virus (A/England/786/2003(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY088144.1 Influenza A virus (A/Scotland/79/2003(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY088136.1 Influenza A virus (A/Scotland/78/2003(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY088096.1 Influenza A virus (A/Scotland/71/2003(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY088088.1 Influenza A virus (A/England/460/2003(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY088080.1 Influenza A virus (A/England/754/2003(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY088048.1 Influenza A virus (A/Scotland/61/2003(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY088040.1 Influenza A virus (A/England/438/2003(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY088016.1 Influenza A virus (A/England/419/2003(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY088008.1 Influenza A virus (A/Scotland/50/2003(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY110761.1 Influenza A virus (A/Kunming/1-Va10/2005(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JQ398765.1 Influenza A virus (A/swine/Iowa/A01202693/2011(H1N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY107068.1 Influenza A virus (A/swine/Illinois/A01201606/2011(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY107060.1 Influenza A virus (A/swine/Minnesota/A01076218/2010(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY107053.1 Influenza A virus (A/swine/North Carolina/A01076212/2010(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY107045.1 Influenza A virus (A/swine/North Carolina/A01076204/2010(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY107030.1 Influenza A virus (A/swine/Minnesota/A01076196/2010(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
EU735828.2 Influenza A virus (A/turkey/North Carolina/353568/2005(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
EU735820.2 Influenza A virus (A/turkey/Ohio/313053/2004(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
EU697211.2 Influenza A virus (A/turkey/North Carolina/353568/2005(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JN706702.1 Influenza A virus (A/turkey/Ontario/FAV-10/2011(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JN683631.1 Influenza A virus (A/turkey/Ontario/FAV-9/2011(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JN683639.1 Influenza A virus (A/turkey/Ontario/FAV-3/2011(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JQ290163.1 Influenza A virus (A/West Virginia/06/2011(H3N2)) segment 6 neuraminidase (NA) gene, partial cds 28.2 28.2 100% 1.8 100%
JN409441.1 Influenza A virus (A/swine/Kansas/11-110529/2011(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY100302.1 Influenza A virus (A/Hong Kong/HKU83/2004(H3N2)) neuraminidase (NA) gene, partial cds 28.2 28.2 100% 1.8 100%
CY100262.1 Influenza A virus (A/Hong Kong/HKU119/2004(H3N2)) neuraminidase (NA) gene, partial cds 28.2 28.2 100% 1.8 100%
CY100246.1 Influenza A virus (A/Hong Kong/HKU117/2004(H3N2)) neuraminidase (NA) gene, partial cds 28.2 28.2 100% 1.8 100%
JN652444.1 Influenza A virus (A/swine/Nebraska/A01049648/2011(H1N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JN652440.1 Influenza A virus (A/swine/Iowa/A01049643/2011(H1N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JN652442.1 Influenza A virus (A/swine/Iowa/A01049645/2011(H1N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JN652430.1 Influenza A virus (A/swine/Oklahoma/A01049500/2011(H1N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JN652545.1 Influenza A virus (A/swine/Nebraska/A01049937/2011(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JN652544.1 Influenza A virus (A/swine/Minnesota/A01049936/2011(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JN652543.1 Influenza A virus (A/swine/Arkansas/A01049917/2011(H1N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY009854.3 Influenza A virus (A/Canterbury/146/2001(H3N2)) segment 6, complete sequence 28.2 28.2 100% 1.8 100%
CY009582.3 Influenza A virus (A/Canterbury/50/2001(H3N2)) segment 6, complete sequence 28.2 28.2 100% 1.8 100%
CY009574.3 Influenza A virus (A/Canterbury/43/2001(H3N2)) segment 6, complete sequence 28.2 28.2 100% 1.8 100%
CY099249.1 Influenza A virus (A/swine/Minnesota/00484/2005(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY099217.1 Influenza A virus (A/swine/Minnesota/001444/2007(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY099209.1 Influenza A virus (A/swine/Minnesota/02324/2008(H1N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY099177.1 Influenza A virus (A/swine/Minnesota/SG1133/2008(H1N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY099145.1 Influenza A virus (A/swine/Minnesota/00611/2005(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY099129.1 Influenza A virus (A/swine/Indiana/00427/2004(H1N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY099113.1 Influenza A virus (A/swine/Minnesota/01862/2007(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY099105.1 Influenza A virus (A/swine/Minnesota/02782/2009(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY099088.1 Influenza A virus (A/swine/Nebraska/00722/2005(mixed)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY099063.1 Influenza A virus (A/swine/Minnesota/00709/2005(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY099054.1 Influenza A virus (A/swine/Illinois/02450/2008(mixed)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY099029.1 Influenza A virus (A/swine/Iowa/01700/2007(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY099018.1 Influenza A virus (A/swine/Kentucky/SG1118/2003(mixed)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JN617985.1 Influenza A virus (A/Thailand/Siriraj-08/1998(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JN584212.1 Influenza A virus (A/swine/Quebec/1267566/2011(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JN584204.1 Influenza A virus (A/swine/Quebec/1257777/2010(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JN584196.1 Influenza A virus (A/swine/Quebec/1257774/2010(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JN584180.1 Influenza A virus (A/swine/Quebec/1262080/2010(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
HM996957.1 Influenza A virus (A/swine/Italy/4675/2003(H1N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JN584188.1 Influenza A virus (A/swine/Quebec/1267568/2010(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY096861.1 Influenza A virus (A/Memphis/3/1988(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY096829.1 Influenza A virus (A/X-133(X-31B-Shenzhen/227/1995)(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JN162016.1 Influenza A virus (A/swine/Minnesota/A01049346/2010(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JN162015.1 Influenza A virus (A/swine/Iowa/A01049317/2010(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JN162014.1 Influenza A virus (A/swine/Pennsylvania/A01049256/2010(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JN162013.1 Influenza A virus (A/swine/Iowa/A01049254/2010(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JN162008.1 Influenza A virus (A/swine/Nebraska/A01049235/2010(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JN162007.1 Influenza A virus (A/swine/Iowa/A01049228/2010(H1N2)) segment 6 neuraminidase (NA) gene, complete cds >gb|JX080648.1| Influenza A virus (A/swine/Iowa/A01049227/2010(H1N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY092326.1 Influenza A virus (A/swine/Argentina/CIP051-A2/2008(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY092211.1 Influenza A virus (A/Georgia/NHRC0001/2003(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY092203.1 Influenza A virus (A/Illinois/NHRC0001/2003(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY092110.1 Influenza A virus (A/Illinois/NHRC0001/2004(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JF972566.1 Influenza A virus (A/Denmark/12/2002(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY091463.1 Influenza A virus (A/California/NHRC0006/2003(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY091303.1 Influenza A virus (A/Australia/NHRC0002/2003(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY091295.1 Influenza A virus (A/Australia/NHRC0003/2003(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY091287.1 Influenza A virus (A/Australia/NHRC0006/2003(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY091279.1 Influenza A virus (A/Australia/NHRC0008/2003(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY091271.1 Influenza A virus (A/Australia/NHRC0009/2003(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY091207.1 Influenza A virus (A/Australia/NHRC0010/2003(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY091199.1 Influenza A virus (A/Australia/NHRC0007/2003(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY091191.1 Influenza A virus (A/Australia/NHRC0004/2003(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY091183.1 Influenza A virus (A/Australia/NHRC0001/2003(H3N2)) neuraminidase (NA) gene, complete cds >gb|CY092227.1| Influenza A virus (A/Australia/NHRC0005/2003(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY091119.1 Influenza A virus (A/Missouri/NHRC0002/2004(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY091103.1 Influenza A virus (A/Texas/NHRC0001/2002(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY091095.1 Influenza A virus (A/Missouri/NHRC0001/2002(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY090975.1 Influenza A virus (A/Georgia/NHRC0001/2004(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY090967.1 Influenza A virus (A/New Jersey/NHRC0001/2003(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Wed Jul 11, 2012 2:15 pm 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
T81C / A87G combination at Genbank (partial list)

CY124840.1 Influenza A virus (A/swine/Pennsylvania/A01076501/2010(H3N2)) neuraminidase (NA) gene, partial cds 28.2 28.2 100% 1.8 100%
CY124831.1 Influenza A virus (A/swine/Ohio/9/2012(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JX138511.1 Influenza A virus (A/swine/Zhejiang/01/2008(H1N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY116594.1 Influenza A virus (A/Netherlands/399/1993(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY116590.1 Influenza A virus (A/Netherlands/178/1995(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY116588.1 Influenza A virus (A/Leningrad/360/1986(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY116585.1 Influenza A virus (A/Guizhou/54/1989(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY116583.1 Influenza A virus (A/England/261/1991(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY116582.1 Influenza A virus (A/Eindhoven/3447/1989(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY116579.1 Influenza A virus (A/Christ Church/2/1988(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY116574.1 Influenza A virus (A/Bilthoven/2271/1976(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY116573.1 Influenza A virus (A/Bilthoven/16190/1968(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY115051.1 Influenza A virus (A/swine/Minnesota/A01134597/2010(H1N2)) neuraminidase (NA) gene, partial cds 28.2 28.2 100% 1.8 100%
CY115023.1 Influenza A virus (A/swine/Minnesota/A01047973/2011(H1N2)) neuraminidase (NA) gene, partial cds 28.2 28.2 100% 1.8 100%
CY114989.1 Influenza A virus (A/swine/Minnesota/A01134468/2011(H1N2)) neuraminidase (NA) gene, partial cds 28.2 28.2 100% 1.8 100%
CY114885.1 Influenza A virus (A/swine/Illinois/A01116190/2011(H3N2)) neuraminidase (NA) gene, partial cds 28.2 28.2 100% 1.8 100%
CY114858.1 Influenza A virus (A/swine/Minnesota/A01201895/2011(H3N2)) neuraminidase (NA) gene, partial cds 28.2 28.2 100% 1.8 100%
CY114850.1 Influenza A virus (A/swine/Illinois/A01201631/2011(H3N2)) neuraminidase (NA) gene, partial cds 28.2 28.2 100% 1.8 100%
CY114847.1 Influenza A virus (A/swine/Illinois/A01201629/2011(H3N2)) neuraminidase (NA) gene, partial cds 28.2 28.2 100% 1.8 100%
CY114841.1 Influenza A virus (A/swine/Illinois/A01201606/2011(H3N2)) neuraminidase (NA) gene, partial cds 28.2 28.2 100% 1.8 100%
CY114808.1 Influenza A virus (A/swine/Minnesota/A01201297/2011(H1N2)) neuraminidase (NA) gene, partial cds 28.2 28.2 100% 1.8 100%
CY114717.1 Influenza A virus (A/swine/North Carolina/A01076184/2010(H1N2)) neuraminidase (NA) gene, partial cds 28.2 28.2 100% 1.8 100%
CY114632.1 Influenza A virus (A/swine/Illinois/A01047079/2010(H1N2)) neuraminidase (NA) gene, partial cds 28.2 28.2 100% 1.8 100%
CY114625.1 Influenza A virus (A/swine/Illinois/A01047048/2010(H1N2)) neuraminidase (NA) gene, partial cds 28.2 28.2 100% 1.8 100%
CY114601.1 Influenza A virus (A/swine/Illinois/A01076954/2010(H1N2)) neuraminidase (NA) gene, partial cds 28.2 28.2 100% 1.8 100%
CY114593.1 Influenza A virus (A/swine/Minnesota/A01201424/2010(H3N2)) neuraminidase (NA) gene, partial cds 28.2 28.2 100% 1.8 100%
CY114579.1 Influenza A virus (A/swine/Minnesota/A01076335/2010(H1N2)) neuraminidase (NA) gene, partial cds >gb|CY114758.1| Influenza A virus (A/swine/Minnesota/A01076326/2010(H1N2)) neuraminidase (NA) gene, partial cds 28.2 28.2 100% 1.8 100%
JX122445.1 Influenza A virus (A/swine/Minnesota/A01076197/2010(H1N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JX122440.1 Influenza A virus (A/swine/Minnesota/A01076193/2010(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY122317.1 Influenza A virus (A/Memphis/8/2003(H1N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY122053.1 Influenza A virus (A/swine/Minnesota/2/2012(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JX092599.1 Influenza A virus (A/swine/Iowa/A01203194/2012(H1N2)) segment 6 neuraminidase (NA) gene, complete cds >gb|JX092600.1| Influenza A virus (A/swine/Iowa/A01203195/2012(H1N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JX092596.1 Influenza A virus (A/swine/Iowa/A01203153/2012(H1N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JX092581.1 Influenza A virus (A/swine/Iowa/A01202905/2011(H3N2)) segment 6 neuraminidase (NA) gene, complete cds >gb|JX092582.1| Influenza A virus (A/swine/Iowa/A01202906/2011(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JX092579.1 Influenza A virus (A/swine/Iowa/A01202889/2011(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JX092483.1 Influenza A virus (A/swine/Iowa/A01202809/2011(H1N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JX092479.1 Influenza A virus (A/swine/Iowa/A01202797/2011(H1N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JX092475.1 Influenza A virus (A/swine/Iowa/A01202786/2011(H1N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JX092472.1 Influenza A virus (A/swine/Iowa/A01202774/2011(H1N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JX092466.1 Influenza A virus (A/swine/Iowa/A01202742/2011(H1N2)) segment 6 neuraminidase (NA) gene, complete cds >gb|JX092467.1| Influenza A virus (A/swine/Iowa/A01202743/2011(H1N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JX092458.1 Influenza A virus (A/swine/Iowa/A01202671/2011(H1N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JX092455.1 Influenza A virus (A/swine/Michigan/A01202655/2011(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JX092357.1 Influenza A virus (A/swine/Iowa/A01202614/2011(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JX092356.1 Influenza A virus (A/swine/Iowa/A01202613/2011(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JX092355.1 Influenza A virus (A/swine/Iowa/A01202612/2011(H1N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JX092351.1 Influenza A virus (A/swine/Iowa/A01202581/2011(H1N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JX092343.1 Influenza A virus (A/swine/Oklahoma/A01202498/2011(H1N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JX092339.1 Influenza A virus (A/swine/Iowa/A01202455/2011(H1N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JX092337.1 Influenza A virus (A/swine/Minnesota/A01202453/2011(H1N2)) segment 6 neuraminidase (NA) gene, complete cds >gb|JX092338.1| Influenza A virus (A/swine/Minnesota/A01202454/2011(H1N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JX092329.1 Influenza A virus (A/swine/Oklahoma/A01202415/2011(H1N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JX092328.1 Influenza A virus (A/swine/Oklahoma/A01202413/2011(H1N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JX092327.1 Influenza A virus (A/swine/Iowa/A01202411/2011(H1N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JX092326.1 Influenza A virus (A/swine/Indiana/A01202298/2011(H1N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JX092318.1 Influenza A virus (A/swine/Iowa/A01202083/2011(H1N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JX080661.1 Influenza A virus (A/swine/Iowa/A01049020/2010(mixed)) clone N2 segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JX080657.1 Influenza A virus (A/swine/Iowa/A01049694/2011(mixed)) clone N2 segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JX080655.1 Influenza A virus (A/swine/Iowa/A01049661/2011(H1N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JX080649.1 Influenza A virus (A/swine/Iowa/A01049263/2010(H1N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JX080645.1 Influenza A virus (A/swine/Iowa/A01049119/2010(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JX080644.1 Influenza A virus (A/swine/Iowa/A01049000/2010(H1N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JX080584.1 Influenza A virus (A/swine/Iowa/A01203463/2012(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JX080583.1 Influenza A virus (A/swine/Iowa/A01203459/2012(H3N2)) segment 6 neuraminidase (NA) gene, complete cds >gb|JX080587.1| Influenza A virus (A/swine/Iowa/A01243311/2012(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JX080561.1 Influenza A virus (A/swine/Iowa/A01203304/2012(H3N2)) segment 6 neuraminidase (NA) gene, complete cds >gb|JX092589.1| Influenza A virus (A/swine/Iowa/A01203104/2011(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY121474.1 Influenza A virus (A/reassortant/NYMC X-153A(Texas/40/2003 x Puerto Rico/8/1934)(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY121434.1 Influenza A virus (A/reassortant/X-145(California/32/1999 x Puerto Rico/8/1934)(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY121426.1 Influenza A virus (A/California/32/1999(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY121418.1 Influenza A virus (A/reassortant/X-143(Ulan Ude/01/2000 x Puerto Rico/8/1934)(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY121410.1 Influenza A virus (A/Ulan Ude/01/2000(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY121402.1 Influenza A virus (A/reassortant/X-141(Panama/2007/1999 x Puerto Rico/8/1934)(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY121383.1 Influenza A virus (A/reassortant/X-137(Moscow/10/1999 x Puerto Rico/8/1934)(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY121375.1 Influenza A virus (A/Moscow/10/1999(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY121367.1 Influenza A virus (A/reassortant/X-129(South Africa/1147/1996 x Puerto Rico/8/1934)(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY121359.1 Influenza A virus (A/South Africa/1147/1996(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY121351.1 Influenza A virus (A/reassortant/X-123A(Johannesburg/33/1994 x Puerto Rico/8/1934)(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY121343.1 Influenza A virus (A/Johannesburg/33/1994(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY121335.1 Influenza A virus (A/reassortant/X-121(Shangdong/9/1993 x Puerto Rico/8/1934)(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY121311.1 Influenza A virus (A/Shanghai/11/1987(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY121303.1 Influenza A virus (A/reassortant/X-97(Sichuan/2/1987 x Puerto Rico/8/1934)(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY121295.1 Influenza A virus (A/Sichuan/2/1987(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY121279.1 Influenza A virus (A/Leningrad/360/1986(H3N2)) neuraminidase (NA) gene, complete cds >gb|CY121287.1| Influenza A virus (A/reassortant/X-91(Leningrad/360/1986 x Puerto Rico/8/1934)(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY121255.1 Influenza A virus (A/reassortant/X-79(Philippines/2/1982 x Puerto Rico/8/1934)(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY121247.1 Influenza A virus (A/Philippines/2/1982(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY121231.1 Influenza A virus (A/reassortant/X-61(Texas/1/1977 x Puerto Rico/8/1934)(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY121207.1 Influenza A virus (A/reassortant/X-47(Victoria/3/1975 x Puerto Rico/8/1934)(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY121199.1 Influenza A virus (A/Victoria/3/1975(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY121191.1 Influenza A virus (A/reassortant/X-41(Port Chalmers/1/1973 x Puerto Rico/8/1934)(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY121183.1 Influenza A virus (A/Port Chalmers/1/1973(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY121175.1 Influenza A virus (A/reassortant/X-37a(England/42-MRC-2/1972 x Puerto Rico/8/1934)(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY121167.1 Influenza A virus (A/reassortant/X-37(England/42/1972 x Puerto Rico/8/1934)(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY121159.1 Influenza A virus (A/England/42/1972(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY121119.1 Influenza A virus (A/Aichi/2/1968(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY121034.1 Influenza A virus (A/reassortant/X-119(Harbin/15/1992 x Puerto Rico/8/1934)(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY121026.1 Influenza A virus (A/Beijing/353/1989(H3N2)) neuraminidase (NA) gene, complete cds >gb|CY121319.1| Influenza A virus (A/reassortant/X-109(Beijing/353/1989 x Puerto Rico/8/1934)(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY121018.1 Influenza A virus (A/reassortant/X-99(Shanghai/11/1987 x Puerto Rico/8/1934)(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY121010.1 Influenza A virus (A/reassortant/X-73(Bangkok/1/1979 x Puerto Rico/8/1934)(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY120994.1 Influenza A virus (A/Texas/1/1977(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JX048064.1 Influenza A virus (A/swine/Illinois/A01201633/2011(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JX048052.1 Influenza A virus (A/swine/Minnesota/A01076531/2010(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JX048051.1 Influenza A virus (A/swine/Iowa/A01076508/2010(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JX048050.1 Influenza A virus (A/swine/Iowa/A01076507/2010(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JX048046.1 Influenza A virus (A/swine/North Carolina/A01076206/2010(H1N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JX048045.1 Influenza A virus (A/swine/North Carolina/A01076202/2010(H1N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JX048035.1 Influenza A virus (A/swine/Illinois/A01076121/2010(H1N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY041849.2 Influenza A virus (A/swine/North Carolina/R08-001877-D08-013371/2008 (H3N2)) segment 6 sequence 28.2 28.2 100% 1.8 100%
CY118676.1 Influenza A virus (A/Malaysia/25920/2003(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY118668.1 Influenza A virus (A/Malaysia/25849/2003(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY118652.1 Influenza A virus (A/Malaysia/18128/1998(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY118644.1 Influenza A virus (A/Malaysia/18121/1998(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY118628.1 Influenza A virus (A/Malaysia/17998/1998(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY118620.1 Influenza A virus (A/Malaysia/17392/1998(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY118612.1 Influenza A virus (A/Malaysia/17332/1998(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY118596.1 Influenza A virus (A/Malaysia/13246/1997(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY118580.1 Influenza A virus (A/Malaysia/13002/1997(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY118572.1 Influenza A virus (A/Malaysia/12990/1997(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY118564.1 Influenza A virus (A/Malaysia/12974/1997(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY118556.1 Influenza A virus (A/Malaysia/12942/1997(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY118548.1 Influenza A virus (A/Malaysia/12904/1997(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY118524.1 Influenza A virus (A/Malaysia/12550/1997(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY118516.1 Influenza A virus (A/Malaysia/12132/1997(H3N2)) neuraminidase (NA) gene, complete cds >gb|CY119084.1| Influenza A virus (A/Malaysia/12106/1997(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY118500.1 Influenza A virus (A/Malaysia/10997/1996(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY118492.1 Influenza A virus (A/Malaysia/10969/1996(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY118484.1 Influenza A virus (A/Malaysia/10877/1996(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY118476.1 Influenza A virus (A/Malaysia/10717/1996(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY118468.1 Influenza A virus (A/Malaysia/10807/1996(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY118460.1 Influenza A virus (A/Malaysia/10370/1996(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY118452.1 Influenza A virus (A/Malaysia/10360/1996(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY118436.1 Influenza A virus (A/Malaysia/07832/1995(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY118420.1 Influenza A virus (A/Malaysia/07145/1995(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JQ922360.1 Influenza A virus (A/swine/Minnesota/A01134341/2010(H1N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY118277.1 Influenza A virus (A/Malaysia/25750/2003(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY117990.1 Influenza A virus (A/Malaysia/29997/2004(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY117973.1 Influenza A virus (A/Malaysia/25890/2003(mixed)) neuraminidase (NA) gene, complete cds >gb|CY118684.1| Influenza A virus (A/Malaysia/25957/2003(H3N2)) neuraminidase (NA) gene, complete cds >gb|CY118692.1| Influenza A virus (A/Malaysia/26003/2003(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY117962.1 Influenza A virus (A/Malaysia/25804/2003(mixed)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY117889.1 Influenza A virus (A/Malaysia/23637/2002(mixed)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY117822.1 Influenza A virus (A/Malaysia/22387/2002(mixed)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY117810.1 Influenza A virus (A/Malaysia/13990/1997(mixed)) neuraminidase (NA) gene, partial cds 28.2 28.2 100% 1.8 100%
CY117802.1 Influenza A virus (A/Malaysia/13381/1997(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY117794.1 Influenza A virus (A/Malaysia/17276/1998(H3N2)) neuraminidase (NA) gene, partial cds 28.2 28.2 100% 1.8 100%
CY117786.1 Influenza A virus (A/Malaysia/14712/1997(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY117778.1 Influenza A virus (A/Malaysia/14590/1997(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY117770.1 Influenza A virus (A/Malaysia/13329/1997(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY117762.1 Influenza A virus (A/Malaysia/13328/1997(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY117754.1 Influenza A virus (A/Malaysia/13241/1997(H3N2)) neuraminidase (NA) gene, complete cds >gb|CY118532.1| Influenza A virus (A/Malaysia/12726/1997(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY117738.1 Influenza A virus (A/Malaysia/10970/1996(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY117730.1 Influenza A virus (A/Malaysia/10879/1996(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JQ906929.1 Influenza A virus (A/swine/North Carolina/A01076192/2010(H1N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JQ906928.1 Influenza A virus (A/swine/North Carolina/A01076185/2010(H1N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JQ906924.1 Influenza A virus (A/swine/Minnesota/A01134598/2010(H1N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JQ906921.1 Influenza A virus (A/swine/Minnesota/A01134357/2011(H1N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JQ906920.1 Influenza A virus (A/swine/Minnesota/A01134353/2011(H1N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JQ906914.1 Influenza A virus (A/swine/Minnesota/A01116140/2011(H1N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JQ906913.1 Influenza A virus (A/swine/Minnesota/A01076998/2010(H1N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JQ906912.1 Influenza A virus (A/swine/Minnesota/A01076764/2010(H1N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JQ906911.1 Influenza A virus (A/swine/Minnesota/A01076763/2010(H1N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JQ906910.1 Influenza A virus (A/swine/Minnesota/A01076626/2010(H1N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JQ906909.1 Influenza A virus (A/swine/Minnesota/A01076331/2010(H1N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JQ906908.1 Influenza A virus (A/swine/Minnesota/A01076210/2010(H1N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JQ906907.1 Influenza A virus (A/swine/Minnesota/A01076209/2010(H1N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JQ906906.1 Influenza A virus (A/swine/Minnesota/A01076205/2010(H1N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JQ906905.1 Influenza A virus (A/swine/Minnesota/A01047913/2010(H1N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JQ906903.1 Influenza A virus (A/swine/Kansas/A01076181/2009(H1N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JQ906899.1 Influenza A virus (A/swine/Indiana/A01076177/2009(H1N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JQ858438.1 Influenza A virus (A/swine/Illinois/A01076955/2010(H1N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JQ858434.1 Influenza A virus (A/swine/Illinois/A01076221/2010(H1N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JQ858435.1 Influenza A virus (A/swine/Illinois/A01076223/2010(H1N2)) segment 6 neuraminidase (NA) gene, complete cds >gb|JQ906901.1| Influenza A virus (A/swine/Iowa/A01076157/2010(H1N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JQ791014.1 Influenza A virus (A/swine/Minnesota/A01076999/2010(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JQ783103.1 Influenza A virus (A/swine/Minnesota/A01201894/2011(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JQ783101.1 Influenza A virus (A/swine/Pennsylvania/A01201666/2011(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JQ783100.1 Influenza A virus (A/swine/Minnesota/A01201437/2011(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JQ783098.1 Influenza A virus (A/swine/Nebraska/A01116980/2011(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JQ783097.1 Influenza A virus (A/swine/Minnesota/A01116200/2011(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JQ783096.1 Influenza A virus (A/swine/Minnesota/A01116195/2011(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JQ783094.1 Influenza A virus (A/swine/Minnesota/A01076701/2010(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JQ783090.1 Influenza A virus (A/swine/North Carolina/A01076214/2010(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JQ783089.1 Influenza A virus (A/swine/North Carolina/A01047914/2011(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JQ783087.1 Influenza A virus (A/swine/Iowa/A01047906/2010(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JQ756389.1 Influenza A virus (A/swine/Missouri/A01240017/2011(H3N2)) segment 6 neuraminidase (NA) gene, complete cds >gb|JQ922362.1| Influenza A virus (A/swine/Missouri/A01240016/2011(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JQ756388.1 Influenza A virus (A/swine/Minnesota/A01134337/2010(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JQ756354.1 Influenza A virus (A/swine/Illinois/A01047080/2010(H1N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JQ756353.1 Influenza A virus (A/swine/Illinois/A01047054/2010(H1N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JQ739710.1 Influenza A virus (A/swine/Iowa/A01203197/2012(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JQ739709.1 Influenza A virus (A/swine/Iowa/A01203196/2012(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY114495.1 Influenza A virus (A/Netherlands/301/1999(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY114487.1 Influenza A virus (A/Netherlands/5/1998(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY114479.1 Influenza A virus (A/Brisbane/8/1996(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY114471.1 Influenza A virus (A/United Kingdom/261/1991(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY114463.1 Influenza A virus (A/Beijing/353/1989(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY114455.1 Influenza A virus (A/Oklahoma/5/1988(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY114439.1 Influenza A virus (A/Netherlands/233/1982(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY114431.1 Influenza A virus (A/Bangkok/1/1979(H3N2)) neuraminidase (NA) gene, complete cds >gb|CY121002.1| Influenza A virus (A/Bangkok/1/1979(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY114367.1 Influenza A virus (A/Netherlands/312/2003(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY114351.1 Influenza A virus (A/Finland/170/2003(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY114343.1 Influenza A virus (A/Netherlands/120/2002(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY114335.1 Influenza A virus (A/Netherlands/126/2001(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY114327.1 Influenza A virus (A/Netherlands/124/2001(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY114319.1 Influenza A virus (A/Netherlands/3/2000(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY114311.1 Influenza A virus (A/Netherlands/462/1998(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY114303.1 Influenza A virus (A/Netherlands/300/1997(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY114295.1 Influenza A virus (A/Auckland/10/1997(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY114287.1 Influenza A virus (A/Netherlands/91/1996(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY114271.1 Influenza A virus (A/Hong Kong/434/1996(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY114263.1 Influenza A virus (A/Hong Kong/358/1996(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY114255.1 Influenza A virus (A/Hong Kong/357/1996(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY114247.1 Influenza A virus (A/Hong Kong/42/1996(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY114239.1 Influenza A virus (A/Hong Kong/20/1996(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY114223.1 Influenza A virus (A/Netherlands/1/1995(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY114215.1 Influenza A virus (A/Lyon/2279/1995(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY114207.1 Influenza A virus (A/Hong Kong/49/1995(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY114199.1 Influenza A virus (A/Hong Kong/3/1995(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY114191.1 Influenza A virus (A/Geneva/A9509/1995(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY114183.1 Influenza A virus (A/Finland/381/1995(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY114175.1 Influenza A virus (A/Finland/339/1995(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY114167.1 Influenza A virus (A/Finland/338/1995(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY114159.1 Influenza A virus (A/Netherlands/18/1994(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY114151.1 Influenza A virus (A/Hong Kong/56/1994(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY114119.1 Influenza A virus (A/Shangdong/9/1993(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY114111.1 Influenza A virus (A/Scotland/160/1993(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY114103.1 Influenza A virus (A/Scotland/142/1993(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY114095.1 Influenza A virus (A/Paris/287/1993(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY114087.1 Influenza A virus (A/Netherlands/398/1993(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY114079.1 Influenza A virus (A/Netherlands/372/1993(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY114071.1 Influenza A virus (A/Netherlands/357/1993(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY114063.1 Influenza A virus (A/Netherlands/165/1993(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY114055.1 Influenza A virus (A/Netherlands/126/1993(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY114047.1 Influenza A virus (A/Netherlands/101/1993(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY114015.1 Influenza A virus (A/Madrid/G101/1993(H3N2)) neuraminidase (NA) gene, complete cds >gb|CY114031.1| Influenza A virus (A/Madrid/G116/1993(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY114007.1 Influenza A virus (A/Madrid/G122/1993(H3N2)) neuraminidase (NA) gene, complete cds >gb|CY114023.1| Influenza A virus (A/Madrid/G109/1993(H3N2)) neuraminidase (NA) gene, complete cds >gb|CY114039.1| Influenza A virus (A/Madrid/G252/1993(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY113999.1 Influenza A virus (A/Lyon/23602/1993(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY113991.1 Influenza A virus (A/Lyon/1815/1993(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY113983.1 Influenza A virus (A/Lyon/672/1993(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY113975.1 Influenza A virus (A/Guangdong/25/1993(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY113967.1 Influenza A virus (A/Enschede/5458/1993(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY113959.1 Influenza A virus (A/Akita/4/1993(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY113951.1 Influenza A virus (A/Victoria/68/1992(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY113943.1 Influenza A virus (A/Umea/2000/1992(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY113935.1 Influenza A virus (A/Umea/1982/1992(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY113919.1 Influenza A virus (A/Stockholm/13/1992(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY113903.1 Influenza A virus (A/Stockholm/7/1992(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY113895.1 Influenza A virus (A/South Austalia/27/1992(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY113887.1 Influenza A virus (A/South Austalia/23/1992(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY113879.1 Influenza A virus (A/Paris/614/1992(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY113871.1 Influenza A virus (A/Paris/597/1991(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY113863.1 Influenza A virus (A/Paris/583/1992(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY113847.1 Influenza A virus (A/Paris/548/1991(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY113831.1 Influenza A virus (A/Paris/467/1991(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY113799.1 Influenza A virus (A/Paris/407/1991(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY113791.1 Influenza A virus (A/Paris/325/1991(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY113775.1 Influenza A virus (A/Oviedo/31/1991(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY113767.1 Influenza A virus (A/Nijmegen/3129/1992(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY113751.1 Influenza A virus (A/Netherlands/938/1991(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Wed Jul 11, 2012 2:43 pm 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
A105G at Genbank (partial)

JQ023764.1 Influenza A virus (A/swine/Minnesota/0745/2010(H1N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY124840.1 Influenza A virus (A/swine/Pennsylvania/A01076501/2010(H3N2)) neuraminidase (NA) gene, partial cds 28.2 28.2 100% 1.8 100%
CY124831.1 Influenza A virus (A/swine/Ohio/9/2012(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY115051.1 Influenza A virus (A/swine/Minnesota/A01134597/2010(H1N2)) neuraminidase (NA) gene, partial cds 28.2 28.2 100% 1.8 100%
CY115023.1 Influenza A virus (A/swine/Minnesota/A01047973/2011(H1N2)) neuraminidase (NA) gene, partial cds 28.2 28.2 100% 1.8 100%
CY114989.1 Influenza A virus (A/swine/Minnesota/A01134468/2011(H1N2)) neuraminidase (NA) gene, partial cds 28.2 28.2 100% 1.8 100%
CY114850.1 Influenza A virus (A/swine/Illinois/A01201631/2011(H3N2)) neuraminidase (NA) gene, partial cds 28.2 28.2 100% 1.8 100%
CY114847.1 Influenza A virus (A/swine/Illinois/A01201629/2011(H3N2)) neuraminidase (NA) gene, partial cds 28.2 28.2 100% 1.8 100%
CY114841.1 Influenza A virus (A/swine/Illinois/A01201606/2011(H3N2)) neuraminidase (NA) gene, partial cds 28.2 28.2 100% 1.8 100%
CY114808.1 Influenza A virus (A/swine/Minnesota/A01201297/2011(H1N2)) neuraminidase (NA) gene, partial cds 28.2 28.2 100% 1.8 100%
CY114593.1 Influenza A virus (A/swine/Minnesota/A01201424/2010(H3N2)) neuraminidase (NA) gene, partial cds 28.2 28.2 100% 1.8 100%
CY114579.1 Influenza A virus (A/swine/Minnesota/A01076335/2010(H1N2)) neuraminidase (NA) gene, partial cds >gb|CY114758.1| Influenza A virus (A/swine/Minnesota/A01076326/2010(H1N2)) neuraminidase (NA) gene, partial cds 28.2 28.2 100% 1.8 100%
JX122445.1 Influenza A virus (A/swine/Minnesota/A01076197/2010(H1N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JX122440.1 Influenza A virus (A/swine/Minnesota/A01076193/2010(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY122319.1 Influenza A virus (A/swine/South Dakota/3/2012(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY122053.1 Influenza A virus (A/swine/Minnesota/2/2012(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JX092599.1 Influenza A virus (A/swine/Iowa/A01203194/2012(H1N2)) segment 6 neuraminidase (NA) gene, complete cds >gb|JX092600.1| Influenza A virus (A/swine/Iowa/A01203195/2012(H1N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JX092579.1 Influenza A virus (A/swine/Iowa/A01202889/2011(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JX092573.1 Influenza A virus (A/swine/Indiana/A01202867/2011(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JX092572.1 Influenza A virus (A/swine/Indiana/A01202866/2011(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JX092472.1 Influenza A virus (A/swine/Iowa/A01202774/2011(H1N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JX092458.1 Influenza A virus (A/swine/Iowa/A01202671/2011(H1N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JX092357.1 Influenza A virus (A/swine/Iowa/A01202614/2011(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JX092356.1 Influenza A virus (A/swine/Iowa/A01202613/2011(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JX092355.1 Influenza A virus (A/swine/Iowa/A01202612/2011(H1N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JX092351.1 Influenza A virus (A/swine/Iowa/A01202581/2011(H1N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JX092343.1 Influenza A virus (A/swine/Oklahoma/A01202498/2011(H1N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JX092339.1 Influenza A virus (A/swine/Iowa/A01202455/2011(H1N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JX092337.1 Influenza A virus (A/swine/Minnesota/A01202453/2011(H1N2)) segment 6 neuraminidase (NA) gene, complete cds >gb|JX092338.1| Influenza A virus (A/swine/Minnesota/A01202454/2011(H1N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JX092329.1 Influenza A virus (A/swine/Oklahoma/A01202415/2011(H1N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JX092328.1 Influenza A virus (A/swine/Oklahoma/A01202413/2011(H1N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JX092327.1 Influenza A virus (A/swine/Iowa/A01202411/2011(H1N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JX080661.1 Influenza A virus (A/swine/Iowa/A01049020/2010(mixed)) clone N2 segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JX080655.1 Influenza A virus (A/swine/Iowa/A01049661/2011(H1N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JX080649.1 Influenza A virus (A/swine/Iowa/A01049263/2010(H1N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JX080644.1 Influenza A virus (A/swine/Iowa/A01049000/2010(H1N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY121474.1 Influenza A virus (A/reassortant/NYMC X-153A(Texas/40/2003 x Puerto Rico/8/1934)(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JX048064.1 Influenza A virus (A/swine/Illinois/A01201633/2011(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JX048057.1 Influenza A virus (A/swine/Illinois/A01076768/2010(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JX048054.1 Influenza A virus (A/swine/Illinois/A01076724/2010(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JX048051.1 Influenza A virus (A/swine/Iowa/A01076508/2010(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JX048050.1 Influenza A virus (A/swine/Iowa/A01076507/2010(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JX048035.1 Influenza A virus (A/swine/Illinois/A01076121/2010(H1N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY041849.2 Influenza A virus (A/swine/North Carolina/R08-001877-D08-013371/2008 (H3N2)) segment 6 sequence 28.2 28.2 100% 1.8 100%
CY118676.1 Influenza A virus (A/Malaysia/25920/2003(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY118668.1 Influenza A virus (A/Malaysia/25849/2003(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JQ922360.1 Influenza A virus (A/swine/Minnesota/A01134341/2010(H1N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY118277.1 Influenza A virus (A/Malaysia/25750/2003(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY117990.1 Influenza A virus (A/Malaysia/29997/2004(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY117973.1 Influenza A virus (A/Malaysia/25890/2003(mixed)) neuraminidase (NA) gene, complete cds >gb|CY118684.1| Influenza A virus (A/Malaysia/25957/2003(H3N2)) neuraminidase (NA) gene, complete cds >gb|CY118692.1| Influenza A virus (A/Malaysia/26003/2003(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY117962.1 Influenza A virus (A/Malaysia/25804/2003(mixed)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JQ906927.1 Influenza A virus (A/swine/Minnesota/A01201429/2011(H1N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JQ906924.1 Influenza A virus (A/swine/Minnesota/A01134598/2010(H1N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JQ906922.1 Influenza A virus (A/swine/Minnesota/A01134528/2010(H1N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JQ906921.1 Influenza A virus (A/swine/Minnesota/A01134357/2011(H1N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JQ906920.1 Influenza A virus (A/swine/Minnesota/A01134353/2011(H1N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JQ906915.1 Influenza A virus (A/swine/Minnesota/A01116285/2011(H1N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JQ906914.1 Influenza A virus (A/swine/Minnesota/A01116140/2011(H1N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JQ906913.1 Influenza A virus (A/swine/Minnesota/A01076998/2010(H1N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JQ906912.1 Influenza A virus (A/swine/Minnesota/A01076764/2010(H1N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JQ906911.1 Influenza A virus (A/swine/Minnesota/A01076763/2010(H1N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JQ906909.1 Influenza A virus (A/swine/Minnesota/A01076331/2010(H1N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JQ906908.1 Influenza A virus (A/swine/Minnesota/A01076210/2010(H1N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JQ906907.1 Influenza A virus (A/swine/Minnesota/A01076209/2010(H1N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JQ906906.1 Influenza A virus (A/swine/Minnesota/A01076205/2010(H1N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JQ906905.1 Influenza A virus (A/swine/Minnesota/A01047913/2010(H1N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JQ906902.1 Influenza A virus (A/swine/Iowa/A01076186/2010(H1N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JQ906900.1 Influenza A virus (A/swine/Iowa/A01076148/2010(H1N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JQ790998.1 Influenza A virus (A/swine/Illinois/A01047009/2010(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JQ791006.1 Influenza A virus (A/swine/Illinois/A01047014/2010(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JQ783102.1 Influenza A virus (A/swine/Illinois/A01201770/2011(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JQ783101.1 Influenza A virus (A/swine/Pennsylvania/A01201666/2011(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JQ783100.1 Influenza A virus (A/swine/Minnesota/A01201437/2011(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JQ783097.1 Influenza A virus (A/swine/Minnesota/A01116200/2011(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JQ783096.1 Influenza A virus (A/swine/Minnesota/A01116195/2011(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JQ783095.1 Influenza A virus (A/swine/Illinois/A01076859/2010(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JQ783093.1 Influenza A virus (A/swine/Iowa/A01076632/2010(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JQ783092.1 Influenza A virus (A/swine/Iowa/A01076630/2010(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JQ783091.1 Influenza A virus (A/swine/Iowa/A01076311/2010(H3N2)) segment 6 neuraminidase (NA) gene, complete cds >gb|JX048048.1| Influenza A virus (A/swine/Iowa/A01076309/2010(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JQ783090.1 Influenza A virus (A/swine/North Carolina/A01076214/2010(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JQ783089.1 Influenza A virus (A/swine/North Carolina/A01047914/2011(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JQ783087.1 Influenza A virus (A/swine/Iowa/A01047906/2010(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JQ756391.1 Influenza A virus (A/swine/Minnesota/A01240095/2011(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JQ756390.1 Influenza A virus (A/swine/Minnesota/A01240088/2011(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JQ756389.1 Influenza A virus (A/swine/Missouri/A01240017/2011(H3N2)) segment 6 neuraminidase (NA) gene, complete cds >gb|JQ922362.1| Influenza A virus (A/swine/Missouri/A01240016/2011(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JQ756387.1 Influenza A virus (A/swine/Illinois/A01076865/2010(H3N2)) segment 6 neuraminidase (NA) gene, complete cds >gb|JQ922347.1| Influenza A virus (A/swine/Illinois/A01076708/2010(H3N2)) segment 6 neuraminidase (NA) gene, complete cds >gb|JX048053.1| Influenza A virus (A/swine/Illinois/A01076709/2010(H3N2)) segment 6 neuraminidase (NA) gene, complete cds >gb|JX048055.1| Influenza A virus (A/swine/Illinois/A01076730/2010(H3N2)) segment 6 neuraminidase (NA) gene, complete cds >gb|JX048056.1| Influenza A virus (A/swine/Illinois/A01076735/2010(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JQ739710.1 Influenza A virus (A/swine/Iowa/A01203197/2012(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JQ739709.1 Influenza A virus (A/swine/Iowa/A01203196/2012(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JQ689094.1 Influenza A virus (A/swine/Minnesota/A01047396/2011(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JQ689102.1 Influenza A virus (A/swine/Illinois/A01047529/2010(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JQ689118.1 Influenza A virus (A/swine/Missouri/A01047969/2010(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JQ689110.1 Influenza A virus (A/swine/Missouri/A01047968/2010(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JQ689161.1 Influenza A virus (A/swine/Illinois/A01047528/2010(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY107180.1 Influenza A virus (A/England/584/2003(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY107164.1 Influenza A virus (A/England/528/2003(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY107140.1 Influenza A virus (A/England/492/2003(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY107124.1 Influenza A virus (A/England/788/2003(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY107100.1 Influenza A virus (A/England/470/2003(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY088467.1 Influenza A virus (A/England/602/2003(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY088459.1 Influenza A virus (A/England/593/2003(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY088451.1 Influenza A virus (A/England/592/2003(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY088440.1 Influenza A virus (A/England/584/2003(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY088416.1 Influenza A virus (A/England/552/2003(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY088392.1 Influenza A virus (A/England/522/2003(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY088376.1 Influenza A virus (A/England/534/2003(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY088352.1 Influenza A virus (A/England/567/2003(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY088344.1 Influenza A virus (A/England/957/2003(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY088336.1 Influenza A virus (A/England/568/2003(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY088328.1 Influenza A virus (A/England/508/2003(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY088320.1 Influenza A virus (A/England/485/2003(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY088312.1 Influenza A virus (A/England/528/2003(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY088288.1 Influenza A virus (A/England/492/2003(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY088272.1 Influenza A virus (A/England/585/2003(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY088256.1 Influenza A virus (A/England/525/2003(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY088248.1 Influenza A virus (A/England/789/2003(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY088240.1 Influenza A virus (A/England/788/2003(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY088232.1 Influenza A virus (A/England/531/2003(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY088216.1 Influenza A virus (A/England/787/2003(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY088208.1 Influenza A virus (A/England/518/2003(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY088176.1 Influenza A virus (A/England/539/2003(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY088160.1 Influenza A virus (A/England/470/2003(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY088152.1 Influenza A virus (A/Scotland/81/2003(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY088136.1 Influenza A virus (A/Scotland/78/2003(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY088128.1 Influenza A virus (A/Scotland/76/2003(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY088120.1 Influenza A virus (A/England/467/2003(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY088112.1 Influenza A virus (A/England/475/2003(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY088104.1 Influenza A virus (A/Scotland/72/2003(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY088096.1 Influenza A virus (A/Scotland/71/2003(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY088072.1 Influenza A virus (A/England/642/2003(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY088064.1 Influenza A virus (A/England/740/2003(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY088056.1 Influenza A virus (A/England/445/2003(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY088048.1 Influenza A virus (A/Scotland/61/2003(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY088024.1 Influenza A virus (A/England/442/2003(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY088008.1 Influenza A virus (A/Scotland/50/2003(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY087992.1 Influenza A virus (A/Scotland/52/2003(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JQ409335.1 Influenza A virus (A/ferret/Quebec/844/2011(H3N2)) segment 6 neuraminidase (NA) gene, partial cds 28.2 28.2 100% 1.8 100%
JQ398765.1 Influenza A virus (A/swine/Iowa/A01202693/2011(H1N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY107068.1 Influenza A virus (A/swine/Illinois/A01201606/2011(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY107060.1 Influenza A virus (A/swine/Minnesota/A01076218/2010(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY107053.1 Influenza A virus (A/swine/North Carolina/A01076212/2010(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY107045.1 Influenza A virus (A/swine/North Carolina/A01076204/2010(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY107037.1 Influenza A virus (A/swine/North Carolina/A01076199/2010(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY107030.1 Influenza A virus (A/swine/Minnesota/A01076196/2010(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY107022.1 Influenza A virus (A/swine/Indiana/A01076191/2010(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JQ350540.1 Influenza A virus (A/swine/Iowa/A01202709/2011(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY104142.1 Influenza A virus (A/HaNoi/HN30110/2004(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
EU735828.2 Influenza A virus (A/turkey/North Carolina/353568/2005(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
EU735820.2 Influenza A virus (A/turkey/Ohio/313053/2004(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
EU697211.2 Influenza A virus (A/turkey/North Carolina/353568/2005(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
EU697206.2 Influenza A virus (A/turkey/Minnesota/366767/2005(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JN706702.1 Influenza A virus (A/turkey/Ontario/FAV-10/2011(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JN683631.1 Influenza A virus (A/turkey/Ontario/FAV-9/2011(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JN683639.1 Influenza A virus (A/turkey/Ontario/FAV-3/2011(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JN409441.1 Influenza A virus (A/swine/Kansas/11-110529/2011(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY100302.1 Influenza A virus (A/Hong Kong/HKU83/2004(H3N2)) neuraminidase (NA) gene, partial cds 28.2 28.2 100% 1.8 100%
CY100262.1 Influenza A virus (A/Hong Kong/HKU119/2004(H3N2)) neuraminidase (NA) gene, partial cds 28.2 28.2 100% 1.8 100%
CY100246.1 Influenza A virus (A/Hong Kong/HKU117/2004(H3N2)) neuraminidase (NA) gene, partial cds 28.2 28.2 100% 1.8 100%
JN652444.1 Influenza A virus (A/swine/Nebraska/A01049648/2011(H1N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JN652545.1 Influenza A virus (A/swine/Nebraska/A01049937/2011(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JN652544.1 Influenza A virus (A/swine/Minnesota/A01049936/2011(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JN652543.1 Influenza A virus (A/swine/Arkansas/A01049917/2011(H1N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY099249.1 Influenza A virus (A/swine/Minnesota/00484/2005(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY099233.1 Influenza A virus (A/swine/Minnesota/001332/2006(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY099217.1 Influenza A virus (A/swine/Minnesota/001444/2007(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY099209.1 Influenza A virus (A/swine/Minnesota/02324/2008(H1N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY099145.1 Influenza A virus (A/swine/Minnesota/00611/2005(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY099113.1 Influenza A virus (A/swine/Minnesota/01862/2007(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY099105.1 Influenza A virus (A/swine/Minnesota/02782/2009(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY099088.1 Influenza A virus (A/swine/Nebraska/00722/2005(mixed)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY099063.1 Influenza A virus (A/swine/Minnesota/00709/2005(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY099054.1 Influenza A virus (A/swine/Illinois/02450/2008(mixed)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY099037.1 Influenza A virus (A/swine/Minnesota/01146/2006(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY099029.1 Influenza A virus (A/swine/Iowa/01700/2007(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JN584212.1 Influenza A virus (A/swine/Quebec/1267566/2011(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JN584204.1 Influenza A virus (A/swine/Quebec/1257777/2010(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JN584196.1 Influenza A virus (A/swine/Quebec/1257774/2010(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JN584180.1 Influenza A virus (A/swine/Quebec/1262080/2010(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JN162016.1 Influenza A virus (A/swine/Minnesota/A01049346/2010(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JN162015.1 Influenza A virus (A/swine/Iowa/A01049317/2010(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JN162008.1 Influenza A virus (A/swine/Nebraska/A01049235/2010(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY092211.1 Influenza A virus (A/Georgia/NHRC0001/2003(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY092203.1 Influenza A virus (A/Illinois/NHRC0001/2003(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY092110.1 Influenza A virus (A/Illinois/NHRC0001/2004(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY091463.1 Influenza A virus (A/California/NHRC0006/2003(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY091303.1 Influenza A virus (A/Australia/NHRC0002/2003(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY091295.1 Influenza A virus (A/Australia/NHRC0003/2003(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY091287.1 Influenza A virus (A/Australia/NHRC0006/2003(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY091279.1 Influenza A virus (A/Australia/NHRC0008/2003(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY091271.1 Influenza A virus (A/Australia/NHRC0009/2003(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY091207.1 Influenza A virus (A/Australia/NHRC0010/2003(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY091199.1 Influenza A virus (A/Australia/NHRC0007/2003(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY091191.1 Influenza A virus (A/Australia/NHRC0004/2003(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY091183.1 Influenza A virus (A/Australia/NHRC0001/2003(H3N2)) neuraminidase (NA) gene, complete cds >gb|CY092227.1| Influenza A virus (A/Australia/NHRC0005/2003(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY091119.1 Influenza A virus (A/Missouri/NHRC0002/2004(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY090975.1 Influenza A virus (A/Georgia/NHRC0001/2004(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY090967.1 Influenza A virus (A/New Jersey/NHRC0001/2003(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY090959.1 Influenza A virus (A/Texas/NHRC0001/2003(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY090951.1 Influenza A virus (A/South Carolina/NHRC0002/2003(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY090943.1 Influenza A virus (A/California/NHRC0001/2003(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY090935.1 Influenza A virus (A/Missouri/NHRC0001/2003(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY090927.1 Influenza A virus (A/South Carolina/NHRC0001/2003(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JF833357.1 Influenza A virus (A/swine/Iowa/A01049185/2010(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JF833354.1 Influenza A virus (A/swine/Illinois/A01049164/2010(H1N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JF833352.1 Influenza A virus (A/swine/Iowa/A01049160/2010(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JF833348.1 Influenza A virus (A/swine/Indiana/A01049124/2010(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JF833346.1 Influenza A virus (A/swine/Iowa/A01049113/2010(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JF812316.1 Influenza A virus (A/swine/Iowa/A01049112/2010(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JF812311.1 Influenza A virus (A/swine/North Carolina/A01049085/2010(H1N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JF812299.1 Influenza A virus (A/swine/Iowa/A01049034/2010(H3N2)) segment 6 neuraminidase (NA) gene, complete cds >gb|JQ689134.1| Influenza A virus (A/swine/Iowa/A01049036/2010(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JF812300.1 Influenza A virus (A/swine/Iowa/A01049035/2010(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JF733897.1 Influenza A virus (A/Yamagata/143/2005(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JF733889.1 Influenza A virus (A/Okayama/23/2004(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JF710730.1 Influenza A virus (A/Scotland/50/2003(H3N2)) segment 6 neuraminidase (NA) gene, partial cds 28.2 28.2 100% 1.8 100%
CY089405.1 Influenza A virus (A/swine/South Dakota/6/2011(H1N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY089402.1 Influenza A virus (A/swine/South Dakota/5/2011(H1N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
HQ825237.1 Influenza A virus (A/swine/QC/1840-2/2009(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
HQ825230.1 Influenza A virus (A/swine/QC/1698-5/2009(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
HQ825227.1 Influenza A virus (A/swine/QC/1698-4/2009(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
HQ825224.1 Influenza A virus (A/swine/QC/1698-2/2009(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
HQ825220.1 Influenza A virus (A/swine/QC/1698-1/2009(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
HQ825212.1 Influenza A virus (A/swine/QC/1685-5/2009(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
HQ825205.1 Influenza A virus (A/swine/QC/1685-1/2009(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
HQ825200.1 Influenza A virus (A/swine/QC/440-A/2009(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
HQ825192.1 Influenza A virus (A/swine/QC/382/2009(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
HQ825184.1 Influenza A virus (A/swine/QC/414/2009(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
HQ825176.1 Influenza A virus (A/quail/QC/FAV-10/2008(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
HQ825168.1 Influenza A virus (A/turkey/BC/1529-3/2005(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JF682719.1 Influenza A virus (A/swine/Quebec/1265553/2010(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY086930.1 Influenza A virus (A/swine/Minnesota/239106/2010(H1N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY086922.1 Influenza A virus (A/swine/Minnesota/239105/2009(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JF312077.1 Influenza A virus (A/swine/Illinois/A01057088/2010(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JF312076.1 Influenza A virus (A/swine/Illinois/A01057087/2010(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JF312075.1 Influenza A virus (A/swine/Iowa/A01057188/2010(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JF316645.1 Influenza A virus (A/swine/Pennsylvania/057108-1/2010(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
HQ734205.1 Influenza A virus (A/swine/Illinois/53612-7/2010(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
HQ734202.1 Influenza A virus (A/swine/Illinois/53612-6/2010(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
HQ734199.1 Influenza A virus (A/swine/Illinois/53612-5/2009(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
HQ734196.1 Influenza A virus (A/swine/Illinois/53612-4/2009(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
HQ734193.1 Influenza A virus (A/swine/Illinois/53612-3/2009(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
HQ734190.1 Influenza A virus (A/swine/Illinois/53612-2/2009(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
HQ424898.1 Influenza A virus (A/swine/Oklahoma/44837-5/2010(H1N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
HQ424889.1 Influenza A virus (A/swine/North Carolina/44837-2/2009(H1N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
HM461772.1 Influenza A virus (A/swine/Iowa/02039/2008(H1N2)) segment 6 neuraminidase (NA) gene, partial cds 28.2 28.2 100% 1.8 100%
FJ805572.1 Influenza A virus (A/Taiwan/295/2004(H3N2)) segment 6 neuraminidase (NA) gene, partial cds 28.2 28.2 100% 1.8 100%
CY064968.1 Influenza A virus (A/Okayama/23/2004(H3N2)) segment 6 sequence 28.2 28.2 100% 1.8 100%
GU480921.1 Influenza A virus (A/swine/SD/31813/2009(H1N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
FJ519969.1 Influenza A virus (A/swine/Minnesota/3236/2007(H1N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
FJ519966.1 Influenza A virus (A/swine/Minnesota/5947/2007(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
FJ519965.1 Influenza A virus (A/swine/Minnesota/1300/2007(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
FJ519964.1 Influenza A virus (A/swine/Minnesota/761/2007(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Wed Jul 11, 2012 5:39 pm 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
C372T at Genbank (partial list)

JQ023764.1 Influenza A virus (A/swine/Minnesota/0745/2010(H1N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY124840.1 Influenza A virus (A/swine/Pennsylvania/A01076501/2010(H3N2)) neuraminidase (NA) gene, partial cds 28.2 28.2 100% 1.8 100%
CY124834.1 Influenza A virus (A/swine/Ohio/7/2012(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY124831.1 Influenza A virus (A/swine/Ohio/9/2012(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY124502.1 Influenza A virus (A/Singapore/TT879/2011(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY124500.1 Influenza A virus (A/Singapore/TT869/2011(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY124498.1 Influenza A virus (A/Singapore/TT849/2011(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY124496.1 Influenza A virus (A/Singapore/TT837/2011(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY124494.1 Influenza A virus (A/Singapore/TT827/2011(H3N2)) neuraminidase (NA) gene, partial cds 28.2 28.2 100% 1.8 100%
CY124492.1 Influenza A virus (A/Singapore/TT816/2011(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY124490.1 Influenza A virus (A/Singapore/TT815/2011(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY124486.1 Influenza A virus (A/Singapore/TT787/2011(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY124482.1 Influenza A virus (A/Singapore/TT765/2011(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY124478.1 Influenza A virus (A/Singapore/TT740/2011(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY124476.1 Influenza A virus (A/Singapore/TT735/2011(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY124474.1 Influenza A virus (A/Singapore/TT728/2011(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY124470.1 Influenza A virus (A/Singapore/TT713/2011(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY124468.1 Influenza A virus (A/Singapore/TT702/2011(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY124466.1 Influenza A virus (A/Singapore/TT673/2011(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY124464.1 Influenza A virus (A/Singapore/TT663/2011(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY124456.1 Influenza A virus (A/Singapore/TT638/2011(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY124454.1 Influenza A virus (A/Singapore/TT633/2011(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY124452.1 Influenza A virus (A/Singapore/TT630 /2011(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY124448.1 Influenza A virus (A/Singapore/TT608/2011(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY124446.1 Influenza A virus (A/Singapore/TT603/2011(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY124444.1 Influenza A virus (A/Singapore/TT594/2011(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY124442.1 Influenza A virus (A/Singapore/TT584/2011(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY124440.1 Influenza A virus (A/Singapore/TT576/2011(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY124438.1 Influenza A virus (A/Singapore/TT572/2011(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY124436.1 Influenza A virus (A/Singapore/TT562/2011(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY124434.1 Influenza A virus (A/Singapore/TT558/2011(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY124432.1 Influenza A virus (A/Singapore/TT556/2011(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY124426.1 Influenza A virus (A/Singapore/TT517/2011(H3N2)) neuraminidase (NA) gene, partial cds 28.2 28.2 100% 1.8 100%
CY124424.1 Influenza A virus (A/Singapore/TT507/2011(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY124422.1 Influenza A virus (A/Singapore/TT506/2011(H3N2)) neuraminidase (NA) gene, partial cds 28.2 28.2 100% 1.8 100%
CY124418.1 Influenza A virus (A/Singapore/TT453/2011(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY124416.1 Influenza A virus (A/Singapore/TT452/2011(H3N2)) neuraminidase (NA) gene, partial cds 28.2 28.2 100% 1.8 100%
CY124414.1 Influenza A virus (A/Singapore/TT430/2011(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY124412.1 Influenza A virus (A/Singapore/TT416/2011(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY124410.1 Influenza A virus (A/Singapore/TT413/2011(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY124406.1 Influenza A virus (A/Singapore/TT352/2011(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY124404.1 Influenza A virus (A/Singapore/TT305/2011(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY124402.1 Influenza A virus (A/Singapore/TT241/2011(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY124398.1 Influenza A virus (A/Singapore/TT217/2011(H3N2)) neuraminidase (NA) gene, partial cds 28.2 28.2 100% 1.8 100%
CY124396.1 Influenza A virus (A/Singapore/TT216/2011(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY124392.1 Influenza A virus (A/Singapore/TT210/2011(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY124388.1 Influenza A virus (A/Singapore/SGH04/2011(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY124376.1 Influenza A virus (A/Singapore/KK7/2011(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY124374.1 Influenza A virus (A/Singapore/KK581/2011(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY124372.1 Influenza A virus (A/Singapore/KK566/2011(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY124370.1 Influenza A virus (A/Singapore/KK564/2011(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY124362.1 Influenza A virus (A/Singapore/KK491/2011(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY124360.1 Influenza A virus (A/Singapore/KK482/2011(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY124352.1 Influenza A virus (A/Singapore/KK427/2011(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY124350.1 Influenza A virus (A/Singapore/KK413/2011(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY124348.1 Influenza A virus (A/Singapore/KK404/2011(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY124346.1 Influenza A virus (A/Singapore/KK398/2011(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY124344.1 Influenza A virus (A/Singapore/KK387/2011(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY124342.1 Influenza A virus (A/Singapore/KK386/2011(H3N2)) neuraminidase (NA) gene, partial cds 28.2 28.2 100% 1.8 100%
CY124340.1 Influenza A virus (A/Singapore/KK380/2011(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY124338.1 Influenza A virus (A/Singapore/KK376/2011(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY124336.1 Influenza A virus (A/Singapore/KK366/2011(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY124334.1 Influenza A virus (A/Singapore/KK354/2011(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY124328.1 Influenza A virus (A/Singapore/KK316/2011(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY124326.1 Influenza A virus (A/Singapore/KK308/2011(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY124324.1 Influenza A virus (A/Singapore/KK264/2011(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY124316.1 Influenza A virus (A/Singapore/KK200/2011(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY124314.1 Influenza A virus (A/Singapore/KK183/2011(H3N2)) neuraminidase (NA) gene, partial cds 28.2 28.2 100% 1.8 100%
CY124312.1 Influenza A virus (A/Singapore/KK182/2011(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY124310.1 Influenza A virus (A/Singapore/KK179/2011(H3N2)) neuraminidase (NA) gene, complete cds >gb|CY124378.1| Influenza A virus (A/Singapore/MOH09/2011(H3N2)) neuraminidase (NA) gene, complete cds >gb|CY124382.1| Influenza A virus (A/Singapore/MOH13/2011(H3N2)) neuraminidase (NA) gene, complete cds >gb|CY124384.1| Influenza A virus (A/Singapore/MOH14/2011(H3N2)) neuraminidase (NA) gene, complete cds >gb|CY124390.1| Influenza A virus (A/Singapore/TT203/2011(H3N2)) neuraminidase (NA) gene, complete cds >gb|CY124394.1| Influenza A virus (A/Singapore/TT215/2011(H3N2)) neuraminidase (NA) gene, complete cds >gb|CY124430.1| Influenza A virus (A/Singapore/TT536/2011(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY124306.1 Influenza A virus (A/Singapore/KK118/2011(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY124304.1 Influenza A virus (A/Singapore/KK114/2011(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY124302.1 Influenza A virus (A/Singapore/GP995/2011(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY124298.1 Influenza A virus (A/Singapore/GP5/2011(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY124296.1 Influenza A virus (A/Singapore/GP429/2011(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY124294.1 Influenza A virus (A/Singapore/GP380/2011(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY124292.1 Influenza A virus (A/Singapore/GP1935/2011(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY124290.1 Influenza A virus (A/Singapore/GP1905/2011(H3N2)) neuraminidase (NA) gene, complete cds >gb|CY124368.1| Influenza A virus (A/Singapore/KK535/2011(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY124288.1 Influenza A virus (A/Singapore/GP1873/2011(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY124286.1 Influenza A virus (A/Singapore/GP185/2011(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY124284.1 Influenza A virus (A/Singapore/GP1846/2011(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY124282.1 Influenza A virus (A/Singapore/GP1838/2011(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY124280.1 Influenza A virus (A/Singapore/GP1818/2011(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY124278.1 Influenza A virus (A/Singapore/GP1814/2011(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY124276.1 Influenza A virus (A/Singapore/GP1810/2011(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY124274.1 Influenza A virus (A/Singapore/GP1797/2011(H3N2)) neuraminidase (NA) gene, complete cds >gb|CY124358.1| Influenza A virus (A/Singapore/KK475/2011(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY124272.1 Influenza A virus (A/Singapore/GP1784/2011(H3N2)) neuraminidase (NA) gene, complete cds >gb|CY124488.1| Influenza A virus (A/Singapore/TT802/2011(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY124270.1 Influenza A virus (A/Singapore/GP1776/2011(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY124268.1 Influenza A virus (A/Singapore/GP1760/2011(H3N2)) neuraminidase (NA) gene, complete cds >gb|CY124356.1| Influenza A virus (A/Singapore/KK459/2011(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY124266.1 Influenza A virus (A/Singapore/GP1751/2011(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY124264.1 Influenza A virus (A/Singapore/GP1726/2011(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY124262.1 Influenza A virus (A/Singapore/GP1717/2011(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY124260.1 Influenza A virus (A/Singapore/GP1713/2011(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY124256.1 Influenza A virus (A/Singapore/GP1703/2011(H3N2)) neuraminidase (NA) gene, complete cds >gb|CY124364.1| Influenza A virus (A/Singapore/KK505/2011(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY124254.1 Influenza A virus (A/Singapore/GP1692/2011(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY124252.1 Influenza A virus (A/Singapore/GP1684/2011(H3N2)) neuraminidase (NA) gene, partial cds 28.2 28.2 100% 1.8 100%
CY124250.1 Influenza A virus (A/Singapore/GP1682/2011(H3N2)) neuraminidase (NA) gene, partial cds 28.2 28.2 100% 1.8 100%
CY124248.1 Influenza A virus (A/Singapore/GP1669/2011(H3N2)) neuraminidase (NA) gene, complete cds >gb|CY124354.1| Influenza A virus (A/Singapore/KK445/2011(H3N2)) neuraminidase (NA) gene, complete cds >gb|CY124458.1| Influenza A virus (A/Singapore/TT654/2011(H3N2)) neuraminidase (NA) gene, complete cds >gb|CY124462.1| Influenza A virus (A/Singapore/TT662 /2011(H3N2)) neuraminidase (NA) gene, complete cds >gb|CY124472.1| Influenza A virus (A/Singapore/TT717/2011(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY124246.1 Influenza A virus (A/Singapore/GP1655/2011(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY124244.1 Influenza A virus (A/Singapore/GP1651/2011(H3N2)) neuraminidase (NA) gene, complete cds >gb|CY124366.1| Influenza A virus (A/Singapore/KK517/2011(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY124242.1 Influenza A virus (A/Singapore/GP1635/2011(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY124240.1 Influenza A virus (A/Singapore/GP1592/2011(H3N2)) neuraminidase (NA) gene, complete cds >gb|CY124460.1| Influenza A virus (A/Singapore/TT657/2011(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY124238.1 Influenza A virus (A/Singapore/GP1583/2011(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY124236.1 Influenza A virus (A/Singapore/GP1575/2011(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY124234.1 Influenza A virus (A/Singapore/GP1561/2011(H3N2)) neuraminidase (NA) gene, complete cds >gb|CY124450.1| Influenza A virus (A/Singapore/TT609/2011(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY124232.1 Influenza A virus (A/Singapore/GP1541/2011(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY124230.1 Influenza A virus (A/Singapore/GP1536/2011(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY124228.1 Influenza A virus (A/Singapore/GP1524/2011(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY124226.1 Influenza A virus (A/Singapore/GP1507/2011(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY124224.1 Influenza A virus (A/Singapore/GP1503/2011(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY124222.1 Influenza A virus (A/Singapore/GP1490/2011(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY124220.1 Influenza A virus (A/Singapore/GP1469/2011(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY124218.1 Influenza A virus (A/Singapore/GP1446/2011(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY124216.1 Influenza A virus (A/Singapore/GP1442/2011(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY124214.1 Influenza A virus (A/Singapore/GP1437/2011(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY124212.1 Influenza A virus (A/Singapore/GP1423/2011(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY124210.1 Influenza A virus (A/Singapore/GP1406/2011(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY124208.1 Influenza A virus (A/Singapore/GP1382/2011(H3N2)) neuraminidase (NA) gene, complete cds >gb|CY124330.1| Influenza A virus (A/Singapore/KK325/2011(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY124206.1 Influenza A virus (A/Singapore/GP1374/2011(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY124204.1 Influenza A virus (A/Singapore/GP1362/2011(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY124202.1 Influenza A virus (A/Singapore/GP1344/2011(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY124200.1 Influenza A virus (A/Singapore/GP1318/2011(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY124198.1 Influenza A virus (A/Singapore/GP1297/2011(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY124196.1 Influenza A virus (A/Singapore/GP1266/2011(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY124194.1 Influenza A virus (A/Singapore/GP125/2011(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY124192.1 Influenza A virus (A/Singapore/GP1231/2011(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY124190.1 Influenza A virus (A/Singapore/GP1215/2011(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY124188.1 Influenza A virus (A/Singapore/GP1188/2011(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY124186.1 Influenza A virus (A/Singapore/GP1155/2011(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY124184.1 Influenza A virus (A/Singapore/GP1147/2011(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY124182.1 Influenza A virus (A/Singapore/GP1138/2011(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY124180.1 Influenza A virus (A/Singapore/GP1111/2011(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY124178.1 Influenza A virus (A/Singapore/GP1098/2011(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY124176.1 Influenza A virus (A/Singapore/GP1084/2011(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY124174.1 Influenza A virus (A/Singapore/GP1072/2011(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY124172.1 Influenza A virus (A/Singapore/GP1063/2011(H3N2)) neuraminidase (NA) gene, complete cds >gb|CY124300.1| Influenza A virus (A/Singapore/GP898/2011(H3N2)) neuraminidase (NA) gene, complete cds >gb|CY124308.1| Influenza A virus (A/Singapore/KK171/2011(H3N2)) neuraminidase (NA) gene, complete cds >gb|CY124318.1| Influenza A virus (A/Singapore/KK212/2011(H3N2)) neuraminidase (NA) gene, complete cds >gb|CY124320.1| Influenza A virus (A/Singapore/KK219/2011(H3N2)) neuraminidase (NA) gene, complete cds >gb|CY124400.1| Influenza A virus (A/Singapore/TT230/2011(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY124170.1 Influenza A virus (A/Singapore/GP1048/2011(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY124168.1 Influenza A virus (A/Singapore/GP1030/2011(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY124166.1 Influenza A virus (A/Singapore/GP103/2011(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY124164.1 Influenza A virus (A/Singapore/EN514/2011(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY124162.1 Influenza A virus (A/Singapore/EN415/2011(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY124160.1 Influenza A virus (A/Singapore/EN401/2011(H3N2)) neuraminidase (NA) gene, complete cds >gb|CY124258.1| Influenza A virus (A/Singapore/GP1710/2011(H3N2)) neuraminidase (NA) gene, complete cds >gb|CY124322.1| Influenza A virus (A/Singapore/KK245/2011(H3N2)) neuraminidase (NA) gene, complete cds >gb|CY124332.1| Influenza A virus (A/Singapore/KK337/2011(H3N2)) neuraminidase (NA) gene, complete cds >gb|CY124408.1| Influenza A virus (A/Singapore/TT393/2011(H3N2)) neuraminidase (NA) gene, complete cds >gb|CY124420.1| Influenza A virus (A/Singapore/TT481/2011(H3N2)) neuraminidase (NA) gene, complete cds >gb|CY124484.1| Influenza A virus (A/Singapore/TT766/2011(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY124158.1 Influenza A virus (A/Singapore/EN358/2011(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY124156.1 Influenza A virus (A/Singapore/EN312/2011(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY124154.1 Influenza A virus (A/Singapore/EN210/2011(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY124152.1 Influenza A virus (A/Singapore/EN122/2011(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JX138527.1 Influenza A virus (A/swine/Hunan/3/2008(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
JQ924799.1 Influenza A virus (A/chicken/Guangdong/C273/2011(H6N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY116600.1 Influenza A virus (A/Wyoming/3/2003(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY116598.1 Influenza A virus (A/Uruguay/716/2007(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY116596.1 Influenza A virus (A/New York/55/2004(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY116594.1 Influenza A virus (A/Netherlands/399/1993(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY116593.1 Influenza A virus (A/Netherlands/282/2009(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY116590.1 Influenza A virus (A/Netherlands/178/1995(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY116588.1 Influenza A virus (A/Leningrad/360/1986(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY116587.1 Influenza A virus (A/Hiroshima/52/2005(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY116585.1 Influenza A virus (A/Guizhou/54/1989(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY116584.1 Influenza A virus (A/Finland/170/2003(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY116583.1 Influenza A virus (A/England/261/1991(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY116582.1 Influenza A virus (A/Eindhoven/3447/1989(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY116580.1 Influenza A virus (A/Caen/1/1984(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY116579.1 Influenza A virus (A/Christ Church/2/1988(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY116578.1 Influenza A virus (A/Brisbane/10/2007(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY116576.1 Influenza A virus (A/Bilthoven/5168/1976(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY116574.1 Influenza A virus (A/Bilthoven/2271/1976(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY116573.1 Influenza A virus (A/Bilthoven/16190/1968(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY116572.1 Influenza A virus (A/Auckland/4382/1982(H3N2)) neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY115100.1 Influenza A virus (A/swine/Minnesota/A01201667/2011(H1N2)) neuraminidase (NA) gene, partial cds 28.2 28.2 100% 1.8 100%
CY115085.1 Influenza A virus (A/swine/Illinois/A01201151/2011(H1N2)) neuraminidase (NA) gene, partial cds 28.2 28.2 100% 1.8 100%
CY115078.1 Influenza A virus (A/swine/Illinois/A01134702/2011(H1N2)) neuraminidase (NA) gene, partial cds 28.2 28.2 100% 1.8 100%
CY115075.1 Influenza A virus (A/swine/Illinois/A01116719/2011(H1N2)) neuraminidase (NA) gene, partial cds 28.2 28.2 100% 1.8 100%
CY115051.1 Influenza A virus (A/swine/Minnesota/A01134597/2010(H1N2)) neuraminidase (NA) gene, partial cds 28.2 28.2 100% 1.8 100%
CY115041.1 Influenza A virus (A/swine/Minnesota/A01134592/2010(H1N2)) neuraminidase (NA) gene, partial cds 28.2 28.2 100% 1.8 100%
CY115036.1 Influenza A virus (A/swine/Illinois/A01134656/2011(H1N2)) neuraminidase (NA) gene, partial cds 28.2 28.2 100% 1.8 100%
CY115023.1 Influenza A virus (A/swine/Minnesota/A01047973/2011(H1N2)) neuraminidase (NA) gene, partial cds 28.2 28.2 100% 1.8 100%
CY115013.1 Influenza A virus (A/swine/Illinois/A01134851/2011(H1N2)) neuraminidase (NA) gene, partial cds 28.2 28.2 100% 1.8 100%
CY115008.1 Influenza A virus (A/swine/Illinois/A01201430/2011(H1N2)) neuraminidase (NA) gene, partial cds 28.2 28.2 100% 1.8 100%
CY115004.1 Influenza A virus (A/swine/Illinois/A01134580/2011(H1N2)) neuraminidase (NA) gene, partial cds 28.2 28.2 100% 1.8 100%
CY114989.1 Influenza A virus (A/swine/Minnesota/A01134468/2011(H1N2)) neuraminidase (NA) gene, partial cds 28.2 28.2 100% 1.8 100%
CY114976.1 Influenza A virus (A/swine/Minnesota/A01134246/2011(H1N2)) neuraminidase (NA) gene, partial cds 28.2 28.2 100% 1.8 100%
CY114972.1 Influenza A virus (A/swine/Minnesota/A01134235/2011(H1N2)) neuraminidase (NA) gene, partial cds 28.2 28.2 100% 1.8 100%
CY114968.1 Influenza A virus (A/swine/Minnesota/A01134221/2011(H1N2)) neuraminidase (NA) gene, partial cds 28.2 28.2 100% 1.8 100%
CY114956.1 Influenza A virus (A/swine/Ohio/A01116888/2011(H1N2)) neuraminidase (NA) gene, partial cds 28.2 28.2 100% 1.8 100%
CY114953.1 Influenza A virus (A/swine/Nebraska/A01116984/2011(H3N2)) neuraminidase (NA) gene, partial cds 28.2 28.2 100% 1.8 100%
CY114947.1 Influenza A virus (A/swine/Michigan/A01116886/2011(H1N2)) neuraminidase (NA) gene, partial cds 28.2 28.2 100% 1.8 100%
CY114942.1 Influenza A virus (A/swine/Minnesota/A01116840/2011(H1N2)) neuraminidase (NA) gene, partial cds 28.2 28.2 100% 1.8 100%
CY114910.1 Influenza A virus (A/swine/Minnesota/A01116381/2011(H3N2)) neuraminidase (NA) gene, partial cds 28.2 28.2 100% 1.8 100%
CY114896.1 Influenza A virus (A/swine/Minnesota/A01116288/2011(H1N2)) neuraminidase (NA) gene, partial cds 28.2 28.2 100% 1.8 100%
CY114893.1 Influenza A virus (A/swine/Illinois/A01047360/2011(H1N2)) neuraminidase (NA) gene, partial cds 28.2 28.2 100% 1.8 100%
CY114885.1 Influenza A virus (A/swine/Illinois/A01116190/2011(H3N2)) neuraminidase (NA) gene, partial cds 28.2 28.2 100% 1.8 100%
CY114880.1 Influenza A virus (A/swine/Minnesota/A01116286/2011(H1N2)) neuraminidase (NA) gene, partial cds 28.2 28.2 100% 1.8 100%
CY114875.1 Influenza A virus (A/swine/Minnesota/A00907733/2011(H3N2)) neuraminidase (NA) gene, partial cds 28.2 28.2 100% 1.8 100%
CY114868.1 Influenza A virus (A/swine/Illinois/A01201927/2011(H1N2)) neuraminidase (NA) gene, partial cds 28.2 28.2 100% 1.8 100%
CY114865.1 Influenza A virus (A/swine/Illinois/A00907727/2011(H1N2)) neuraminidase (NA) gene, partial cds 28.2 28.2 100% 1.8 100%
CY114862.1 Influenza A virus (A/swine/Illinois/A01047350/2011(H1N2)) neuraminidase (NA) gene, partial cds 28.2 28.2 100% 1.8 100%
CY114858.1 Influenza A virus (A/swine/Minnesota/A01201895/2011(H3N2)) neuraminidase (NA) gene, partial cds 28.2 28.2 100% 1.8 100%
CY114850.1 Influenza A virus (A/swine/Illinois/A01201631/2011(H3N2)) neuraminidase (NA) gene, partial cds 28.2 28.2 100% 1.8 100%
CY114847.1 Influenza A virus (A/swine/Illinois/A01201629/2011(H3N2)) neuraminidase (NA) gene, partial cds 28.2 28.2 100% 1.8 100%
CY114841.1 Influenza A virus (A/swine/Illinois/A01201606/2011(H3N2)) neuraminidase (NA) gene, partial cds 28.2 28.2 100% 1.8 100%
CY114813.1 Influenza A virus (A/swine/Illinois/A01047996/2011(H1N2)) neuraminidase (NA) gene, partial cds 28.2 28.2 100% 1.8 100%
CY114808.1 Influenza A virus (A/swine/Minnesota/A01201297/2011(H1N2)) neuraminidase (NA) gene, partial cds 28.2 28.2 100% 1.8 100%
CY114805.1 Influenza A virus (A/swine/Minnesota/A01201296/2011(H1N2)) neuraminidase (NA) gene, partial cds 28.2 28.2 100% 1.8 100%
CY114799.1 Influenza A virus (A/swine/Illinois/A01201077/2011(H3N2)) neuraminidase (NA) gene, partial cds 28.2 28.2 100% 1.8 100%
CY114790.1 Influenza A virus (A/swine/Illinois/A01116186/2011(H1N2)) neuraminidase (NA) gene, partial cds 28.2 28.2 100% 1.8 100%
CY114778.1 Influenza A virus (A/swine/Ohio/A01076765/2010(H1N2)) neuraminidase (NA) gene, partial cds 28.2 28.2 100% 1.8 100%
CY114717.1 Influenza A virus (A/swine/North Carolina/A01076184/2010(H1N2)) neuraminidase (NA) gene, partial cds 28.2 28.2 100% 1.8 100%
CY114704.1 Influenza A virus (A/swine/Minnesota/A01116364/2010(H1N2)) neuraminidase (NA) gene, partial cds 28.2 28.2 100% 1.8 100%
CY114659.1 Influenza A virus (A/swine/Minnesota/A01047499/2010(H1N2)) neuraminidase (NA) gene, partial cds 28.2 28.2 100% 1.8 100%
CY114632.1 Influenza A virus (A/swine/Illinois/A01047079/2010(H1N2)) neuraminidase (NA) gene, partial cds 28.2 28.2 100% 1.8 100%
CY114625.1 Influenza A virus (A/swine/Illinois/A01047048/2010(H1N2)) neuraminidase (NA) gene, partial cds 28.2 28.2 100% 1.8 100%
CY114609.1 Influenza A virus (A/swine/Minnesota/A01047910/2010(H1N2)) neuraminidase (NA) gene, partial cds 28.2 28.2 100% 1.8 100%
CY114606.1 Influenza A virus (A/swine/Minnesota/A01047909/2010(H1N2)) neuraminidase (NA) gene, partial cds 28.2 28.2 100% 1.8 100%
CY114601.1 Influenza A virus (A/swine/Illinois/A01076954/2010(H1N2)) neuraminidase (NA) gene, partial cds 28.2 28.2 100% 1.8 100%
CY114593.1 Influenza A virus (A/swine/Minnesota/A01201424/2010(H3N2)) neuraminidase (NA) gene, partial cds 28.2 28.2 100% 1.8 100%
CY114579.1 Influenza A virus (A/swine/Minnesota/A01076335/2010(H1N2)) neuraminidase (NA) gene, partial cds >gb|CY114758.1| Influenza A virus (A/swine/Minnesota/A01076326/2010(H1N2)) neuraminidase (NA) gene, partial cds 28.2 28.2 100% 1.8 100%
JN088204.1 Influenza A virus (A/swine/Bakum/1832/2000(H1N2)) segment 6 neuraminidase (NA) gene, partial cds 28.2 28.2 100% 1.8 100%
JX122445.1 Influenza A virus (A/swine/Minnesota/A01076197/2010(H1N2)) segment 6 neuraminidase (NA) gene, complete cds 28.2 28.2 100% 1.8 100%
CY100398.1 Influenza A virus (A/Hong Kong/HKU98/2005(H3N2)) neuraminidase (NA) gene, partial cds 28.2 28.2 100% 1.8 100%
CY100390.1 Influenza A virus (A/Hong Kong/HKU96/2005(H3N2)) neuraminidase (NA) gene, partial cds 28.2 28.2 100% 1.8 100%
CY100382.1 Influenza A virus (A/Hong Kong/HKU94/2005(H3N2)) neuraminidase (NA) gene, partial cds 28.2 28.2 100% 1.8 100%
CY100374.1 Influenza A virus (A/Hong Kong/HKU93/2005(H3N2)) neuraminidase (NA) gene, partial cds 28.2 28.2 100% 1.8 100%
CY100366.1 Influenza A virus (A/Hong Kong/HKU92/2004(H3N2)) neuraminidase (NA) gene, partial cds 28.2 28.2 100% 1.8 100%
CY100358.1 Influenza A virus (A/Hong Kong/HKU91/2004(H3N2)) neuraminidase (NA) gene, partial cds 28.2 28.2 100% 1.8 100%
CY100350.1 Influenza A virus (A/Hong Kong/HKU90/2004(H3N2)) neuraminidase (NA) gene, partial cds 28.2 28.2 100% 1.8 100%
CY100342.1 Influenza A virus (A/Hong Kong/HKU89/2004(H3N2)) neuraminidase (NA) gene, partial cds 28.2 28.2 100% 1.8 100%
CY100334.1 Influenza A virus (A/Hong Kong/HKU88/2004(H3N2)) neuraminidase (NA) gene, partial cds 28.2 28.2 100% 1.8 100%
CY100326.1 Influenza A virus (A/Hong Kong/HKU87/2004(H3N2)) neuraminidase (NA) gene, partial cds 28.2 28.2 100% 1.8 100%
CY100318.1 Influenza A virus (A/Hong Kong/HKU86/2004(H3N2)) neuraminidase (NA) gene, partial cds 28.2 28.2 100% 1.8 100%
CY100310.1 Influenza A virus (A/Hong Kong/HKU85/2004(H3N2)) neuraminidase (NA) gene, partial cds 28.2 28.2 100% 1.8 100%
CY100302.1 Influenza A virus (A/Hong Kong/HKU83/2004(H3N2)) neuraminidase (NA) gene, partial cds 28.2 28.2 100% 1.8 100%
CY100294.1 Influenza A virus (A/Hong Kong/HKU123/2004(H3N2)) neuraminidase (NA) gene, partial cds 28.2 28.2 100% 1.8 100%
CY100286.1 Influenza A virus (A/Hong Kong/HKU122/2004(H3N2)) neuraminidase (NA) gene, partial cds 28.2 28.2 100% 1.8 100%
CY100278.1 Influenza A virus (A/Hong Kong/HKU121/2004(H3N2)) neuraminidase (NA) gene, partial cds 28.2 28.2 100% 1.8 100%
CY100270.1 Influenza A virus (A/Hong Kong/HKU120/2004(H3N2)) neuraminidase (NA) gene, partial cds 28.2 28.2 100% 1.8 100%
CY100262.1 Influenza A virus (A/Hong Kong/HKU119/2004(H3N2)) neuraminidase (NA) gene, partial cds 28.2 28.2 100% 1.8 100%
CY100254.1 Influenza A virus (A/Hong Kong/HKU118/2004(H3N2)) neuraminidase (NA) gene, partial cds 28.2 28.2 100% 1.8 100%
CY100246.1 Influenza A virus (A/Hong Kong/HKU117/2004(H3N2)) neuraminidase (NA) gene, partial cds 28.2 28.2 100% 1.8 100%
CY100238.1 Influenza A virus (A/Hong Kong/HKU116/2004(H3N2)) neuraminidase (NA) gene, partial cds 28.2 28.2 100% 1.8 100%
CY100230.1 Influenza A virus (A/Hong Kong/HKU115/2004(H3N2)) neuraminidase (NA) gene, partial cds 28.2 28.2 100% 1.8 100%
CY100222.1 Influenza A virus (A/Hong Kong/HKU114/2004(H3N2)) neuraminidase (NA) gene, partial cds 28.2 28.2 100% 1.8 100%
CY100214.1 Influenza A virus (A/Hong Kong/HKU111/2005(H3N2)) neuraminidase (NA) gene, partial cds 28.2 28.2 100% 1.8 100%
CY100206.1 Influenza A virus (A/Hong Kong/HKU110/2005(H3N2)) neuraminidase (NA) gene, partial cds 28.2 28.2 100% 1.8 100%
CY100198.1 Influenza A virus (A/Hong Kong/HKU109/2005(H3N2)) neuraminidase (NA) gene, partial cds 28.2 28.2 100% 1.8 100%
CY100190.1 Influenza A virus (A/Hong Kong/HKU108/2005(H3N2)) neuraminidase (NA) gene, partial cds 28.2 28.2 100% 1.8 100%
CY100182.1 Influenza A virus (A/Hong Kong/HKU107/2005(H3N2)) neuraminidase (NA) gene, partial cds 28.2 28.2 100% 1.8 100%
CY100174.1 Influenza A virus (A/Hong Kong/HKU105/2005(H3N2)) neuraminidase (NA) gene, partial cds 28.2 28.2 100% 1.8 100%
CY100166.1 Influenza A virus (A/Hong Kong/HKU104/2005(H3N2)) neuraminidase (NA) gene, partial cds 28.2 28.2 100% 1.8 100%
CY100158.1 Influenza A virus (A/Hong Kong/HKU102/2005(H3N2)) neuraminidase (NA) gene, partial cds 28.2 28.2 100% 1.8 100%
CY100150.1 Influenza A virus (A/Hong Kong/HKU101/2005(H3N2)) neuraminidase (NA) gene, partial cds 28.2 28.2 100% 1.8 100%
CY100142.1 Influenza A virus (A/Hong Kong/HKU100/2005(H3N2)) neuraminidase (NA) gene, partial cds 28.2 28.2 100% 1.8 100%

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Wed Jul 25, 2012 9:10 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
Thread on 2012 Indiana match with 2012 human case in Utah

viewtopic.php?f=5&t=8161

_________________
www.twitter.com/hniman


Top
 Profile  
 
Display posts from previous:  Sort by  
Post new topic Reply to topic  [ 7 posts ] 

All times are UTC - 5 hours [ DST ]


Who is online

Users browsing this forum: Google [Bot], HilarioR and 56 guests


You cannot post new topics in this forum
You cannot reply to topics in this forum
You cannot edit your posts in this forum
You cannot delete your posts in this forum
You cannot post attachments in this forum

Search for:
Jump to:  
cron
Powered by phpBB® Forum Software © phpBB Group