Rhiza Labs FluTracker Forum • View topic - H1N1 With Swine H3N2 In Canadian Mink

View unanswered posts | View active topics

Board index » Discussion » General Discussion

All times are UTC - 5 hours [ DST ]

H1N1 With Swine H3N2 In Canadian Mink

Page 1 of 2

[ 12 posts ]

Go to page 1, 2 Next

Print view

Previous topic | Next topic

Author

Message

niman

Post subject: H1N1 With Swine H3N2 In Canadian Mink

Posted: Fri Mar 25, 2011 9:00 am

Joined: Wed Aug 19, 2009 10:42 am
Posts: 27330
Location: Pittsburgh, PA USA

Recently released sequences from swine in Quebec, A/swine/Quebec/1265553/2010, and mink in Nova Scotia, A/mink/Nova Scotia/1265707/2010, have swine H3 and N2 appended onto a pandemic H1N1 background. Thus, six of the eight gene segments are pandemic H1N1 and the novel constellation is transmitting.

_________________
www.twitter.com/hniman

Top

niman

Post subject: Re: H1N1 With Swine H3N2 In Canadian Mink

Posted: Fri Mar 25, 2011 9:01 am

Joined: Wed Aug 19, 2009 10:42 am
Posts: 27330
Location: Pittsburgh, PA USA

LOCUS JF411012 1565 bp cRNA linear VRL 14-MAR-2011
DEFINITION Influenza A virus (A/swine/Quebec/1259260/2010(H3N2)) segment 4
hemagglutinin (HA) gene, partial cds.
ACCESSION JF411012
VERSION JF411012.1 GI:324033756
KEYWORDS .
SOURCE Influenza A virus (A/swine/Quebec/1259260/2010(H3N2))
ORGANISM Influenza A virus (A/swine/Quebec/1259260/2010(H3N2))
Viruses; ssRNA negative-strand viruses; Orthomyxoviridae;
Influenzavirus A.
REFERENCE 1 (bases 1 to 1565)
AUTHORS Tremblay,D., Allard,V., Harel,J. and Gagnon,C.A.
TITLE Emergence of a new reassortant of swine H3N2 and pandemic H1N1 2009
Influenza A virus
JOURNAL Unpublished
REFERENCE 2 (bases 1 to 1565)
AUTHORS Tremblay,D., Allard,V., Harel,J. and Gagnon,C.A.
TITLE Direct Submission
JOURNAL Submitted (21-FEB-2011) Faculte de Medecine Veterinaire, Universite
de Montreal, 3200 rue Sicotte, St-Hyacinthe, Quebec J2S 7C6, Canada
FEATURES Location/Qualifiers
source 1..1565
/organism="Influenza A virus
(A/swine/Quebec/1259260/2010(H3N2))"
/mol_type="viral cRNA"
/strain="A/swine/Quebec/1259260/2010"
/serotype="H3N2"
/host="swine"
/db_xref="taxon:986731"
/segment="4"
/country="Canada"
/collection_date="20-Dec-2010"
gene <1..>1565
/gene="HA"
CDS <1..>1565
/gene="HA"
/codon_start=3
/product="hemagglutinin"
/protein_id="ADY16756.1"
/db_xref="GI:324033757"
/translation="FAQKLPESDNSMATLCLGHHAVPNGTLVKTITDDQIEVTNATEL
VQSSSTGRICNSPHQILDGKNCTLIDALLGDPHCDDFQNKEWDLFVERSTAYSSCYPY
YVPDYVSLRSLVASSGTLEFTQESFNWTGVAQDGSSYACRRKSVNSFFSRLNWLHNLD
YKYPALNVTMPNNEKFDKLYIWGVHHPGTDRDQTNLYVQASGRVTVSTKRSQQTVIPN
IGSRPWVRGVSSIISIYWTIVKPGDILLIKSTGNLIAPRGYFKIQSGKSSIMRSDAPI
GNCNSECITPNGSIPNDKPFQNVNRITYGACPRYVKQNTLKLATGMRNVPEKQTRGIF
GAIAGFIENGWEGMVDGWYGFRHQNSEGTGQAADLKSTQAAINQITGKLNRVIKKTNE
KFHQIEKEFSEVEGRIQDLEKYVEDTKIDLWSYNAELLVALENQHTIDLTDSEMNKLF
ERTRKQLRENAEDMGNGCFKIYHKCDNACIGSIRNGTYDHDVYRDEALNNRFQIKGVQ
LKSGYKDWILWIS"
ORIGIN
1 ttttcgctca aaaacttccc gaaagtgaca acagcatggc aacgctgtgc ttgggacacc
61 atgcagtacc aaatggaacg ttagtgaaaa caatcacaga tgaccaaatt gaagtgacta
121 atgctactga actggttcag agttcctcaa caggtagaat atgcaacagt cctcaccaaa
181 tccttgatgg gaaaaattgc acactgatag atgctctatt gggagaccct cattgtgatg
241 acttccaaaa caaggagtgg gacctttttg ttgaacgaag cacagcctac agcagctgtt
301 acccttatta tgtgccagat tatgtctctc ttaggtcact agttgcctca tccggcaccc
361 tggagtttac ccaagaaagc ttcaattgga ctggagttgc tcaagatgga tcaagctatg
421 cttgcagaag gaaatctgtt aacagtttct ttagtagatt gaattggttg cataatttgg
481 attacaaata tccagcgctg aacgtaacta tgccaaacaa tgaaaaattt gacaaattgt
541 acatatgggg ggttcaccac ccgggtacgg acagggacca aaccaatcta tatgttcaag
601 catcagggag agttacagtc tccaccaaaa gaagccaaca aactgtaatc ccgaatatcg
661 ggtctagacc ctgggtaagg ggtgtctcca gcataataag catctattgg acaatagtaa
721 aaccgggaga catacttttg attaaaagca cagggaatct aattgcccct cggggttact
781 tcaaaataca aagtgggaaa agctcaataa tgaggtcaga tgcacccatt ggcaactgca
841 attctgaatg cattactcca aatggaagta ttcccaatga caaacctttt caaaatgtaa
901 acaggatcac atatggggca tgtcccagat atgttaagca aaacactctg aaattggcaa
961 cagggatgcg gaatgtacca gagaaacaaa ctagaggcat atttggcgca atcgcaggtt
1021 tcatagaaaa tggttgggag gggatggtgg acggttggta cggtttcagg catcaaaatt
1081 ctgaaggtac aggacaagca gcagatctta aaagcactca agcagcaatc aaccaaatca
1141 ccgggaaact aaatagagta atcaagaaaa cgaacgagaa attccatcag attgaaaaag
1201 aattctcaga agtagaaggg agaattcagg acctagagaa atacgttgaa gacactaaaa
1261 tagatctctg gtcttacaac gcggagcttc ttgttgccct ggagaaccaa catacaattg
1321 atttaactga ctcagaaatg aacaaactgt tcgaaagaac aagaaagcaa ctgcgggaaa
1381 atgctgagga catgggcaat ggttgcttca aaatatacca caaatgtgac aatgcctgca
1441 taggatcaat cagaaatgga acttatgacc atgatgtata tagagacgag gcattaaaca
1501 atcggttcca gatcaaaggt gttcagctga agtcaggata caaagattgg atcctatgga
1561 tttcc

_________________
www.twitter.com/hniman

Top

novascotia35

Post subject: Re: H1N1 With Swine H3N2 In Canadian Mink

Posted: Fri Mar 25, 2011 11:35 am

Joined: Fri Feb 26, 2010 10:50 pm
Posts: 53

niman wrote:

FYI: there have been at least five "code census" calls at the main halifax hospital this month. Four occurred between march 1=11 and I just heard of another yesterday but don't know and couldn't find out how many there were in between. A "code census" is when the ER is shut down due to overcrowding. This is highly unusual. LOTS of kids at our school are sick with ongoing flu and/or gastro symptoms, this has been the case for the last few weeks.

Top

niman

Post subject: Re: H1N1 With Swine H3N2 In Canadian Mink

Posted: Fri Mar 25, 2011 11:40 am

Joined: Wed Aug 19, 2009 10:42 am
Posts: 27330
Location: Pittsburgh, PA USA

novascotia35 wrote:

niman wrote:

The mink sample was colected December 22, 2010:

LOCUS JF682717 644 bp cRNA linear VRL 22-MAR-2011
DEFINITION Influenza A virus (A/mink/Nova Scotia/1265707/2010(H3N2)) segment 4
hemagglutinin (HA) gene, partial cds.
ACCESSION JF682717
VERSION JF682717.1 GI:326579377
KEYWORDS .
SOURCE Influenza A virus (A/mink/Nova Scotia/1265707/2010(H3N2))
ORGANISM Influenza A virus (A/mink/Nova Scotia/1265707/2010(H3N2))
Viruses; ssRNA negative-strand viruses; Orthomyxoviridae;
Influenzavirus A.
REFERENCE 1 (bases 1 to 644)
AUTHORS Tremblay,D., Allard,V., Harel,J. and Gagnon,C.A.
TITLE Identification of a new swine H3N2 and pandemic H1N1 2009 influenza
virus reassortant in two Canadian animal species
JOURNAL Unpublished
REFERENCE 2 (bases 1 to 644)
AUTHORS Tremblay,D., Allard,V., Harel,J. and Gagnon,C.A.
TITLE Direct Submission
JOURNAL Submitted (13-MAR-2011) Faculte de Medecine Veterinaire, Universite
de Montreal, 3200 rue Sicotte, St-Hyacinthe, Quebec J2S 7C6, Canada
FEATURES Location/Qualifiers
source 1..644
/organism="Influenza A virus (A/mink/Nova
Scotia/1265707/2010(H3N2))"
/mol_type="viral cRNA"
/strain="A/mink/Nova Scotia/1265707/2010"
/serotype="H3N2"
/isolate="FMV10-1265707"
/host="mink"
/db_xref="taxon:997456"
/segment="4"
/country="Canada"
/collection_date="22-Dec-2010"
gene <1..>644
/gene="HA"
CDS <1..>644
/gene="HA"
/codon_start=3
/product="hemagglutinin"
/protein_id="ADZ96192.1"
/db_xref="GI:326579378"
/translation="FAQKLPESDNSMATLCLGHHAVPNGTLVKTITDDQIEVTNATEL
VQSSSTGRICNSPHQILDGKNCTLIDALLGDPHCDDFQNKEWDLFVERSTAYSSCYPY
YVPDYVSLRSLVASSGTLEFTQESFNWTGVAQDGSSYACRRKSVNSFFSRLNWLHNLD
YKYPALNVTMPNNEKFDKLYIWGVHHPGTDRDQTNLYVQASGRVTVSTKRSQQT"
ORIGIN
1 ttttcgctca aaaacttccc gaaagtgaca acagcatggc aacgctgtgc ttgggacacc
61 atgcagtacc aaatggaacg ttagtgaaaa caatcacaga tgaccaaatt gaagtgacta
121 atgctactga actggttcag agttcctcaa caggtagaat atgcaacagt cctcaccaaa
181 tccttgatgg gaaaaattgc acactgatag atgctctatt gggagaccct cattgtgatg
241 acttccaaaa caaggagtgg gacctttttg ttgaacgaag cacagcctac agcagctgtt
301 acccttatta tgtgccagat tatgtctctc ttaggtcact agttgcctca tccggcaccc
361 tggagtttac ccaagaaagc ttcaattgga ctggagttgc tcaagatgga tcaagctatg
421 cttgcagaag gaaatctgtt aacagtttct ttagtagatt gaattggttg cataatttgg
481 attacaaata tccagcgctg aacgtaacta tgccaaacaa tgaaaaattt gacaaattgt
541 acatatgggg ggttcaccac ccgggtacgg acagggacca aaccaatcta tatgttcaag
601 catcagggag agttacagtc tccaccaaaa gaagccaaca aact

_________________
www.twitter.com/hniman

Top

niman

Post subject: Re: H1N1 With Swine H3N2 In Canadian Mink

Posted: Fri Mar 25, 2011 11:44 am

Joined: Wed Aug 19, 2009 10:42 am
Posts: 27330
Location: Pittsburgh, PA USA

Top 100 matches to mink HA sequence

Sequences producing significant alignments: Accession Description Max score Total score Query coverage E value Max ident Links
JF411012.1 Influenza A virus (A/swine/Quebec/1259260/2010(H3N2)) segment 4 hemagglutinin (HA) gene, partial cds 1162 1162 100% 0.0 100%
DQ470002.1 Influenza A virus (A/turkey/Ontario/31232/2005(H3N2)) hemagglutinin (HA) gene, complete cds 1094 1094 100% 0.0 97%
DQ469994.1 Influenza A virus (A/swine/Ontario/33853/2005(H3N2)) hemagglutinin (HA) gene, complete cds 1094 1094 100% 0.0 97%
DQ469978.1 Influenza A virus (A/swine/British Columbia/28103/2005(H3N2)) hemagglutinin (HA) gene, complete cds 1094 1094 100% 0.0 97%
DQ469970.1 Influenza A virus (A/swine/Alberta/14722/2005(H3N2)) hemagglutinin (HA) gene, complete cds 1094 1094 100% 0.0 97%
DQ469962.1 Influenza A virus (A/Ontario/RV1273/2005(H3N2)) hemagglutinin (HA) gene, complete cds 1094 1094 100% 0.0 97%
EU826543.2 Influenza A virus (A/swine/Quebec/4001/2005(H3N2)) segment 4 hemagglutinin (HA) gene, complete cds 1090 1090 100% 0.0 97%
CY040583.1 Influenza A virus (A/swine/Minnesota/21057/2005(H3N2)) segment 4 sequence 1090 1090 100% 0.0 97%
EU743210.1 Influenza A virus (A/turkey/MN/366767/2005(H3N2)) segment 4 hemagglutinin (HA) gene, complete cds 1090 1090 100% 0.0 97%
DQ469986.1 Influenza A virus (A/swine/Manitoba/12707/2005(H3N2)) hemagglutinin (HA) gene, complete cds 1090 1090 100% 0.0 97%
FJ519971.1 Influenza A virus (A/swine/Minnesota/65767/2006(H3N2)) segment 4 hemagglutinin (HA) gene, complete cds 1085 1085 100% 0.0 97%
CY040584.1 Influenza A virus (A/swine/Minnesota/24877/2005(H3N2)) segment 4 sequence 1085 1085 99% 0.0 97%
CY040582.1 Influenza A virus (A/swine/Minnesota/18815/2005(H3N2)) segment 4 sequence 1085 1085 100% 0.0 97%
EU697204.1 Influenza A virus (A/turkey/Minnesota/366767/2005(H3N2)) hemagglutinin (HA) gene, complete cds 1085 1085 100% 0.0 97%
EU735818.1 Influenza A virus (A/turkey/OH/313053/2004(H3N2)) hemagglutinin (HA) gene, complete cds 1085 1085 100% 0.0 97%
HQ315643.1 Influenza A virus (A/swine/Minnesota/1300/2007(H3N2)) segment 4 hemagglutinin (HA) gene, complete cds 1081 1081 100% 0.0 97%
DQ335771.1 Influenza A virus (A/turkey/Ohio/313053/04(H3N2)) hemagglutinin (HA) gene, complete cds 1081 1081 100% 0.0 97%
EU735826.1 Influenza A virus (A/turkey/NC/353568/2005(H3N2)) hemagglutinin (HA) gene, complete cds 1076 1076 100% 0.0 97%
GU721165.1 Influenza A virus (A/swine/Illinois/02945/2010(H3N2)) segment 4 hemagglutinin (HA) gene, partial cds 1072 1072 100% 0.0 96%
FJ519974.1 Influenza A virus (A/swine/Minnesota/578/2007(H3N2)) segment 4 hemagglutinin (HA) gene, complete cds 1072 1072 100% 0.0 96%
FJ519973.1 Influenza A virus (A/swine/Minnesota/66960/2006(H3N2)) segment 4 hemagglutinin (HA) gene, complete cds 1072 1072 100% 0.0 96%
EU697209.1 Influenza A virus (A/turkey/North Carolina/353568/2005(H3N2)) hemagglutinin (HA) gene, complete cds 1072 1072 100% 0.0 96%
CY035416.1 Influenza A virus (A/swine/Minnesota/SG-00234/2005(H3N2)) segment 4 sequence 1072 1072 100% 0.0 96%
CY040581.1 Influenza A virus (A/swine/Iowa/36241/2005(H3N2)) segment 4 sequence 1067 1067 100% 0.0 96%
CY040518.1 Influenza A virus (A/swine/Illinois/34642/2005(H3N2)) segment 4 sequence 1067 1067 100% 0.0 96%
CY040516.1 Influenza A virus (A/swine/Iowa/36243/2005(H3N2)) segment 4 sequence 1067 1067 100% 0.0 96%
EF551045.1 Influenza A virus (A/turkey/Illinois/2004(H3N2)) segment 4 hemagglutinin (HA) gene, complete cds 1067 1067 100% 0.0 96%
DQ150425.1 Influenza A virus (A/swine/MI/PU243/04 (H3N1)) hemagglutinin (HA) gene, complete cds 1067 1067 100% 0.0 96%
FJ410140.1 Influenza A virus (A/swine/Minnesota/1145/2007(H3N2)) segment 4, complete sequence 1063 1063 100% 0.0 96%
CY045575.1 Influenza A virus (A/swine/Oklahoma/011506/2007(H3N2)) segment 4 sequence 1063 1063 100% 0.0 96%
CY040538.1 Influenza A virus (A/swine/North Carolina/38715/2005(H3N2)) segment 4 sequence 1063 1063 100% 0.0 96%
CY035442.1 Influenza A virus (A/swine/Minnesota/SG-00242/2006(H3N2)) segment 4 sequence 1063 1063 100% 0.0 96%
CY035422.1 Influenza A virus (A/swine/Minnesota/SG-00236/2007(H3N2)) segment 4 sequence 1063 1063 100% 0.0 96%
CY035419.1 Influenza A virus (A/swine/Minnesota/SG-00235/2007(H3N2)) segment 4 sequence 1063 1063 100% 0.0 96%
HM025943.1 Influenza A virus (A/swine/Missouri/02980/2010(H3N2)) segment 4 hemagglutinin (HA) gene, partial cds 1058 1058 100% 0.0 96%
FJ519975.1 Influenza A virus (A/swine/Minnesota/761/2007(H3N2)) segment 4 hemagglutinin (HA) gene, complete cds 1058 1058 100% 0.0 96%
FJ519972.1 Influenza A virus (A/swine/Minnesota/66853/2006(H3N2)) segment 4 hemagglutinin (HA) gene, complete cds 1058 1058 100% 0.0 96%
CY040470.1 Influenza A virus (A/swine/Iowa/63607-19/2008(H3N2)) segment 4 sequence 1058 1058 100% 0.0 96%
EU399751.1 Influenza A virus (A/Ontario/1252/2007(H3N2)) hemagglutinin (HA) gene, complete cds 1058 1058 100% 0.0 96%
JF263536.1 Influenza A virus (A/swine/Pennsylvania/62170-3/2010(H3N2)) segment 4 hemagglutinin (HA) gene, complete cds 1054 1054 100% 0.0 96%
JF263535.1 Influenza A virus (A/swine/Pennsylvania/62170-1/2010(H3N2)) segment 4 hemagglutinin (HA) gene, complete cds 1054 1054 100% 0.0 96%
CY045567.1 Influenza A virus (A/swine/Oklahoma/008722/2007(H3N2)) segment 4 sequence 1054 1054 100% 0.0 96%
CY041847.1 Influenza A virus (A/swine/North Carolina/R08-001877-D08-013371/2008 (H3N2)) segment 4 sequence 1054 1054 100% 0.0 96%
CY040491.1 Influenza A virus (A/swine/Minnesota/63607-5/2008(H3N1)) segment 4 sequence 1049 1049 100% 0.0 96%
CY040487.1 Influenza A virus (A/swine/Minnesota/63607-33/2008 (H3)) segment 4 sequence 1047 1047 100% 0.0 95%
CY040459.1 Influenza A virus (A/swine/Arkansas/63607-20/2008(H3N2)) segment 4 sequence 1047 1047 99% 0.0 96%
GU937743.1 Influenza A virus (A/Kansas/13/2009(H3N2)) segment 4 hemagglutinin (HA) gene, complete cds 1045 1045 100% 0.0 95%
HQ734189.1 Influenza A virus (A/swine/Illinois/53612-2/2009(H3N2)) segment 4 hemagglutinin (HA) gene, complete cds 1045 1045 100% 0.0 95%
HQ734186.1 Influenza A virus (A/swine/Illinois/53612-1/2009(H3N2)) segment 4 hemagglutinin (HA) gene, complete cds 1045 1045 100% 0.0 95%
GU817057.1 Influenza A virus (A/swine/Minnesota/02952/2009(H3N2)) segment 4 hemagglutinin (HA) gene, partial cds 1045 1045 100% 0.0 95%
GU565035.2 Influenza A Virus (A/swine/Illinois/02940/2010(H3N2)) segment 4 hemagglutinin (HA) gene, partial cds 1045 1045 100% 0.0 95%
EU826551.2 Influenza A virus (A/mink/Nova Scotia/1055488/2007(H3N2)) segment 4 hemagglutinin (HA) gene, complete cds 1045 1045 100% 0.0 95%
CY040463.1 Influenza A virus (A/swine/Illinois/63607-2/2008(H3N2)) segment 4 sequence 1045 1045 100% 0.0 95%
CY040469.1 Influenza A virus (A/swine/Iowa/63607-13/2008(H3N2)) segment 4 sequence 1043 1043 99% 0.0 95%
FJ519976.1 Influenza A virus (A/swine/Minnesota/5947/2007(H3N2)) segment 4 hemagglutinin (HA) gene, complete cds 1041 1041 99% 0.0 95%
HM570052.1 Influenza A virus (A/swine/Iowa/03017/2010(H3N2)) segment 4 hemagglutinin (HA) gene, partial cds 1040 1040 100% 0.0 95%
CY040467.1 Influenza A virus (A/swine/Iowa/225-9/2008(H3)) segment 4 sequence 1040 1040 100% 0.0 95%
CY040484.1 Influenza A virus (A/swine/Minnesota/63607-29/2008(H3N2)) segment 4 sequence 1038 1038 100% 0.0 95%
CY040506.1 Influenza A virus (A/swine/North Carolina/63607-38/2008(H3N2)) segment 4 sequence 1036 1036 100% 0.0 95%
CY040465.1 Influenza A virus (A/swine/Illinois/63607-36/2008(H3N2)) segment 4 sequence 1036 1036 100% 0.0 95%
CY040464.1 Influenza A virus (A/swine/Illinois/63607-22/2008(H3N2)) segment 4 sequence 1036 1036 100% 0.0 95%
CY040462.1 Influenza A virus (A/swine/Illinois/63607-18/2008 (H3N2)) segment 4 sequence 1036 1036 100% 0.0 95%
JF312071.1 Influenza A virus (A/swine/Iowa/A01057188/2010(H3N2)) segment 4 hemagglutinin (HA) gene, complete cds 1031 1031 100% 0.0 95%
HQ734201.1 Influenza A virus (A/swine/Illinois/53612-6/2010(H3N2)) segment 4 hemagglutinin (HA) gene, complete cds 1031 1031 100% 0.0 95%
HQ734198.1 Influenza A virus (A/swine/Illinois/53612-5/2009(H3N2)) segment 4 hemagglutinin (HA) gene, complete cds 1031 1031 100% 0.0 95%
GU817053.1 Influenza A virus (A/swine/Minnesota/02948/2009(H3N2)) segment 4 hemagglutinin (HA) gene, partial cds 1031 1031 100% 0.0 95%
FJ519977.1 Influenza A virus (A/swine/Minnesota/7931/2007(H3N2)) segment 4 hemagglutinin (HA) gene, complete cds 1029 1029 99% 0.0 95%
JF312073.1 Influenza A virus (A/swine/Illinois/A01057088/2010(H3N2)) segment 4 hemagglutinin (HA) gene, complete cds 1027 1027 100% 0.0 95%
JF312072.1 Influenza A virus (A/swine/Illinois/A01057087/2010(H3N2)) segment 4 hemagglutinin (HA) gene, complete cds 1027 1027 100% 0.0 95%
HQ734204.1 Influenza A virus (A/swine/Illinois/53612-7/2010(H3N2)) segment 4 hemagglutinin (HA) gene, complete cds 1027 1027 100% 0.0 95%
HQ734195.1 Influenza A virus (A/swine/Illinois/53612-4/2009(H3N2)) segment 4 hemagglutinin (HA) gene, complete cds 1027 1027 100% 0.0 95%
HM778115.1 Influenza A virus (A/swine/Illinois/03040/2010(H3N2)) segment 4 hemagglutinin (HA) gene, partial cds 1027 1027 100% 0.0 95%
CY045559.1 Influenza A virus (A/swine/Kansas/015252/2009(H3N2)) segment 4 sequence 1027 1027 100% 0.0 95%
CY040478.1 Influenza A virus (A/swine/Minnesota/63607-11/2008(H3)) segment 4 sequence 1023 1023 100% 0.0 95%
HM217202.1 Influenza A virus (A/swine/Minnesota/03008/2010(H3N2)) segment 4 hemagglutinin (HA) gene, complete cds 1021 1021 100% 0.0 95%
GU289666.1 Influenza A virus (A/swine/Wisconsin/R7c/2001(H3N2)) segment 4 hemagglutinin (HA) gene, complete cds 1021 1021 100% 0.0 95%
CY086920.1 Influenza A virus (A/swine/Minnesota/239105/2009(H3N2)) hemagglutinin (HA) gene, complete cds 1018 1018 100% 0.0 95%
HM778116.1 Influenza A virus (A/swine/Illinois/03041/2010(H3N2)) segment 4 hemagglutinin (HA) gene, partial cds 1012 1012 100% 0.0 94%
GU968905.1 Influenza A virus (A/swine/Minnesota/02981/2010(H3N2)) segment 4 hemagglutinin (HA) gene, partial cds 1012 1012 100% 0.0 94%
AY779253.1 Influenza A virus (A/turkey/North Carolina/12344/03(H3N2)) hemagglutinin (HA) gene, complete cds 1012 1012 100% 0.0 94%
AY779254.1 Influenza A virus (A/turkey/Minnesota/764-2/03(H3N2)) hemagglutinin (HA) gene, complete cds 1009 1009 100% 0.0 94%
GU135891.1 Influenza A virus (A/swine/Iowa/H03BF5/2003(H3N2)) segment 4 hemagglutinin (HA) gene, complete cds 1005 1005 100% 0.0 94%
CY045551.1 Influenza A virus (A/swine/Oklahoma/001142/2009(H3N2)) segment 4 sequence 1003 1003 100% 0.0 94%
CY040511.1 Influenza A virus (A/swine/Oklahoma/225-14/2008(H3N2)) segment 4 sequence 1000 1000 100% 0.0 94%
JF316643.1 Influenza A virus (A/swine/Pennsylvania/057108-1/2010(H3N2)) segment 4 hemagglutinin (HA) gene, complete cds 994 994 100% 0.0 94%
DQ145537.1 Influenza A virus (A/swine/Minnesota/00395/2004(H3N1)) hemagglutinin gene, complete cds 994 994 100% 0.0 94%
EU422988.1 Influenza A virus (A/swine/Iowa/H03HO7/2003(H3N2)) segment 4 hemagglutinin (HA) gene, complete cds 989 989 100% 0.0 94%
CY040498.1 Influenza A virus (A/swine/North Carolina/225-7/2008(H3N2)) segment 4 sequence 976 976 100% 0.0 93%
CY035426.1 Influenza A virus (A/swine/Minnesota/SG-00237/2007(H3N2)) segment 4 sequence 976 976 100% 0.0 93%
DQ150433.1 Influenza A virus (A/swine/IN/PU542/04 (H3N1)) hemagglutinin (HA) gene, complete cds 976 976 100% 0.0 93%
AF268126.1 Influenza A virus (A/Swine/Wisconsin/14094/99(H3N2)) hemagglutinin protein gene, partial cds 976 976 100% 0.0 93%
AF268124.1 Influenza A virus (A/Swine/Illinois/21587/99(H3N2)) hemagglutinin protein gene, partial cds 976 976 100% 0.0 93%
AF268125.1 Influenza A virus (A/Swine/Oklahoma/18089/99(H3N2)) hemagglutinin protein gene, partial cds 967 967 100% 0.0 93%
AF268123.1 Influenza A virus (A/Swine/Oklahoma/18717/99(H3N2)) hemagglutinin protein gene, partial cds 967 967 100% 0.0 93%
EU301209.1 Influenza A virus (A/swine/Korea/JNS06/2004(H3N2)) hemagglutinin (HA) gene, complete cds 964 964 100% 0.0 93%
GU135918.1 Influenza A virus (A/swine/Iowa/H03HB4/2003(H3N2)) segment 4 hemagglutinin (HA) gene, complete cds 958 958 100% 0.0 93%
HQ734192.1 Influenza A virus (A/swine/Illinois/53612-3/2009(H3N2)) segment 4 hemagglutinin (HA) gene, complete cds 957 957 100% 0.0 91%
EU857004.1 Influenza A virus (A/Hong Kong/CUHK4147/1997(H3N2)) hemagglutinin (HA) gene, complete cds 955 955 100% 0.0 92%
EF551053.1 Influenza A virus (A/swine/North Carolina/2003(H3N2)) segment 4 hemagglutinin (HA) gene, complete cds 955 955 100% 0.0 92%
CY011128.1 Influenza A virus (A/New York/599/1996(H3N2)) segment 4, complete sequence 955 955 100% 0.0 92%

_________________
www.twitter.com/hniman

Top

niman

Post subject: Re: H1N1 With Swine H3N2 In Canadian Mink

Posted: Fri Mar 25, 2011 11:50 am

Joined: Wed Aug 19, 2009 10:42 am
Posts: 27330
Location: Pittsburgh, PA USA

Top 100 NA matches to swine sequence

Sequences producing significant alignments: Accession Description Max score Total score Query coverage E value Max ident Links
EU826544.2 Influenza A virus (A/swine/Quebec/4001/2005(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 2367 2367 100% 0.0 97%
DQ469976.1 Influenza A virus (A/swine/British Columbia/28103/2005(H3N2)) neuraminidase (NA) gene, complete cds 2365 2365 99% 0.0 97%
DQ469992.1 Influenza A virus (A/swine/Ontario/33853/2005(H3N2)) neuraminidase (NA) gene, complete cds 2363 2363 100% 0.0 97%
DQ469960.1 Influenza A virus (A/Ontario/RV1273/2005(H3N2)) neuraminidase (NA) gene, complete cds 2363 2363 100% 0.0 97%
DQ470000.1 Influenza A virus (A/turkey/Ontario/31232/2005(H3N2)) neuraminidase (NA) gene, complete cds 2356 2356 99% 0.0 97%
EU735820.1 Influenza A virus (A/turkey/OH/313053/2004(H3N2)) neuraminidase (NA) gene, complete cds 2345 2345 100% 0.0 96%
DQ335773.1 Influenza A virus (A/turkey/Ohio/313053/04(H3N2)) neuraminidase (NA) gene, complete cds 2345 2345 100% 0.0 96%
FJ410142.1 Influenza A virus (A/swine/Minnesota/1145/2007(H3N2)) segment 6, complete sequence 2331 2331 100% 0.0 96%
DQ469984.1 Influenza A virus (A/swine/Manitoba/12707/2005(H3N2)) neuraminidase (NA) gene, complete cds 2331 2331 100% 0.0 96%
CY045569.1 Influenza A virus (A/swine/Oklahoma/008722/2007(H3N2)) segment 6 sequence 2327 2327 100% 0.0 96%
FJ519961.1 Influenza A virus (A/swine/Minnesota/66853/2006(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 2322 2322 100% 0.0 96%
EU826553.2 Influenza A virus (A/mink/Nova Scotia/1055488/2007(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 2322 2322 100% 0.0 96%
EU735828.1 Influenza A virus (A/turkey/NC/353568/2005(H3N2)) neuraminidase (NA) gene, complete cds 2322 2322 100% 0.0 96%
EF551055.1 Influenza A virus (A/swine/North Carolina/2003(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 2322 2322 100% 0.0 96%
EF551047.1 Influenza A virus (A/turkey/Illinois/2004(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 2322 2322 100% 0.0 96%
FJ519960.1 Influenza A virus (A/swine/Minnesota/65767/2006(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 2318 2318 100% 0.0 96%
EU399753.1 Influenza A virus (A/Ontario/1252/2007(H3N2)) neuraminidase (NA) gene, complete cds 2318 2318 100% 0.0 96%
CY015830.1 Influenza A virus (A/Western Australia/44/2003(H3N2)) segment 6, complete sequence 2318 2318 100% 0.0 96%
DQ469968.1 Influenza A virus (A/swine/Alberta/14722/2005(H3N2)) neuraminidase (NA) gene, complete cds 2318 2318 100% 0.0 96%
CY001223.1 Influenza A virus (A/New York/65/2003(H3N2)) segment 6, complete sequence 2318 2318 100% 0.0 96%
CY001114.1 Influenza A virus (A/New York/27/2003(H3N2)) segment 6, complete sequence 2318 2318 100% 0.0 96%
CY001098.1 Influenza A virus (A/New York/39/2003(H3N2)) segment 6, complete sequence 2318 2318 100% 0.0 96%
CY007261.1 Influenza A virus (A/Canterbury/443/2003(H3N2)) segment 6, complete sequence 2318 2318 100% 0.0 96%
CY007237.1 Influenza A virus (A/Canterbury/440/2003(H3N2)) segment 6, complete sequence 2318 2318 100% 0.0 96%
CY007173.1 Influenza A virus (A/Canterbury/431/2003(H3N2)) segment 6, complete sequence 2318 2318 100% 0.0 96%
CY006941.1 Influenza A virus (A/Canterbury/386/2003(H3N2)) segment 6, complete sequence 2318 2318 100% 0.0 96%
CY000523.1 Influenza A virus (A/New York/29/2003(H3N2)) segment 6, complete sequence 2318 2318 100% 0.0 96%
CY000379.1 Influenza A virus (A/New York/49/2003(H3N2)) segment 6, complete sequence 2318 2318 100% 0.0 96%
CY000267.1 Influenza A virus (A/New York/53/2003(H3N2)) segment 6, complete sequence 2318 2318 100% 0.0 96%
CY000179.1 Influenza A virus (A/New York/44/2003(H3N2)) segment 6, complete sequence 2318 2318 100% 0.0 96%
CY000043.1 Influenza A virus (A/New York/34/2003(H3N2)) segment 6, complete sequence 2318 2318 100% 0.0 96%
EU103836.1 Influenza A virus (A/Denmark/4/2002(H3N2)) clone 4-02 neuraminidase (NA) gene, complete cds 2313 2313 100% 0.0 96%
EU103832.1 Influenza A virus (A/Denmark/26/2002(H3N2)) clone 26-02 neuraminidase (NA) gene, complete cds 2313 2313 100% 0.0 96%
EU103825.1 Influenza A virus (A/Denmark/01/2002(H3N2)) clone 1-02 neuraminidase (NA) gene, complete cds 2313 2313 100% 0.0 96%
CY018999.1 Influenza A virus (A/Queensland/35/2003(H3N2)) segment 6, complete sequence 2313 2313 100% 0.0 96%
CY018991.1 Influenza A virus (A/Queensland/34/2003(H3N2)) segment 6, complete sequence 2313 2313 100% 0.0 96%
CY018975.1 Influenza A virus (A/Queensland/31/2003(H3N2)) segment 6, complete sequence 2313 2313 100% 0.0 96%
CY017943.1 Influenza A virus (A/Queensland/38/2003(H3N2)) segment 6, complete sequence 2313 2313 100% 0.0 96%
CY017935.1 Influenza A virus (A/Queensland/37/2003(H3N2)) segment 6, complete sequence 2313 2313 100% 0.0 96%
CY017565.1 Influenza A virus (A/Queensland/33/2003(H3N2)) segment 6, complete sequence 2313 2313 100% 0.0 96%
CY015846.1 Influenza A virus (A/Western Australia/46/2003(H3N2)) segment 6, complete sequence 2313 2313 100% 0.0 96%
CY015798.1 Influenza A virus (A/Western Australia/40/2003(H3N2)) segment 6, complete sequence 2313 2313 100% 0.0 96%
CY013431.1 Influenza A virus (A/Waikato/15/2003(H3N2)) segment 6, complete sequence 2313 2313 100% 0.0 96%
CY013130.1 Influenza A virus (A/Waikato/53/2003(H3N2)) segment 6, complete sequence 2313 2313 100% 0.0 96%
CY012658.1 Influenza A virus (A/Wellington/47/2003(H3N2)) segment 6, complete sequence 2313 2313 100% 0.0 96%
CY012650.1 Influenza A virus (A/Wellington/9/2003(H3N2)) segment 6, complete sequence 2313 2313 100% 0.0 96%
CY012410.1 Influenza A virus (A/Waikato/139/2003(H3N2)) segment 6, complete sequence 2313 2313 100% 0.0 96%
CY012394.1 Influenza A virus (A/Waikato/129/2003(H3N2)) segment 6, complete sequence 2313 2313 100% 0.0 96%
CY012386.1 Influenza A virus (A/Waikato/122/2003(H3N2)) segment 6, complete sequence 2313 2313 100% 0.0 96%
CY012362.1 Influenza A virus (A/Waikato/29/2003(H3N2)) segment 6, complete sequence 2313 2313 100% 0.0 96%
CY012354.1 Influenza A virus (A/Waikato/156/2003(H3N2)) segment 6, complete sequence 2313 2313 100% 0.0 96%
CY012098.1 Influenza A virus (A/Waikato/150/2003(H3N2)) segment 6, complete sequence 2313 2313 100% 0.0 96%
CY012082.1 Influenza A virus (A/Waikato/91/2003(H3N2)) segment 6, complete sequence 2313 2313 100% 0.0 96%
CY012074.1 Influenza A virus (A/Waikato/154/2003(H3N2)) segment 6, complete sequence 2313 2313 100% 0.0 96%
CY011762.1 Influenza A virus (A/Waikato/75/2003(H3N2)) segment 6, complete sequence 2313 2313 100% 0.0 96%
CY011746.1 Influenza A virus (A/Wellington/28/2003(H3N2)) segment 6, complete sequence 2313 2313 100% 0.0 96%
CY011730.1 Influenza A virus (A/Waikato/3/2003(H3N2)) segment 6, complete sequence 2313 2313 100% 0.0 96%
CY011722.1 Influenza A virus (A/Wellington/10/2003(H3N2)) segment 6, complete sequence 2313 2313 100% 0.0 96%
CY011706.1 Influenza A virus (A/Wellington/4/2003(H3N2)) segment 6, complete sequence 2313 2313 100% 0.0 96%
CY011698.1 Influenza A virus (A/Wellington/3/2003(H3N2)) segment 6, complete sequence 2313 2313 100% 0.0 96%
CY009022.1 Influenza A virus (A/Canterbury/400/2003(H3N2)) segment 6, complete sequence 2313 2313 100% 0.0 96%
CY008542.1 Influenza A virus (A/Canterbury/425/2003(H3N2)) segment 6, complete sequence 2313 2313 100% 0.0 96%
CY001514.1 Influenza A virus (A/New York/58/2003(H3N2)) segment 6, complete sequence 2313 2313 100% 0.0 96%
CY000075.1 Influenza A virus (A/New York/47/2003(H3N2)) segment 6, complete sequence 2313 2313 100% 0.0 96%
CY001090.1 Influenza A virus (A/New York/24/2003(H3N2)) segment 6, complete sequence 2313 2313 100% 0.0 96%
CY007821.1 Influenza A virus (A/Canterbury/409/2003(H3N2)) segment 6, complete sequence 2313 2313 100% 0.0 96%
CY007733.1 Influenza A virus (A/Canterbury/56/2002(H3N2)) segment 6, complete sequence 2313 2313 100% 0.0 96%
CY007253.1 Influenza A virus (A/Canterbury/442/2003(H3N2)) segment 6, complete sequence 2313 2313 100% 0.0 96%
CY007245.1 Influenza A virus (A/Canterbury/441/2003(H3N2)) segment 6, complete sequence 2313 2313 100% 0.0 96%
CY007229.1 Influenza A virus (A/Canterbury/439/2003(H3N2)) segment 6, complete sequence 2313 2313 100% 0.0 96%
CY007181.1 Influenza A virus (A/South Canterbury/433/2003(H3N2)) segment 6, complete sequence 2313 2313 100% 0.0 96%
CY007165.1 Influenza A virus (A/Canterbury/430/2003(H3N2)) segment 6, complete sequence 2313 2313 100% 0.0 96%
CY007157.1 Influenza A virus (A/Canterbury/428/2003(H3N2)) segment 6, complete sequence 2313 2313 100% 0.0 96%
CY007069.1 Influenza A virus (A/Canterbury/408/2003(H3N2)) segment 6, complete sequence 2313 2313 100% 0.0 96%
CY006949.1 Influenza A virus (A/Canterbury/387/2003(H3N2)) segment 6, complete sequence 2313 2313 100% 0.0 96%
CY007189.1 Influenza A virus (A/Canterbury/434/2003(H3N2)) segment 6, complete sequence 2313 2313 100% 0.0 96%
CY007133.1 Influenza A virus (A/Canterbury/423/2003(H3N2)) segment 6, complete sequence 2313 2313 100% 0.0 96%
CY007125.1 Influenza A virus (A/Canterbury/420/2003(H3N2)) segment 6, complete sequence 2313 2313 100% 0.0 96%
CY007117.1 Influenza A virus (A/Canterbury/418/2003(H3N2)) segment 6, complete sequence 2313 2313 100% 0.0 96%
CY007093.1 Influenza A virus (A/Canterbury/412/2003(H3N2)) segment 6, complete sequence 2313 2313 100% 0.0 96%
CY007077.1 Influenza A virus (A/Canterbury/410/2003(H3N2)) segment 6, complete sequence 2313 2313 100% 0.0 96%
CY007053.1 Influenza A virus (A/Canterbury/405/2003(H3N2)) segment 6, complete sequence 2313 2313 100% 0.0 96%
CY007037.1 Influenza A virus (A/Canterbury/403/2003(H3N2)) segment 6, complete sequence 2313 2313 100% 0.0 96%
CY007005.1 Influenza A virus (A/Canterbury/397/2003(H3N2)) segment 6, complete sequence 2313 2313 100% 0.0 96%
CY006997.1 Influenza A virus (A/Canterbury/395/2003(H3N2)) segment 6, complete sequence 2313 2313 100% 0.0 96%
CY006989.1 Influenza A virus (A/Canterbury/394/2003(H3N2)) segment 6, complete sequence 2313 2313 100% 0.0 96%
CY006981.1 Influenza A virus (A/Canterbury/393/2003(H3N2)) segment 6, complete sequence 2313 2313 100% 0.0 96%
CY006973.1 Influenza A virus (A/Canterbury/392/2003(H3N2)) segment 6, complete sequence 2313 2313 100% 0.0 96%
CY006965.1 Influenza A virus (A/Canterbury/391/2003(H3N2)) segment 6, complete sequence 2313 2313 100% 0.0 96%
CY006957.1 Influenza A virus (A/Canterbury/390/2003(H3N2)) segment 6, complete sequence 2313 2313 100% 0.0 96%
CY006933.1 Influenza A virus (A/Canterbury/384/2003(H3N2)) segment 6, complete sequence 2313 2313 100% 0.0 96%
CY006925.1 Influenza A virus (A/Canterbury/382/2003(H3N2)) segment 6, complete sequence 2313 2313 100% 0.0 96%
CY000787.1 Influenza A virus (A/New York/46/2003(H3N2)) segment 6, complete sequence 2313 2313 100% 0.0 96%
CY000771.1 Influenza A virus (A/New York/25/2003(H3N2)) segment 6, complete sequence 2313 2313 99% 0.0 96%
CY000371.1 Influenza A virus (A/New York/31/2004(H3N2)) segment 6, complete sequence 2313 2313 100% 0.0 96%
CY000363.1 Influenza A virus (A/New York/22/2003(H3N2)) segment 6, complete sequence 2313 2313 100% 0.0 96%
CY000355.1 Influenza A virus (A/New York/21/2003(H3N2)) segment 6, complete sequence 2313 2313 100% 0.0 96%
CY000347.1 Influenza A virus (A/New York/15/2003(H3N2)) segment 6, complete sequence 2313 2313 100% 0.0 96%
CY038593.1 Influenza A virus (A/Hong Kong/HKU12/2004(H3N2)) segment 6, complete sequence 2309 2309 100% 0.0 96%
EU743212.1 Influenza A virus (A/turkey/MN/366767/2005(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 2309 2309 100% 0.0 96%

_________________
www.twitter.com/hniman

Top

niman

Post subject: Re: H1N1 With Swine H3N2 In Canadian Mink

Posted: Fri Mar 25, 2011 11:50 am

Joined: Wed Aug 19, 2009 10:42 am
Posts: 27330
Location: Pittsburgh, PA USA

Top 100 MP matches

CY087209.1 Influenza A virus (A/Texas/JMS368/2009(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1361 1361 100% 0.0 99%
CY087001.1 Influenza A virus (A/New York/3256/2009(N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1361 1361 100% 0.0 99%
CY086994.1 Influenza A virus (A/New York/3251/2009(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1361 1361 100% 0.0 99%
CY086978.1 Influenza A virus (A/New York/3217/2009(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1361 1361 100% 0.0 99%
CY086970.1 Influenza A virus (A/New York/3198/2009(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1361 1361 100% 0.0 99%
CY086931.1 Influenza A virus (A/swine/Minnesota/239106/2010(H1N2)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1361 1361 100% 0.0 99%
CY086915.1 Influenza A virus (A/swine/Minnesota/226128/2010(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1361 1361 100% 0.0 99%
CY040718.2 Influenza A virus (A/New York/3238/2009(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1361 1361 100% 0.0 99%
CY084463.1 Influenza A virus (A/New York/6537/2009(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1361 1361 100% 0.0 99%
CY083943.1 Influenza A virus (A/San Diego/INS194/2009(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1361 1361 100% 0.0 99%
CY083927.1 Influenza A virus (A/Warsaw/INS148/2009(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1361 1361 100% 0.0 99%
CY083911.1 Influenza A virus (A/Aalborg/INS132/2009(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1361 1361 100% 0.0 99%
CY083887.1 Influenza A virus (A/San Diego/INS72/2009(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1361 1361 100% 0.0 99%
CY083879.1 Influenza A virus (A/San Diego/INS50/2009(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1361 1361 100% 0.0 99%
CY083847.1 Influenza A virus (A/District of Columbia/INS23/2009(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1361 1361 100% 0.0 99%
CY083839.1 Influenza A virus (A/San Diego/INS14/2009(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1361 1361 100% 0.0 99%
CY083831.1 Influenza A virus (A/San Diego/INS07/2009(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1361 1361 100% 0.0 99%
CY083826.1 Influenza A virus (A/Wroclaw/INS435/2009(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1361 1361 100% 0.0 99%
CY083818.1 Influenza A virus (A/Los Angeles/INS423/2010(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1361 1361 100% 0.0 99%
CY083795.1 Influenza A virus (A/Athens/INS328/2009) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1361 1361 100% 0.0 99%
CY083769.1 Influenza A virus (A/Athens/INS256/2009(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1361 1361 100% 0.0 99%
CY083730.1 Influenza A virus (A/Bochum/INS120/2009(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1361 1361 100% 0.0 99%
CY083722.1 Influenza A virus (A/District of Columbia/INS115/2009(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1361 1361 100% 0.0 99%
CY083714.1 Influenza A virus (A/Madrid/INS112/2009(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1361 1361 100% 0.0 99%
CY083691.1 Influenza A virus (A/Terrassa/INS94/2009(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1361 1361 100% 0.0 99%
CY083678.1 Influenza A virus (A/Madrid/INS77/2009(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1361 1361 100% 0.0 99%
CY083662.1 Influenza A virus (A/San Diego/INS41/2009(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1361 1361 100% 0.0 99%
CY083656.1 Influenza A virus (A/San Diego/INS36/2009(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1361 1361 100% 0.0 99%
CY083648.1 Influenza A virus (A/District of Columbia/INS22/2009(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1361 1361 100% 0.0 99%
CY083640.1 Influenza A virus (A/San Diego/INS13/2009(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1361 1361 100% 0.0 99%
CY083618.1 Influenza A virus (A/Lima/WRAIR9202F/2009(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1361 1361 100% 0.0 99%
CY083578.1 Influenza A virus (A/Lima/WRAIR8648F/2009(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1361 1361 100% 0.0 99%
CY083570.1 Influenza A virus (A/Lima/WRAIR8511F/2009(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1361 1361 100% 0.0 99%
CY083562.1 Influenza A virus (A/Budapest/WRAIR2411N/2009(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1361 1361 100% 0.0 99%
CY083546.1 Influenza A virus (A/Budapest/WRAIR2393N/2009(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1361 1361 100% 0.0 99%
CY083522.1 Influenza A virus (A/Lima/WRAIR1695P/2009(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1361 1361 100% 0.0 99%
CY083514.1 Influenza A virus (A/Piura/WRAIR1694P/2009(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1361 1361 100% 0.0 99%
CY083498.1 Influenza A virus (A/Chicago/WRAIR1691P/2009(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1361 1361 100% 0.0 99%
CY083490.1 Influenza A virus (A/Mexico City/WRAIR1691N/2009(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1361 1361 100% 0.0 99%
CY083450.1 Influenza A virus (A/Mexico City/WRAIR1679N/2009(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1361 1361 100% 0.0 99%
CY083426.1 Influenza A virus (A/San Diego/WRAIR1667P/2009(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1361 1361 100% 0.0 99%
CY083418.1 Influenza A virus (A/San Diego/WRAIR1666P/2009(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1361 1361 100% 0.0 99%
CY083394.1 Influenza A virus (A/San Diego/WRAIR1663P/2009(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1361 1361 100% 0.0 99%
CY083386.1 Influenza A virus (A/San Diego/WRAIR1662P/2009(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1361 1361 100% 0.0 99%
CY083378.1 Influenza A virus (A/Pendleton/WRAIR1661P/2009(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1361 1361 100% 0.0 99%
CY083362.1 Influenza A virus (A/San Diego/WRAIR1658P/2009(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1361 1361 100% 0.0 99%
CY083347.1 Influenza A virus (A/San Diego/WRAIR1656P/2009(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1361 1361 100% 0.0 99%
CY083323.1 Influenza A virus (A/Great Lakes/WRAIR1652P/2009(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1361 1361 100% 0.0 99%
CY083315.1 Influenza A virus (A/San Diego/WRAIR1649P/2009(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1361 1361 100% 0.0 99%
CY083267.1 Influenza A virus (A/San Diego/WRAIR1643P/2009(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1361 1361 100% 0.0 99%
CY083259.1 Influenza A virus (A/San Diego/WRAIR1642P/2009(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1361 1361 100% 0.0 99%
CY083243.1 Influenza A virus (A/Virginia/WRAIR1511P/2009(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1361 1361 100% 0.0 99%
CY083227.1 Influenza A virus (A/California/WRAIR1507P/2009(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1361 1361 100% 0.0 99%
CY083195.1 Influenza A virus (A/California/WRAIR1502P/2009(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1361 1361 100% 0.0 99%
CY083147.1 Influenza A virus (A/Bishkek/WRAIR0883N/2009(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1361 1361 100% 0.0 99%
CY083139.1 Influenza A virus (A/Lima/WRAIR0681F/2009(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1361 1361 100% 0.0 99%
CY083107.1 Influenza A virus (A/Piura/WRAIR0603F/2009(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1361 1361 100% 0.0 99%
CY083099.1 Influenza A virus (A/Lima/WRAIR0519F/2009(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1361 1361 100% 0.0 99%
CY083051.1 Influenza A virus (A/Lima/WRAIR0285F/2009(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1361 1361 100% 0.0 99%
CY081568.1 Influenza A virus (A/swine/South Dakota/4/2010(H1N2)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1361 1361 100% 0.0 99%
CY080427.1 Influenza A virus (A/swine/VIC/09-02767-01/2009(H1N1)) segment 7 sequence 1361 1361 100% 0.0 99%
HQ239621.1 Influenza A virus (A/Canada-NB/RV0005-10/2009(H1N1)) segment 7 matrix protein 2 (M2) gene, partial cds; and matrix protein 1 (M1) gene, complete cds 1361 1361 100% 0.0 99%
CY080326.1 Influenza A virus (A/Thailand/CU-H1786/2010(H1N1)) segment 7 sequence 1361 1361 100% 0.0 99%
HQ840322.1 Influenza A virus (A/swine/Minnesota/165A/2009(H1N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1361 1361 100% 0.0 99%
HQ840314.1 Influenza A virus (A/swine/Minnesota/136B/2009(H1N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1361 1361 100% 0.0 99%
HQ840301.1 Influenza A virus (A/swine/Minnesota/130A/2009(H1N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1361 1361 100% 0.0 99%
HQ840293.1 Influenza A virus (A/swine/Minnesota/074A/2009(H1N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1361 1361 100% 0.0 99%
HQ728113.1 Influenza A virus (A/swine/Taiwan/CH-1204/2009(H1N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1361 1361 100% 0.0 99%
HQ728105.1 Influenza A virus (A/swine/Taiwan/PT-1204/2009(H1N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1361 1361 100% 0.0 99%
HQ661365.1 Influenza A virus (A/Russia/01-MA/2009(H1N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1361 1361 100% 0.0 99%
CY076719.1 Influenza A virus (A/ferret/Washington/WADDL13230/2009(H1N1)) segment 7 sequence 1361 1361 100% 0.0 99%
CY075867.1 Influenza A virus (A/swine/Argentina/CIP051-StaFeN2/2010(H1N2)) segment 7 sequence 1361 1361 100% 0.0 99%
HQ393496.1 Influenza A virus (A/swine/Taiwan/TD-2542/2010(H1N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1361 1361 100% 0.0 99%
CY075637.1 Influenza A virus (A/Boston/703/2009(H1N1)) segment 7, complete sequence 1361 1361 100% 0.0 99%
CY075629.1 Influenza A virus (A/Boston/701/2009(H1N1)) segment 7, complete sequence 1361 1361 100% 0.0 99%
CY075621.1 Influenza A virus (A/Boston/698/2009(H1N1)) segment 7, complete sequence 1361 1361 100% 0.0 99%
CY075613.1 Influenza A virus (A/Boston/682/2009(H1N1)) segment 7, complete sequence 1361 1361 100% 0.0 99%
CY075597.1 Influenza A virus (A/Boston/672/2009(H1N1)) segment 7, complete sequence 1361 1361 100% 0.0 99%
CY075573.1 Influenza A virus (A/Boston/658/2009(H1N1)) segment 7, complete sequence 1361 1361 100% 0.0 99%
CY075557.1 Influenza A virus (A/Boston/653/2009(H1N1)) segment 7, complete sequence 1361 1361 100% 0.0 99%
CY075549.1 Influenza A virus (A/Boston/648/2009(H1N1)) segment 7, complete sequence 1361 1361 100% 0.0 99%
CY075525.1 Influenza A virus (A/Boston/606/2009(H1N1)) segment 7, complete sequence 1361 1361 100% 0.0 99%
CY075517.1 Influenza A virus (A/Boston/602/2009(H1N1)) segment 7, complete sequence 1361 1361 100% 0.0 99%
CY075509.1 Influenza A virus (A/Boston/595/2009(H1N1)) segment 7, complete sequence 1361 1361 100% 0.0 99%
CY075493.1 Influenza A virus (A/Boston/584/2009(H1N1)) segment 7, complete sequence 1361 1361 100% 0.0 99%
HQ291551.1 Influenza A virus (A/swine/IL/27486-2/2010(H1N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1361 1361 100% 0.0 99%
HQ291548.1 Influenza A virus (A/swine/IL/27486-1/2010(H1N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1361 1361 100% 0.0 99%
HQ291542.1 Influenza A virus (A/swine/IL/25399-3/2010(H1N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1361 1361 100% 0.0 99%
HQ291536.1 Influenza A virus (A/swine/MO/23881/2010(H1N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1361 1361 100% 0.0 99%
CY075396.1 Influenza A virus (A/Chile/3766/2009(H1N1)) segment 7, complete sequence 1361 1361 100% 0.0 99%
CY075356.1 Influenza A virus (A/Chile/3375/2009(H1N1)) segment 7, complete sequence 1361 1361 100% 0.0 99%
CY075348.1 Influenza A virus (A/Chile/3369/2009(H1N1)) segment 7, complete sequence 1361 1361 100% 0.0 99%
HQ214453.1 Influenza A virus (A/Kenya/0027/2009(H1N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1361 1361 100% 0.0 99%
HQ214452.1 Influenza A virus (A/Kenya/0026/2009(H1N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1361 1361 100% 0.0 99%
HQ214451.1 Influenza A virus (A/Kenya/0013/2009(H1N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1361 1361 100% 0.0 99%
HQ214450.1 Influenza A virus (A/Kenya/0048/2009(H1N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1361 1361 100% 0.0 99%
HQ214446.1 Influenza A virus (A/Kenya/0028/2009(H1N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1361 1361 100% 0.0 99%
HQ214443.1 Influenza A virus (A/Kenya/0002/2009(H1N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1361 1361 100% 0.0 99%
HQ214442.1 Influenza A virus (A/Kenya/0023/2009(H1N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1361 1361 100% 0.0 99%
HQ214434.1 Influenza A virus (A/Kenya/0012/2009(H1N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1361 1361 100% 0.0 99%

_________________
www.twitter.com/hniman

Top

niman

Post subject: Re: H1N1 With Swine H3N2 In Canadian Mink

Posted: Fri Mar 25, 2011 11:51 am

Joined: Wed Aug 19, 2009 10:42 am
Posts: 27330
Location: Pittsburgh, PA USA

Top 100 PB2 matches

HQ240860.1 Influenza A virus (A/Canada-NFL/RV3019/2009(H1N1)) segment 2 polymerase PB1 (PB1) gene, partial cds; and nonfunctional PB1-F2 protein (PB1-F2) gene, complete sequence 4082 4082 100% 0.0 99%
HQ240826.1 Influenza A virus (A/Canada-SK/RV2926/2009(H1N1)) segment 2 polymerase PB1 (PB1) gene, partial cds; and nonfunctional PB1-F2 protein (PB1-F2) gene, complete sequence 4082 4082 100% 0.0 99%
HQ240853.1 Influenza A virus (A/Canada-ON/RV2964/2009(H1N1)) segment 2 polymerase PB1 (PB1) gene, partial cds; and nonfunctional PB1-F2 protein (PB1-F2) gene, complete sequence 4080 4080 100% 0.0 99%
CY083533.1 Influenza A virus (A/Mexico City/WRAIR1752N/2010(H1N1)) polymerase PB1 (PB1) gene, complete cds; and PB1-F2 gene, complete sequence 4078 4078 100% 0.0 99%
CY060572.1 Influenza A virus (A/Ontario/29801/2009(H1N1)) segment 2 sequence 4078 4078 100% 0.0 99%
CY083493.1 Influenza A virus (A/Chicago/WRAIR1691P/2009(H1N1)) polymerase PB1 (PB1) gene, complete cds; and PB1-F2 gene, complete sequence 4073 4073 100% 0.0 99%
CY066773.1 Influenza A virus (A/Pensacola/INS212/2009(H1N1)) segment 2, complete sequence 4073 4073 100% 0.0 99%
CY063281.1 Influenza A virus (A/Wisconsin/629-D00888/2009(H1N1)) segment 2, complete sequence 4073 4073 100% 0.0 99%
CY060929.1 Influenza A virus (A/Texas/JMS371/2009(H1N1)) segment 2, complete sequence 4073 4073 100% 0.0 99%
CY060556.1 Influenza A virus (A/Ontario/26184/2009(H1N1)) segment 2 sequence 4073 4073 100% 0.0 99%
CY057932.1 Influenza A virus (A/Wisconsin/629-D01190/2009(H1N1)) segment 2, complete sequence 4073 4073 100% 0.0 99%
CY057900.1 Influenza A virus (A/Wisconsin/629-D00908/2009(H1N1)) segment 2, complete sequence 4073 4073 100% 0.0 99%
CY057724.1 Influenza A virus (A/Wisconsin/629-D02317/2009(H1N1)) segment 2, complete sequence 4073 4073 100% 0.0 99%
CY050041.2 Influenza A virus (A/Mexico City/WR1310N/2009(H1N1)) segment 2 sequence 4073 4073 100% 0.0 99%
HQ240808.1 Influenza A virus (A/Canada-ON/RV2887/2009(H1N1)) segment 2 polymerase PB1 (PB1) gene, partial cds; and nonfunctional PB1-F2 protein (PB1-F2) gene, complete sequence 4069 4069 100% 0.0 99%
HQ240806.1 Influenza A virus (A/Canada-AB/RV2854/2009(H1N1)) segment 2 polymerase PB1 (PB1) gene, partial cds; and nonfunctional PB1-F2 protein (PB1-F2) gene, complete sequence 4069 4069 100% 0.0 99%
CY071744.1 Influenza A virus (A/Mexico City/WR1704T/2009(H1N1)) segment 2 sequence 4069 4069 100% 0.0 99%
CY067093.1 Influenza A virus (A/Athens/INS261/2009(H1N1)) segment 2, complete sequence 4069 4069 100% 0.0 99%
CY066949.1 Influenza A virus (A/Aarhus/INS237/2009(H1N1)) segment 2, complete sequence 4069 4069 100% 0.0 99%
CY066493.1 Influenza A virus (A/California/VRDL7/2010(H1N1)) segment 2, complete sequence 4069 4069 100% 0.0 99%
CY063273.1 Influenza A virus (A/Wisconsin/629-D02082/2009(H1N1)) segment 2, complete sequence 4069 4069 100% 0.0 99%
CY063145.1 Influenza A virus (A/California/VRDL98/2009(H1N1)) segment 2, complete sequence 4069 4069 100% 0.0 99%
CY062729.1 Influenza A virus (A/Athens/INS125/2009(H1N1)) segment 2, complete sequence 4069 4069 100% 0.0 99%
CY061928.1 Influenza A virus (A/New York/6937/2009(H1N1)) segment 2, complete sequence 4069 4069 100% 0.0 99%
CY061265.1 Influenza A virus (A/San Diego/INS105/2009(H1N1)) segment 2, complete sequence 4069 4069 100% 0.0 99%
CY058450.1 Influenza A virus (A/Wisconsin/629-D02073/2009(H1N1)) segment 2, complete sequence 4069 4069 100% 0.0 99%
CY058362.1 Influenza A virus (A/Wisconsin/629-D02489/2009(H1N1)) segment 2, complete sequence 4069 4069 100% 0.0 99%
CY057268.1 Influenza A virus (A/New York/5196/2009(H1N1)) segment 2, complete sequence 4069 4069 100% 0.0 99%
CY050057.2 Influenza A virus (A/Mexico City/WR1312N/2009(H1N1)) segment 2 sequence 4069 4069 100% 0.0 99%
CY066957.1 Influenza A virus (A/Aarhus/INS238/2009(H1N1)) segment 2, complete sequence 4066 4066 100% 0.0 99%
HQ698625.1 Influenza A virus (A/Beijing/16/2009(H1N1)) segment 2 polymerase PB1 (PB1) gene, complete cds; and nonfunctional PB1-F2 protein (PB1-F2) gene, complete sequence 4064 4064 100% 0.0 99%
CY086999.1 Influenza A virus (A/New York/3251/2009(H1N1)) polymerase PB1 (PB1) gene, complete cds; and PB1-F2 gene, complete sequence 4064 4064 100% 0.0 99%
CY086983.1 Influenza A virus (A/New York/3217/2009(H1N1)) polymerase PB1 (PB1) gene, complete cds; and PB1-F2 gene, complete sequence 4064 4064 100% 0.0 99%
CY086975.1 Influenza A virus (A/New York/3198/2009(H1N1)) polymerase PB1 (PB1) gene, complete cds; and PB1-F2 gene, complete sequence 4064 4064 100% 0.0 99%
CY040723.2 Influenza A virus (A/New York/3238/2009(H1N1)) polymerase PB1 (PB1) gene, complete cds; and PB1-F2 gene, complete sequence 4064 4064 100% 0.0 99%
CY083868.1 Influenza A virus (A/District of Columbia/INS47/2009(H1N1)) polymerase PB1 (PB1) gene, complete cds; and PB1-F2 gene, complete sequence 4064 4064 100% 0.0 99%
CY083485.1 Influenza A virus (A/Mexico City/WRAIR1691N/2009(H1N1)) polymerase PB1 (PB1) gene, complete cds; and PB1-F2 gene, complete sequence 4064 4064 100% 0.0 99%
CY083286.1 Influenza A virus (A/San Diego/WRAIR1646P/2009(H1N1)) polymerase PB1 (PB1) gene, complete cds; and PB1-F2 gene, complete sequence 4064 4064 100% 0.0 99%
CY083238.1 Influenza A virus (A/Virginia/WRAIR1511P/2009(H1N1)) polymerase PB1 (PB1) gene, complete cds; and PB1-F2 gene, complete sequence 4064 4064 100% 0.0 99%
CY083222.1 Influenza A virus (A/California/WRAIR1507P/2009(H1N1)) polymerase PB1 (PB1) gene, complete cds; and PB1-F2 gene, complete sequence 4064 4064 100% 0.0 99%
CY083086.1 Influenza A virus (A/Bogota/WRAIR0442T/2009(H1N1)) polymerase PB1 (PB1) gene, complete cds; and PB1-F2 gene, complete sequence 4064 4064 100% 0.0 99%
HQ240862.1 Influenza A virus (A/Canada-MB/RV3607/2009(H1N1)) segment 2 polymerase PB1 (PB1) gene, partial cds; and nonfunctional PB1-F2 protein (PB1-F2) gene, complete sequence 4064 4064 100% 0.0 99%
HQ240851.1 Influenza A virus (A/Canada-ON/RV2962/2009(H1N1)) segment 2 polymerase PB1 (PB1) gene, partial cds; and nonfunctional PB1-F2 protein (PB1-F2) gene, complete sequence 4064 4064 100% 0.0 99%
HQ240825.1 Influenza A virus (A/Canada-SK/RV2925/2009(H1N1)) segment 2 polymerase PB1 (PB1) gene, partial cds; and nonfunctional PB1-F2 protein (PB1-F2) gene, complete sequence 4064 4064 100% 0.0 99%
HQ240811.1 Influenza A virus (A/Canada-ON/RV2890/2009(H1N1)) segment 2 polymerase PB1 (PB1) gene, partial cds; and nonfunctional PB1-F2 protein (PB1-F2) gene, complete sequence 4064 4064 100% 0.0 99%
HQ240783.1 Influenza A virus (A/Canada-MB/RV2661/2009(H1N1)) segment 2 polymerase PB1 (PB1) gene, partial cds; and nonfunctional PB1-F2 protein (PB1-F2) gene, complete sequence 4064 4064 100% 0.0 99%
HQ240779.1 Influenza A virus (A/Canada-NFL/RV2513/2009(H1N1)) segment 2 polymerase PB1 (PB1) gene, partial cds; and nonfunctional PB1-F2 protein (PB1-F2) gene, complete sequence 4064 4064 100% 0.0 99%
HQ240772.1 Influenza A virus (A/Canada-NFL/RV2504/2009(H1N1)) segment 2 polymerase PB1 (PB1) gene, partial cds; and nonfunctional PB1-F2 protein (PB1-F2) gene, complete sequence 4064 4064 100% 0.0 99%
HQ240759.1 Influenza A virus (A/Canada-NB/RV2431/2009(H1N1)) segment 2 polymerase PB1 (PB1) gene, partial cds; and nonfunctional PB1-F2 protein (PB1-F2) gene, complete sequence 4064 4064 100% 0.0 99%
HQ240758.1 Influenza A virus (A/Canada-MB/RV2291/2009(H1N1)) segment 2 polymerase PB1 (PB1) gene, partial cds; and nonfunctional PB1-F2 protein (PB1-F2) gene, complete sequence 4064 4064 100% 0.0 99%
HQ240757.1 Influenza A virus (A/Canada-NB/RV2276/2009(H1N1)) segment 2 polymerase PB1 (PB1) gene, partial cds; and nonfunctional PB1-F2 protein (PB1-F2) gene, complete sequence 4064 4064 100% 0.0 99%
HQ240745.1 Influenza A virus (A/Canada-MB/RV2076p/2009(H1N1)) segment 2 polymerase PB1 (PB1) gene, partial cds; and nonfunctional PB1-F2 protein (PB1-F2) gene, complete sequence 4064 4064 100% 0.0 99%
HQ240744.1 Influenza A virus (A/Canada-MB/RV2076i/2009(H1N1)) segment 2 polymerase PB1 (PB1) gene, partial cds; and nonfunctional PB1-F2 protein (PB1-F2) gene, complete sequence 4064 4064 100% 0.0 99%
HQ240741.1 Influenza A virus (A/Canada-MB/RV2066p/2009(H1N1)) segment 2 polymerase PB1 (PB1) gene, partial cds; and nonfunctional PB1-F2 protein (PB1-F2) gene, complete sequence 4064 4064 100% 0.0 99%
HQ240740.1 Influenza A virus (A/Canada-MB/RV2066i/2009(H1N1)) segment 2 polymerase PB1 (PB1) gene, partial cds; and nonfunctional PB1-F2 protein (PB1-F2) gene, complete sequence 4064 4064 100% 0.0 99%
HQ240728.1 Influenza A virus (A/Canada-MB/RV2045-10/2009(H1N1)) segment 2 polymerase PB1 (PB1) gene, partial cds; and nonfunctional PB1-F2 protein (PB1-F2) gene, complete sequence 4064 4064 100% 0.0 99%
HQ240727.1 Influenza A virus (A/Canada-MB/RV2044-10/2009(H1N1)) segment 2 polymerase PB1 (PB1) gene, partial cds; and nonfunctional PB1-F2 protein (PB1-F2) gene, complete sequence 4064 4064 100% 0.0 99%
HQ240726.1 Influenza A virus (A/Canada-MB/RV2044/2009(H1N1)) segment 2 polymerase PB1 (PB1) gene, partial cds; and nonfunctional PB1-F2 protein (PB1-F2) gene, complete sequence 4064 4064 100% 0.0 99%
HQ240725.1 Influenza A virus (A/Canada-MB/RV2043-10/2009(H1N1)) segment 2 polymerase PB1 (PB1) gene, partial cds; and nonfunctional PB1-F2 protein (PB1-F2) gene, complete sequence 4064 4064 100% 0.0 99%
HQ240724.1 Influenza A virus (A/Canada-MB/RV2043/2009(H1N1)) segment 2 polymerase PB1 (PB1) gene, partial cds; and nonfunctional PB1-F2 protein (PB1-F2) gene, complete sequence 4064 4064 100% 0.0 99%
HQ240723.1 Influenza A virus (A/Canada-MB/RV2042-10/2009(H1N1)) segment 2 polymerase PB1 (PB1) gene, partial cds; and nonfunctional PB1-F2 protein (PB1-F2) gene, complete sequence 4064 4064 100% 0.0 99%
HQ240722.1 Influenza A virus (A/Canada-MB/RV2042p/2009(H1N1)) segment 2 polymerase PB1 (PB1) gene, partial cds; and nonfunctional PB1-F2 protein (PB1-F2) gene, complete sequence 4064 4064 100% 0.0 99%
HQ240721.1 Influenza A virus (A/Canada-MB/RV2042i/2009(H1N1)) segment 2 polymerase PB1 (PB1) gene, partial cds; and nonfunctional PB1-F2 protein (PB1-F2) gene, complete sequence 4064 4064 100% 0.0 99%
HQ240720.1 Influenza A virus (A/Canada-MB/RV2041-10/2009(H1N1)) segment 2 polymerase PB1 (PB1) gene, partial cds; and nonfunctional PB1-F2 protein (PB1-F2) gene, complete sequence 4064 4064 100% 0.0 99%
HQ240719.1 Influenza A virus (A/Canada-MB/RV2041/2009(H1N1)) segment 2 polymerase PB1 (PB1) gene, partial cds; and nonfunctional PB1-F2 protein (PB1-F2) gene, complete sequence 4064 4064 100% 0.0 99%
HQ240718.1 Influenza A virus (A/Canada-MB/RV2040-10/2009(H1N1)) segment 2 polymerase PB1 (PB1) gene, partial cds; and nonfunctional PB1-F2 protein (PB1-F2) gene, complete sequence 4064 4064 100% 0.0 99%
HQ240717.1 Influenza A virus (A/Canada-MB/RV2040/2009(H1N1)) segment 2 polymerase PB1 (PB1) gene, partial cds; and nonfunctional PB1-F2 protein (PB1-F2) gene, complete sequence 4064 4064 100% 0.0 99%
HQ240716.1 Influenza A virus (A/Canada-MB/RV2039-10/2009(H1N1)) segment 2 polymerase PB1 (PB1) gene, partial cds; and nonfunctional PB1-F2 protein (PB1-F2) gene, complete sequence 4064 4064 100% 0.0 99%
HQ240715.1 Influenza A virus (A/Canada-MB/RV2038-10/2009(H1N1)) segment 2 polymerase PB1 (PB1) gene, partial cds; and nonfunctional PB1-F2 protein (PB1-F2) gene, complete sequence 4064 4064 100% 0.0 99%
HQ240714.1 Influenza A virus (A/Canada-MB/RV2037-10/2009(H1N1)) segment 2 polymerase PB1 (PB1) gene, partial cds; and nonfunctional PB1-F2 protein (PB1-F2) gene, complete sequence 4064 4064 100% 0.0 99%
HQ240713.1 Influenza A virus (A/Canada-MB/RV2036-10/2009(H1N1)) segment 2 polymerase PB1 (PB1) gene, partial cds; and nonfunctional PB1-F2 protein (PB1-F2) gene, complete sequence 4064 4064 100% 0.0 99%
HQ240712.1 Influenza A virus (A/Canada-MB/RV2034-10/2009(H1N1)) segment 2 polymerase PB1 (PB1) gene, partial cds; and nonfunctional PB1-F2 protein (PB1-F2) gene, complete sequence 4064 4064 100% 0.0 99%
HQ240711.1 Influenza A virus (A/Canada-MB/RV2033-10/2009(H1N1)) segment 2 polymerase PB1 (PB1) gene, partial cds; and nonfunctional PB1-F2 protein (PB1-F2) gene, complete sequence 4064 4064 100% 0.0 99%
HQ240710.1 Influenza A virus (A/Canada-MB/RV2032-10/2009(H1N1)) segment 2 polymerase PB1 (PB1) gene, partial cds; and nonfunctional PB1-F2 protein (PB1-F2) gene, complete sequence 4064 4064 100% 0.0 99%
HQ240709.1 Influenza A virus (A/Canada-MB/RV2031-10/2009(H1N1)) segment 2 polymerase PB1 (PB1) gene, partial cds; and nonfunctional PB1-F2 protein (PB1-F2) gene, complete sequence 4064 4064 100% 0.0 99%
HQ240708.1 Influenza A virus (A/Canada-MB/RV2030-10/2009(H1N1)) segment 2 polymerase PB1 (PB1) gene, partial cds; and nonfunctional PB1-F2 protein (PB1-F2) gene, complete sequence 4064 4064 100% 0.0 99%
HQ240707.1 Influenza A virus (A/Canada-MB/RV2029-10/2009(H1N1)) segment 2 polymerase PB1 (PB1) gene, partial cds; and nonfunctional PB1-F2 protein (PB1-F2) gene, complete sequence 4064 4064 100% 0.0 99%
HQ240706.1 Influenza A virus (A/Canada-MB/RV2028-10/2009(H1N1)) segment 2 polymerase PB1 (PB1) gene, partial cds; and nonfunctional PB1-F2 protein (PB1-F2) gene, complete sequence 4064 4064 100% 0.0 99%
HQ240705.1 Influenza A virus (A/Canada-MB/RV2027-10/2009(H1N1)) segment 2 polymerase PB1 (PB1) gene, partial cds; and nonfunctional PB1-F2 protein (PB1-F2) gene, complete sequence 4064 4064 100% 0.0 99%
HQ240704.1 Influenza A virus (A/Canada-MB/RV2026-10/2009(H1N1)) segment 2 polymerase PB1 (PB1) gene, partial cds; and nonfunctional PB1-F2 protein (PB1-F2) gene, complete sequence 4064 4064 100% 0.0 99%
HQ240702.1 Influenza A virus (A/Canada-ON/RV2017/2010(H1N1)) segment 2 polymerase PB1 (PB1) gene, partial cds; and nonfunctional PB1-F2 protein (PB1-F2) gene, complete sequence 4064 4064 100% 0.0 99%
HQ240701.1 Influenza A virus (A/Canada-ON/RV2016/2010(H1N1)) segment 2 polymerase PB1 (PB1) gene, partial cds; and nonfunctional PB1-F2 protein (PB1-F2) gene, complete sequence 4064 4064 100% 0.0 99%
HQ240700.1 Influenza A virus (A/Canada-ON/RV2015/2010(H1N1)) segment 2 polymerase PB1 (PB1) gene, partial cds; and nonfunctional PB1-F2 protein (PB1-F2) gene, complete sequence 4064 4064 100% 0.0 99%
HQ240699.1 Influenza A virus (A/Canada-MB/RV2015/2009(H1N1)) segment 2 polymerase PB1 (PB1) gene, partial cds; and nonfunctional PB1-F2 protein (PB1-F2) gene, complete sequence 4064 4064 100% 0.0 99%
HQ240698.1 Influenza A virus (A/Canada-MB/RV2014-10/2009(H1N1)) segment 2 polymerase PB1 (PB1) gene, partial cds; and nonfunctional PB1-F2 protein (PB1-F2) gene, complete sequence 4064 4064 100% 0.0 99%
HQ240696.1 Influenza A virus (A/Canada-MB/RV2012-10/2009(H1N1)) segment 2 polymerase PB1 (PB1) gene, partial cds; and nonfunctional PB1-F2 protein (PB1-F2) gene, complete sequence 4064 4064 100% 0.0 99%
HQ240695.1 Influenza A virus (A/Canada-MB/RV2011-10/2009(H1N1)) segment 2 polymerase PB1 (PB1) gene, partial cds; and nonfunctional PB1-F2 protein (PB1-F2) gene, complete sequence 4064 4064 100% 0.0 99%
HQ240692.1 Influenza A virus (A/Canada-MB/RV2007-10/2009(H1N1)) segment 2 polymerase PB1 (PB1) gene, partial cds; and nonfunctional PB1-F2 protein (PB1-F2) gene, complete sequence 4064 4064 100% 0.0 99%
HQ240691.1 Influenza A virus (A/Canada-MB/RV2006-10/2009(H1N1)) segment 2 polymerase PB1 (PB1) gene, partial cds; and nonfunctional PB1-F2 protein (PB1-F2) gene, complete sequence 4064 4064 100% 0.0 99%
HQ240683.1 Influenza A virus (A/Canada-MB/RV1989/2009(H1N1)) segment 2 polymerase PB1 (PB1) gene, partial cds; and nonfunctional PB1-F2 protein (PB1-F2) gene, complete sequence 4064 4064 100% 0.0 99%
HQ240675.1 Influenza A virus (A/Canada-MB/RV1927/2009(H1N1)) segment 2 polymerase PB1 (PB1) gene, partial cds; and nonfunctional PB1-F2 protein (PB1-F2) gene, complete sequence 4064 4064 100% 0.0 99%
HQ240672.1 Influenza A virus (A/Canada-BC/RV1720/2009(H1N1)) segment 2 polymerase PB1 (PB1) gene, partial cds; and nonfunctional PB1-F2 protein (PB1-F2) gene, complete sequence 4064 4064 100% 0.0 99%
HQ240670.1 Influenza A virus (A/Canada-BC/RV1718/2009(H1N1)) segment 2 polymerase PB1 (PB1) gene, partial cds; and nonfunctional PB1-F2 protein (PB1-F2) gene, complete sequence 4064 4064 100% 0.0 99%
HQ240668.1 Influenza A virus (A/Canada-PQ/RV1602/2009(H1N1)) segment 2 polymerase PB1 (PB1) gene, partial cds; and nonfunctional PB1-F2 protein (PB1-F2) gene, complete sequence 4064 4064 100% 0.0 99%
HQ240664.1 Influenza A virus (A/Canada-NS/RV1562/2009(H1N1)) segment 2 polymerase PB1 (PB1) gene, partial cds; and nonfunctional PB1-F2 protein (PB1-F2) gene, complete sequence 4064 4064 100% 0.0 99%
CY074070.1 Influenza A virus (A/Argentina/HNRG83/2009(H1N1)) segment 2 sequence 4064 4064 100% 0.0 99%
CY074059.1 Influenza A virus (A/Argentina/HNRG8/2009(H1N1)) segment 2 sequence 4064 4064 100% 0.0 99%
CY073987.1 Influenza A virus (A/Argentina/HNRG106/2009(H1N1)) segment 2 sequence 4064 4064 100% 0.0 99%
CY073973.1 Influenza A virus (A/Argentina/HNRG104/2009(H1N1)) segment 2 sequence 4064 4064 100% 0.0 99%
HQ240780.1 Influenza A virus (A/Canada-NS/RV2598/2009(H1N1)) segment 2 polymerase PB1 (PB1) gene, partial cds; and nonfunctional PB1-F2 protein (PB1-F2) gene, complete sequence 4062 4062 100% 0.0 99%

_________________
www.twitter.com/hniman

Top

niman

Post subject: Re: H1N1 With Swine H3N2 In Canadian Mink

Posted: Fri Mar 25, 2011 11:52 am

Joined: Wed Aug 19, 2009 10:42 am
Posts: 27330
Location: Pittsburgh, PA USA

Top 100 PB1

CY083736.1 Influenza A virus (A/Bochum/INS120/2009(H1N1)) polymerase PB2 (PB2) gene, complete cds 4089 4089 100% 0.0 99%
CY062706.1 Influenza A virus (A/Aarhus/INS118/2009(H1N1)) segment 1, complete sequence 4089 4089 100% 0.0 99%
CY071086.1 Influenza A virus (A/Bochum/INS375/2009(H1N1)) segment 1, complete sequence 4080 4080 100% 0.0 99%
CY069225.1 Influenza A virus (A/Munich/INS363/2009(H1N1)) segment 1, complete sequence 4080 4080 100% 0.0 99%
CY069193.1 Influenza A virus (A/Athens/INS357/2009(H1N1)) segment 1, complete sequence 4080 4080 100% 0.0 99%
GQ494357.1 Influenza A virus (A/Moscow/IIV05/2009(H1N1)) segment 1 polymerase PB2 (PB2) gene, complete cds 4080 4080 100% 0.0 99%
CY062682.1 Influenza A virus (A/Madrid/INS113/2009(H1N1)) segment 1, complete sequence 4078 4078 100% 0.0 99%
CY071262.1 Influenza A virus (A/Madrid/INS408/2009(H1N1)) segment 1, complete sequence 4076 4076 100% 0.0 99%
CY071254.1 Influenza A virus (A/Madrid/INS407/2009(H1N1)) segment 1, complete sequence 4076 4076 100% 0.0 99%
CY067054.1 Influenza A virus (A/Aarhus/INS253/2009(H1N1)) segment 1, complete sequence 4076 4076 100% 0.0 99%
CY066982.1 Influenza A virus (A/Aarhus/INS242/2009(H1N1)) segment 1, complete sequence 4076 4076 100% 0.0 99%
CY065887.1 Influenza A virus (A/Netherlands/1093/2009(H1N1)) segment 1, complete sequence 4076 4076 100% 0.0 99%
CY063058.1 Influenza A virus (A/Tessenderlo/INS191/2009(H1N1)) segment 1, complete sequence 4076 4076 100% 0.0 99%
CY062786.1 Influenza A virus (A/Tessenderlo/INS138/2009(H1N1)) segment 1, complete sequence 4076 4076 100% 0.0 99%
CY052161.1 Influenza A virus (A/New York/4401/2009(H1N1)) segment 1, complete sequence 4076 4076 100% 0.0 99%
CY051534.1 Influenza A virus (A/New York/4400/2009(H1N1)) segment 1, complete sequence 4076 4076 100% 0.0 99%
CY062762.1 Influenza A virus (A/Madrid/INS131/2009(H1N1)) segment 1, complete sequence 4073 4073 100% 0.0 99%
CY083917.1 Influenza A virus (A/Aalborg/INS132/2009(H1N1)) polymerase PB2 (PB2) gene, complete cds 4071 4071 100% 0.0 99%
CY083861.1 Influenza A virus (A/Pensacola/INS39/2009(H1N1)) polymerase PB2 (PB2) gene, complete cds 4071 4071 100% 0.0 99%
CY083341.1 Influenza A virus (A/San Diego/WRAIR1656P/2009(H1N1)) polymerase PB2 (PB2) gene, complete cds 4071 4071 100% 0.0 99%
CY083261.1 Influenza A virus (A/San Diego/WRAIR1643P/2009(H1N1)) polymerase PB2 (PB2) gene, complete cds 4071 4071 100% 0.0 99%
CY074058.1 Influenza A virus (A/Argentina/HNRG8/2009(H1N1)) segment 1 sequence 4071 4071 100% 0.0 99%
CY074040.1 Influenza A virus (A/Argentina/HNRG45/2009(H1N1)) segment 1 sequence 4071 4071 100% 0.0 99%
CY074010.1 Influenza A virus (A/Argentina/HNRG21/2009(H1N1)) segment 1 sequence 4071 4071 100% 0.0 99%
CY074005.1 Influenza A virus (A/Argentina/HNRG15/2009(H1N1)) segment 1 sequence 4071 4071 100% 0.0 99%
CY075571.1 Influenza A virus (A/Boston/655/2009(H1N1)) segment 1, complete sequence 4071 4071 100% 0.0 99%
CY075507.1 Influenza A virus (A/Boston/591/2009(H1N1)) segment 1, complete sequence 4071 4071 100% 0.0 99%
CY075386.1 Influenza A virus (A/Chile/3586/2009(H1N1)) segment 1, complete sequence 4071 4071 100% 0.0 99%
CY075354.1 Influenza A virus (A/Chile/3369/2009(H1N1)) segment 1, complete sequence 4071 4071 100% 0.0 99%
CY073608.1 Influenza A virus (A/Managua/4451.02/2009(H1N1)) segment 1, complete sequence 4071 4071 100% 0.0 99%
CY073536.1 Influenza A virus (A/Managua/466.01/2009(H1N1)) segment 1, complete sequence 4071 4071 100% 0.0 99%
CY073504.1 Influenza A virus (A/Frankfurt/INS304/2009(H1N1)) segment 1, complete sequence 4071 4071 100% 0.0 99%
CY073407.1 Influenza A virus (A/San Diego/WR1639P/2009(H1N1)) segment 1 sequence 4071 4071 100% 0.0 99%
CY073331.1 Influenza A virus (A/San Diego/WR1627P/2009(H1N1)) segment 1 sequence 4071 4071 100% 0.0 99%
CY072965.1 Influenza A virus (A/Managua/585.01/2009(H1N1)) segment 1, complete sequence 4071 4071 100% 0.0 99%
CY072933.1 Influenza A virus (A/Managua/4063.01/2009(H1N1)) segment 1, complete sequence 4071 4071 100% 0.0 99%
CY072853.1 Influenza A virus (A/Managua/4702.04/2009(H1N1)) segment 1, complete sequence 4071 4071 100% 0.0 99%
CY072733.1 Influenza A virus (A/Managua/4407.02/2009(H1N1)) segment 1, complete sequence 4071 4071 100% 0.0 99%
CY072669.1 Influenza A virus (A/Managua/2339.03/2009(H1N1)) segment 1, complete sequence 4071 4071 100% 0.0 99%
CY072365.1 Influenza A virus (A/Athens/INS325/2009(H1N1)) segment 1, complete sequence 4071 4071 100% 0.0 99%
CY072253.1 Influenza A virus (A/Odense/INS307/2009(H1N1)) segment 1, complete sequence 4071 4071 100% 0.0 99%
CY072245.1 Influenza A virus (A/Frankfurt/INS305/2009(H1N1)) segment 1, complete sequence 4071 4071 100% 0.0 99%
CY072229.1 Influenza A virus (A/Frankfurt/INS302/2009(H1N1)) segment 1, complete sequence 4071 4071 100% 0.0 99%
CY071647.1 Influenza A virus (A/Quito/WR1589N/2009(H1N1)) segment 1 sequence 4071 4071 100% 0.0 99%
CY071198.1 Influenza A virus (A/Frankfurt/INS399/2009(H1N1)) segment 1, complete sequence 4071 4071 100% 0.0 99%
CY071094.1 Influenza A virus (A/Bochum/INS376/2009(H1N1)) segment 1, complete sequence 4071 4071 100% 0.0 99%
CY071054.1 Influenza A virus (A/New York/NHRC0004/2009(H1N1)) segment 1, complete sequence 4071 4071 100% 0.0 99%
CY071046.1 Influenza A virus (A/New York/NHRC0003/2009(H1N1)) segment 1, complete sequence 4071 4071 100% 0.0 99%
CY071038.1 Influenza A virus (A/New York/NHRC0002/2009(H1N1)) segment 1, complete sequence 4071 4071 100% 0.0 99%
CY071022.1 Influenza A virus (A/Guam/NHRC0032/2009(H1N1)) segment 1, complete sequence 4071 4071 100% 0.0 99%
CY070998.1 Influenza A virus (A/Guam/NHRC0029/2009(H1N1)) segment 1, complete sequence 4071 4071 100% 0.0 99%
CY070990.1 Influenza A virus (A/Guam/NHRC0007/2009(H1N1)) segment 1, complete sequence 4071 4071 100% 0.0 99%
CY070982.1 Influenza A virus (A/Guam/NHRC0006/2009(H1N1)) segment 1, complete sequence 4071 4071 100% 0.0 99%
CY069631.1 Influenza A virus (A/Singapore/478/2009(H1N1)) segment 1 sequence 4071 4071 100% 0.0 99%
HQ011415.1 Influenza A virus (A/Guangdong/45/2009(H1N1)) segment 1 polymerase PB2 (PB2) gene, complete cds 4071 4071 100% 0.0 99%
CY069249.1 Influenza A virus (A/Vienna/INS366/2009(H1N1)) segment 1, complete sequence 4071 4071 100% 0.0 99%
CY069233.1 Influenza A virus (A/Munich/INS364/2009(H1N1)) segment 1, complete sequence 4071 4071 100% 0.0 99%
CY069201.1 Influenza A virus (A/Athens/INS358/2009(H1N1)) segment 1, complete sequence 4071 4071 100% 0.0 99%
CY069057.1 Influenza A virus (A/Guam/NHRC0021/2009(H1N1)) segment 1, complete sequence 4071 4071 100% 0.0 99%
CY066854.1 Influenza A virus (A/Madrid/INS225/2009(H1N1)) segment 1, complete sequence 4071 4071 100% 0.0 99%
CY066686.1 Influenza A virus (A/Hvidovre/INS288/2009(H1N1)) segment 1, complete sequence 4071 4071 100% 0.0 99%
CY066678.1 Influenza A virus (A/Tessenderlo/INS287/2009(H1N1)) segment 1, complete sequence 4071 4071 100% 0.0 99%
CY066622.1 Influenza A virus (A/Athens/INS274/2009(H1N1)) segment 1, complete sequence 4071 4071 100% 0.0 99%
CY066374.1 Influenza A virus (A/California/VRDL124/2009(H1N1)) segment 1, complete sequence 4071 4071 100% 0.0 99%
CY065895.1 Influenza A virus (A/Netherlands/2815/2009(H1N1)) segment 1, complete sequence 4071 4071 100% 0.0 99%
HM569698.1 Influenza A virus (A/Argentina/19656/2009(H1N1)) segment 1 polymerase PB2 (PB2) gene, complete cds 4071 4071 100% 0.0 99%
CY065082.1 Influenza A virus (A/New York/7421/2009(H1N1)) segment 1, complete sequence 4071 4071 100% 0.0 99%
CY064643.1 Influenza A virus (A/Boston/134/2009(H1N1)) segment 1, complete sequence 4071 4071 100% 0.0 99%
CY064555.1 Influenza A virus (A/Boston/122/2009(H1N1)) segment 1, complete sequence 4071 4071 100% 0.0 99%
CY064415.1 Influenza A virus (A/Mexico city/CIA11/2009(H1N1)) segment 1 sequence 4071 4071 100% 0.0 99%
CY064408.1 Influenza A virus (A/Mexico city/CIA10/2009(H1N1)) segment 1 sequence 4071 4071 100% 0.0 99%
CY063501.1 Influenza A virus (A/Boston/112/2009(H1N1)) segment 1, complete sequence 4071 4071 100% 0.0 99%
CY062994.1 Influenza A virus (A/Vienna/INS179/2010(H1N1)) segment 1, complete sequence 4071 4071 100% 0.0 99%
CY062954.1 Influenza A virus (A/Terrassa/INS173/2009(H1N1)) segment 1, complete sequence 4071 4071 100% 0.0 99%
CY062906.1 Influenza A virus (A/Athens/INS164/2009(H1N1)) segment 1, complete sequence 4071 4071 100% 0.0 99%
CY062650.1 Influenza A virus (A/District of Columbia/INS45/2009(H1N1)) segment 1, complete sequence 4071 4071 100% 0.0 99%
CY062537.1 Influenza A virus (A/Mexico city/CIA9/2009(H1N1)) segment 1 sequence 4071 4071 100% 0.0 99%
CY062526.1 Influenza A virus (A/Mexico city/CIA7/2009(H1N1)) segment 1 sequence 4071 4071 100% 0.0 99%
CY062514.1 Influenza A virus (A/Mexico city/CIA5/2009(H1N1)) segment 1 sequence 4071 4071 100% 0.0 99%
CY062488.1 Influenza A virus (A/Mexico city/CIA1/2009(H1N1)) segment 1 sequence 4071 4071 100% 0.0 99%
CY061977.1 Influenza A virus (A/New York/6976/2009(H1N1)) segment 1, complete sequence 4071 4071 100% 0.0 99%
CY061969.1 Influenza A virus (A/New York/6949/2009(H1N1)) segment 1, complete sequence 4071 4071 100% 0.0 99%
CY060986.1 Influenza A virus (A/Texas/JMS383/2009(H1N1)) segment 1, complete sequence 4071 4071 100% 0.0 99%
CY060898.1 Influenza A virus (A/Texas/JMS364/2009(H1N1)) segment 1, complete sequence 4071 4071 100% 0.0 99%
CY060890.1 Influenza A virus (A/Texas/JMS363/2009(H1N1)) segment 1, complete sequence 4071 4071 100% 0.0 99%
CY060707.1 Influenza A virus (A/Ontario/315637/2009(H1N1)) segment 1 sequence 4071 4071 100% 0.0 99%
CY060691.1 Influenza A virus (A/Ontario/315187/2009(H1N1)) segment 1 sequence 4071 4071 100% 0.0 99%
CY060667.1 Influenza A virus (A/Ontario/315047/2009(H1N1)) segment 1 sequence 4071 4071 100% 0.0 99%
CY060659.1 Influenza A virus (A/Ontario/315015/2009(H1N1)) segment 1 sequence 4071 4071 100% 0.0 99%
CY060603.1 Influenza A virus (A/Ontario/308054/2009(H1N1)) segment 1 sequence 4071 4071 100% 0.0 99%
CY060595.1 Influenza A virus (A/Ontario/305598/2009(H1N1)) segment 1 sequence 4071 4071 100% 0.0 99%
CY060587.1 Influenza A virus (A/Ontario/305139/2009(H1N1)) segment 1 sequence 4071 4071 100% 0.0 99%
CY060523.1 Influenza A virus (A/Ontario/235657/2009(H1N1)) segment 1 sequence 4071 4071 100% 0.0 99%
CY060515.1 Influenza A virus (A/Ontario/222656/2009(H1N1)) segment 1 sequence 4071 4071 100% 0.0 99%
CY058699.1 Influenza A virus (A/Texas/461917783/2009(H1N1)) segment 1, complete sequence 4071 4071 100% 0.0 99%
CY058571.1 Influenza A virus (A/Managua/4218.01/2009(H1N1)) segment 1, complete sequence 4071 4071 100% 0.0 99%
CY058299.1 Influenza A virus (A/Wisconsin/629-D02100/2009(H1N1)) segment 1, complete sequence 4071 4071 100% 0.0 99%
CY058267.1 Influenza A virus (A/Managua/164.01/2009(H1N1)) segment 1, complete sequence 4071 4071 100% 0.0 99%
CY058005.1 Influenza A virus (A/Wisconsin/629-D02299/2009(H1N1)) segment 1, complete sequence 4071 4071 100% 0.0 99%
CY071030.1 Influenza A virus (A/New York/NHRC0001/2009(H1N1)) segment 1, complete sequence 4069 4069 100% 0.0 99%

_________________
www.twitter.com/hniman

Top

niman

Post subject: Re: H1N1 With Swine H3N2 In Canadian Mink

Posted: Fri Mar 25, 2011 11:52 am

Joined: Wed Aug 19, 2009 10:42 am
Posts: 27330
Location: Pittsburgh, PA USA

Top 100 PA

CY083939.1 Influenza A virus (A/Warsaw/INS149/2009(H1N1)) polymerase PA (PA) gene, complete cds 3802 3802 100% 0.0 99%
CY075064.1 Influenza A virus (A/Athens/INS392/2010(H1N1)) segment 3, complete sequence 3802 3802 100% 0.0 99%
CY067140.1 Influenza A virus (A/Athens/INS268/2009(H1N1)) segment 3, complete sequence 3802 3802 100% 0.0 99%
CY067092.1 Influenza A virus (A/Athens/INS261/2009(H1N1)) segment 3, complete sequence 3802 3802 100% 0.0 99%
CY066628.1 Influenza A virus (A/Athens/INS275/2009(H1N1)) segment 3, complete sequence 3802 3802 100% 0.0 99%
CY066404.1 Influenza A virus (A/California/VRDL128/2009(H1N1)) segment 3, complete sequence 3802 3802 100% 0.0 99%
CY063595.1 Influenza A virus (A/Athens/INS122/2009(H1N1)) segment 3, complete sequence 3802 3802 100% 0.0 99%
CY063280.1 Influenza A virus (A/Wisconsin/629-D00888/2009(H1N1)) segment 3, complete sequence 3802 3802 100% 0.0 99%
CY061559.1 Influenza A virus (A/Texas/JMS366/2009(H1N1)) segment 3, complete sequence 3802 3802 100% 0.0 99%
CY061056.1 Influenza A virus (A/Texas/JMS392/2009(H1N1)) segment 3, complete sequence 3802 3802 100% 0.0 99%
CY060749.1 Influenza A virus (A/Ontario/9739/2009(H1N1)) segment 3 sequence 3802 3802 100% 0.0 99%
CY060557.1 Influenza A virus (A/Ontario/26184/2009(H1N1)) segment 3 sequence 3802 3802 100% 0.0 99%
CY058689.1 Influenza A virus (A/Texas/46182018/2009(H1N1)) segment 3, complete sequence 3802 3802 100% 0.0 99%
CY057899.1 Influenza A virus (A/Wisconsin/629-D00908/2009(H1N1)) segment 3, complete sequence 3802 3802 100% 0.0 99%
CY057723.1 Influenza A virus (A/Wisconsin/629-D02317/2009(H1N1)) segment 3, complete sequence 3802 3802 100% 0.0 99%
GU451253.1 Influenza A virus (A/Tver/IIV2969/2009(H1N1)) segment 3 polymerase PA (PA) gene, complete cds 3802 3802 100% 0.0 99%
GQ465740.1 Influenza A virus (A/Canada-PQ/RV1758/2009(H1N1)) segment 3 polymerase PA (PA) gene, complete cds 3802 3802 100% 0.0 99%
GQ402299.1 Influenza A virus (A/Canada-QC/RV1954/2009(H1N1)) segment 3 polymerase PA (PA) gene, complete cds 3802 3802 100% 0.0 99%
HQ698626.1 Influenza A virus (A/Beijing/16/2009(H1N1)) segment 3 polymerase PA (PA) gene, complete cds 3799 3799 100% 0.0 99%
CY087005.1 Influenza A virus (A/New York/3256/2009(N1)) polymerase PA (PA) gene, complete cds 3799 3799 100% 0.0 99%
CY086998.1 Influenza A virus (A/New York/3251/2009(H1N1)) polymerase PA (PA) gene, complete cds 3799 3799 100% 0.0 99%
CY086974.1 Influenza A virus (A/New York/3198/2009(H1N1)) polymerase PA (PA) gene, complete cds 3799 3799 100% 0.0 99%
CY040722.2 Influenza A virus (A/New York/3238/2009(H1N1)) polymerase PA (PA) gene, complete cds 3799 3799 100% 0.0 99%
CY083891.1 Influenza A virus (A/San Diego/INS72/2009(H1N1)) polymerase PA (PA) gene, complete cds 3799 3799 100% 0.0 99%
CY083718.1 Influenza A virus (A/Madrid/INS112/2009(H1N1)) polymerase PA (PA) gene, complete cds 3799 3799 100% 0.0 99%
CY083494.1 Influenza A virus (A/Chicago/WRAIR1691P/2009(H1N1)) polymerase PA (PA) gene, complete cds 3799 3799 100% 0.0 99%
CY083486.1 Influenza A virus (A/Mexico City/WRAIR1691N/2009(H1N1)) polymerase PA (PA) gene, complete cds 3799 3799 100% 0.0 99%
CY083422.1 Influenza A virus (A/San Diego/WRAIR1667P/2009(H1N1)) polymerase PA (PA) gene, complete cds 3799 3799 100% 0.0 99%
CY083366.1 Influenza A virus (A/South Carolina/WRAIR1660P/2009(H1N1)) polymerase PA (PA) gene, complete cds 3799 3799 100% 0.0 99%
CY083358.1 Influenza A virus (A/San Diego/WRAIR1658P/2009(H1N1)) polymerase PA (PA) gene, complete cds 3799 3799 100% 0.0 99%
CY083350.1 Influenza A virus (A/San Diego/WRAIR1657P/2009(H1N1)) polymerase PA (PA) gene, complete cds 3799 3799 100% 0.0 99%
CY083311.1 Influenza A virus (A/San Diego/WRAIR1649P/2009(H1N1)) polymerase PA (PA) gene, complete cds 3799 3799 100% 0.0 99%
CY083239.1 Influenza A virus (A/Virginia/WRAIR1511P/2009(H1N1)) polymerase PA (PA) gene, complete cds 3799 3799 100% 0.0 99%
CY074022.1 Influenza A virus (A/Argentina/HNRG32/2009(H1N1)) segment 3 sequence 3799 3799 100% 0.0 99%
CY075665.1 Influenza A virus (A/Boston/628/2009(H1N1)) segment 3, complete sequence 3799 3799 100% 0.0 99%
CY075617.1 Influenza A virus (A/Boston/682/2009(H1N1)) segment 3, complete sequence 3799 3799 100% 0.0 99%
CY075609.1 Influenza A virus (A/Boston/681/2009(H1N1)) segment 3, complete sequence 3799 3799 100% 0.0 99%
CY075593.1 Influenza A virus (A/Boston/666/2009(H1N1)) segment 3, complete sequence 3799 3799 100% 0.0 99%
CY075553.1 Influenza A virus (A/Boston/648/2009(H1N1)) segment 3, complete sequence 3799 3799 100% 0.0 99%
CY075537.1 Influenza A virus (A/Boston/612/2009(H1N1)) segment 3, complete sequence 3799 3799 100% 0.0 99%
CY075472.1 Influenza A virus (A/Chile/4438/2009(H1N1)) segment 3, complete sequence 3799 3799 100% 0.0 99%
CY075464.1 Influenza A virus (A/Chile/4406/2009(H1N1)) segment 3, complete sequence 3799 3799 100% 0.0 99%
CY075448.1 Influenza A virus (A/Chile/4182/2009(H1N1)) segment 3, complete sequence 3799 3799 100% 0.0 99%
CY075440.1 Influenza A virus (A/Chile/4181/2009(H1N1)) segment 3, complete sequence 3799 3799 100% 0.0 99%
CY075416.1 Influenza A virus (A/Chile/3905/2009(H1N1)) segment 3, complete sequence 3799 3799 100% 0.0 99%
CY075392.1 Influenza A virus (A/Chile/3760/2009(H1N1)) segment 3, complete sequence 3799 3799 100% 0.0 99%
CY075368.1 Influenza A virus (A/Chile/3467/2009(H1N1)) segment 3, complete sequence 3799 3799 100% 0.0 99%
CY075344.1 Influenza A virus (A/Chile/3361/2009(H1N1)) segment 3, complete sequence 3799 3799 100% 0.0 99%
CY075296.1 Influenza A virus (A/Chile/3123/2009(H1N1)) segment 3, complete sequence 3799 3799 100% 0.0 99%
CY075288.1 Influenza A virus (A/Chile/3056/2009(H1N1)) segment 3, complete sequence 3799 3799 100% 0.0 99%
CY075272.1 Influenza A virus (A/Chile/2994/2009(H1N1)) segment 3, complete sequence 3799 3799 100% 0.0 99%
CY075264.1 Influenza A virus (A/Chile/2911/2009(H1N1)) segment 3, complete sequence 3799 3799 100% 0.0 99%
CY075240.1 Influenza A virus (A/Chile/2851/2009(H1N1)) segment 3, complete sequence 3799 3799 100% 0.0 99%
CY075232.1 Influenza A virus (A/Chile/2239/2009(H1N1)) segment 3, complete sequence 3799 3799 100% 0.0 99%
CY075224.1 Influenza A virus (A/Chile/2009/2009(H1N1)) segment 3, complete sequence 3799 3799 100% 0.0 99%
CY075216.1 Influenza A virus (A/Chile/1624/2009(H1N1)) segment 3, complete sequence 3799 3799 100% 0.0 99%
CY075208.1 Influenza A virus (A/Chile/1603/2009(H1N1)) segment 3, complete sequence 3799 3799 100% 0.0 99%
CY075200.1 Influenza A virus (A/Chile/1600/2009(H1N1)) segment 3, complete sequence 3799 3799 100% 0.0 99%
CY075184.1 Influenza A virus (A/Chile/1598/2009(H1N1)) segment 3, complete sequence 3799 3799 100% 0.0 99%
CY075168.1 Influenza A virus (A/Chile/180/2009(H1N1)) segment 3, complete sequence 3799 3799 100% 0.0 99%
CY075160.1 Influenza A virus (A/Chile/158/2009(H1N1)) segment 3, complete sequence 3799 3799 100% 0.0 99%
CY075152.1 Influenza A virus (A/Chile/95/2009(H1N1)) segment 3, complete sequence 3799 3799 100% 0.0 99%
CY075144.1 Influenza A virus (A/Chile/88/2009(H1N1)) segment 3, complete sequence 3799 3799 100% 0.0 99%
CY075136.1 Influenza A virus (A/Chile/56/2009(H1N1)) segment 3, complete sequence 3799 3799 100% 0.0 99%
CY075088.1 Influenza A virus (A/Chile/28/2009(H1N1)) segment 3, complete sequence 3799 3799 100% 0.0 99%
CY075013.1 Influenza A virus (A/Thailand/CU-H910/2009(H1N1)) segment 3 sequence 3799 3799 100% 0.0 99%
CY074973.1 Influenza A virus (A/Thailand/CU-C161/2009(H1N1)) segment 3 sequence 3799 3799 100% 0.0 99%
CY073417.1 Influenza A virus (A/San Diego/WR1640P/2009(H1N1)) segment 3 sequence 3799 3799 100% 0.0 99%
CY073409.1 Influenza A virus (A/San Diego/WR1639P/2009(H1N1)) segment 3 sequence 3799 3799 100% 0.0 99%
CY073253.1 Influenza A virus (A/Athens/WRAIR2962N/2009(H1N1)) segment 3 sequence 3799 3799 100% 0.0 99%
CY072787.1 Influenza A virus (A/Managua/5401.01/2009(H1N1)) segment 3, complete sequence 3799 3799 100% 0.0 99%
CY072731.1 Influenza A virus (A/Managua/4407.02/2009(H1N1)) segment 3, complete sequence 3799 3799 100% 0.0 99%
CY072435.1 Influenza A virus (A/Athens/INS337/2009(H1N1)) segment 3, complete sequence 3799 3799 100% 0.0 99%
CY071745.1 Influenza A virus (A/Mexico City/WR1704T/2009(H1N1)) segment 3 sequence 3799 3799 100% 0.0 99%
CY071473.1 Influenza A virus (A/California/WR1313P/2009(H1N1)) segment 3 sequence 3799 3799 100% 0.0 99%
CY071457.1 Influenza A virus (A/Mexico City/WR1090N/2009(H1N1)) segment 3 sequence 3799 3799 100% 0.0 99%
CY071260.1 Influenza A virus (A/Madrid/INS408/2009(H1N1)) segment 3, complete sequence 3799 3799 100% 0.0 99%
CY071052.1 Influenza A virus (A/New York/NHRC0004/2009(H1N1)) segment 3, complete sequence 3799 3799 100% 0.0 99%
CY071044.1 Influenza A virus (A/New York/NHRC0003/2009(H1N1)) segment 3, complete sequence 3799 3799 100% 0.0 99%
CY069111.1 Influenza A virus (A/Guam/NHRC0028/2009(H1N1)) segment 3, complete sequence 3799 3799 100% 0.0 99%
CY069087.1 Influenza A virus (A/Guam/NHRC0025/2009(H1N1)) segment 3, complete sequence 3799 3799 100% 0.0 99%
CY068919.1 Influenza A virus (A/Japan/NHRC0003/2009(H1N1)) segment 3, complete sequence 3799 3799 100% 0.0 99%
HM849037.1 Influenza A virus (A/Kurume/K0910/2009(H1N1)) segment 3 polymerase PA (PA) gene, complete cds 3799 3799 100% 0.0 99%
CY067020.1 Influenza A virus (A/Bochum/INS249/2009(H1N1)) segment 3, complete sequence 3799 3799 100% 0.0 99%
CY066908.1 Influenza A virus (A/District of Columbia/INS232/2009(H1N1)) segment 3, complete sequence 3799 3799 100% 0.0 99%
CY066828.1 Influenza A virus (A/Antwerp/INS221/2009(H1N1)) segment 3, complete sequence 3799 3799 100% 0.0 99%
CY066788.1 Influenza A virus (A/San Diego/INS214/2009(H1N1)) segment 3, complete sequence 3799 3799 100% 0.0 99%
CY066692.1 Influenza A virus (A/Hvidovre/INS289/2009(H1N1)) segment 3, complete sequence 3799 3799 100% 0.0 99%
CY066260.1 Influenza A virus (A/California/VRDL110/2009(H1N1)) segment 3, complete sequence 3799 3799 100% 0.0 99%
CY065965.1 Influenza A virus (A/Japan/NHRC0002/2009(H1N1)) segment 3, complete sequence 3799 3799 100% 0.0 99%
CY065761.1 Influenza A virus (A/British Columbia/GFA0401/2009(H1N1)) segment 3 sequence 3799 3799 100% 0.0 99%
CY064900.1 Influenza A virus (A/Boston/136/2009(H1N1)) segment 3, complete sequence 3799 3799 100% 0.0 99%
CY064737.1 Influenza A virus (A/Mexico City/023/2009(H1N1)) segment 3, complete sequence 3799 3799 100% 0.0 99%
CY064729.1 Influenza A virus (A/Mexico City/022/2009(H1N1)) segment 3, complete sequence 3799 3799 100% 0.0 99%
CY064721.1 Influenza A virus (A/Mexico City/021/2009(H1N1)) segment 3, complete sequence 3799 3799 100% 0.0 99%
CY064713.1 Influenza A virus (A/Mexico City/020/2009(H1N1)) segment 3, complete sequence 3799 3799 100% 0.0 99%
CY064705.1 Influenza A virus (A/Mexico City/019/2009(H1N1)) segment 3, complete sequence 3799 3799 100% 0.0 99%
CY064777.1 Influenza A virus (A/Berlin/INS170/2009(H1N1)) segment 3, complete sequence 3799 3799 100% 0.0 99%
CY064657.1 Influenza A virus (A/Boston/137/2009(H1N1)) segment 3, complete sequence 3799 3799 100% 0.0 99%
CY072891.1 Influenza A virus (A/Managua/12.01/2009(H1N1)) segment 3, complete sequence 3795 3795 100% 0.0 99%

_________________
www.twitter.com/hniman

Top

Page 1 of 2

[ 12 posts ]

Go to page 1, 2 Next

Board index » Discussion » General Discussion

All times are UTC - 5 hours [ DST ]

Who is online

Users browsing this forum: Google [Bot] and 17 guests

You cannot post new topics in this forum
You cannot reply to topics in this forum
You cannot edit your posts in this forum
You cannot delete your posts in this forum
You cannot post attachments in this forum

Jump to: