Rhiza Labs FluTracker Forum

The place to discuss the flu
It is currently Thu May 23, 2013 3:31 am

All times are UTC - 5 hours [ DST ]




Post new topic Reply to topic  [ 11 posts ]  Go to page 1, 2  Next
Author Message
PostPosted: Wed Mar 09, 2011 9:21 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 27403
Location: Pittsburgh, PA USA
St Jude released a series of sequences from swine isolates from 2009 and 2010 which were triple reassortants which had acquired pandemic H1N1 gene segments. One of the examples was an trH3N2 isolate, A/swine/Minnesota/239105/2009, which had acquired pandemic H1N1 sequences, which replaced PA, NP, and MP segments.

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Wed Mar 09, 2011 9:23 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 27403
Location: Pittsburgh, PA USA
LOCUS CY086920 1701 bp cRNA linear VRL 02-MAR-2011
DEFINITION Influenza A virus (A/swine/Minnesota/239105/2009(H3N2))
hemagglutinin (HA) gene, complete cds.
ACCESSION CY086920
VERSION CY086920.1 GI:325111521
KEYWORDS .
SOURCE Influenza A virus (A/swine/Minnesota/239105/2009(H3N2))
ORGANISM Influenza A virus (A/swine/Minnesota/239105/2009(H3N2))
Viruses; ssRNA negative-strand viruses; Orthomyxoviridae;
Influenzavirus A.
REFERENCE 1 (bases 1 to 1701)
AUTHORS Ducatez,M.F., Webby,R.J., Hause,B., Evelyn,S.-R., Darnel,D.,
Corzo,C., Juleen,K., Simonson,R., Rubrum,A., Lowe,J. and Gramer,M.
TITLE unpublished
JOURNAL Unpublished
REFERENCE 2 (bases 1 to 1701)
AUTHORS Ducatez,M.F., Webby,R.J., Hause,B., Evelyn,S.-R., Darnel,D.,
Corzo,C., Juleen,K., Simonson,R., Rubrum,A., Lowe,J. and Gramer,M.
TITLE Direct Submission
JOURNAL Submitted (02-MAR-2011) Infectious Diseases, St. Jude Children's
Research Hospital, 262 Danny Thomas Place, Memphis, Tennessee
38105, USA
FEATURES Location/Qualifiers
source 1..1701
/organism="Influenza A virus
(A/swine/Minnesota/239105/2009(H3N2))"
/mol_type="viral cRNA"
/strain="A/swine/Minnesota/239105/2009"
/serotype="H3N2"
/host="swine"
/db_xref="taxon:992196"
/segment="4"
/country="USA: Minnesota"
/collection_date="24-Nov-2009"
gene 1..1701
/gene="HA"
CDS 1..1701
/gene="HA"
/function="receptor binding and fusion protein"
/codon_start=1
/product="hemagglutinin"
/protein_id="ADY80098.1"
/db_xref="GI:325111522"
/translation="MKAIIAFSCILCLVFAQKLPGSDNSMATLCLGHHAVPNGTLVKT
ITEDQIEVTNATELVQSSSTGRICNSPHQILDGKNCTLIDALLGDPHCDDFQNKEWDL
FIERSTAYSNCYPYYVPDYASLRSLIASSGTLKFTQESFNWTGVAQDGSSYACRRGSV
NSFFSRLNWLHNLNYKYPALNVTMPNNDRFDKLYIWGVHHPGTDKDQTNLYVQASGIV
TVSTKRSQQTVIPNIGSRPWVRGVSSIISIYWTIVKPGDILLINSTGNLIAPRGYFKI
QGGKSSIMRSDAPIGKCNSECITPNGSIPNDKPFQNVNRITYGACPRYVKQNTLKLAT
GMRNVPEKQTRGIFGAIAGFIENGWEGMVDGWYGFRHQNSEGTGQAADLKSTQEAVNQ
ITGKLNRVIKKTNEKFHQIEKEFSEVEGRIQDLEKYVEDTKIDLWSYNAELLVALENQ
HTIDLTDSEMNKLFERTRKQLRENAEDMGNGCFKIYHKCDNACIGSIRNGTYDHDVYR
DEALNNRFQIKSVQLKSGYKDWILWISFAISCFLLCVVLLGFIMWACQKGNIRCNICI
"
sig_peptide 1..48
/gene="HA"
mat_peptide 49..1035
/gene="HA"
/product="HA1"
mat_peptide 1036..1698
/gene="HA"
/product="HA2"
misc_feature 1..1701
/db_xref="IRD:CEIRS-SJC001-239105.4"
ORIGIN
1 atgaaggcta tcattgcttt tagctgcatt ttatgtctgg ttttcgctca aaaacttccc
61 ggaagtgaca acagcatggc aacgctgtgc ctgggacatc atgcagtacc aaacggaacg
121 ttagtgaaaa caatcacgga agaccaaatt gaagtgacta atgctactga gctggttcag
181 agttcctcaa caggtagaat atgcaacagt cctcaccaaa tccttgatgg gaaaaattgc
241 acactgatag atgctctatt gggagaccct cattgtgatg acttccaaaa caaggaatgg
301 gaccttttta ttgaacgaag cacagcctac agcaactgtt acccttatta tgtgccggat
361 tatgcctccc tcaggtcact aattgcctca tctggcaccc tgaaatttac ccaagaaagc
421 ttcaattgga ctggagttgc tcaagatgga tcaagctatg cttgcagaag gggatctgtt
481 aacagtttct ttagtagatt gaattggttg cataatttga attacaaata tccagcgctg
541 aacgtaacta tgccaaacaa tgacagattt gacaaattgt acatttgggg ggttcaccat
601 ccgggtacag acaaggacca aaccaaccta tatgttcaag catcaggaat agtcacagtc
661 tccacaaaaa gaagccaaca aactgtaatc ccgaatatcg ggtctagacc ctgggtgagg
721 ggtgtctcca gtataataag catctattgg acaatagtaa agccgggaga catactcttg
781 attaacagca cagggaatct aattgcccct cggggttact tcaaaataca aggtgggaaa
841 agctcaataa tgaggtcaga tgcacccatt ggcaaatgca attctgaatg cattactcca
901 aatggaagca ttcccaatga caaacctttt caaaatgtaa acaggatcac atatggggcc
961 tgtcccagat atgttaagca aaacactctg aaattggcaa caggaatgcg gaatgtacca
1021 gagaaacaaa ctagaggcat attcggcgca atcgcaggtt tcatagaaaa tggttgggag
1081 gggatggtag acggttggta cggtttcagg catcaaaatt ctgaaggcac aggacaagca
1141 gcagatctta aaagcactca agaagcagtc aaccaaatca ccgggaaact aaatagagta
1201 atcaagaaaa cgaacgagaa attccatcag atcgaaaaag aattctcaga agtagaaggg
1261 aggattcagg acctagagaa atacgttgaa gacactaaaa tagatctctg gtcttacaac
1321 gcggagcttc ttgttgccct ggagaaccaa catacaattg atttaactga ctcagaaatg
1381 aacaaactgt tcgaaagaac aagaaagcaa ctgcgggaaa atgctgagga catgggcaat
1441 ggttgcttca aaatatacca caagtgtgac aatgcctgca taggatcaat cagaaatgga
1501 acttatgacc atgatgtata cagagacgag gcattgaaca atcggttcca gatcaaaagt
1561 gttcagctga agtcaggata caaagattgg atcctatgga tttcctttgc catatcatgc
1621 tttttgcttt gtgttgttct gctggggttc attatgtggg cctgccaaaa aggcaacatt
1681 aggtgcaaca tttgcatttg a

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Wed Mar 09, 2011 9:27 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 27403
Location: Pittsburgh, PA USA
Top 100 HA matches

CY086920.1 Influenza A virus (A/swine/Minnesota/239105/2009(H3N2)) hemagglutinin (HA) gene, complete cds 3372 3372 100% 0.0 100%
DQ469994.1 Influenza A virus (A/swine/Ontario/33853/2005(H3N2)) hemagglutinin (HA) gene, complete cds 3102 3102 100% 0.0 98%
DQ469962.1 Influenza A virus (A/Ontario/RV1273/2005(H3N2)) hemagglutinin (HA) gene, complete cds 3102 3102 100% 0.0 98%
EU735818.1 Influenza A virus (A/turkey/OH/313053/2004(H3N2)) hemagglutinin (HA) gene, complete cds 3079 3079 100% 0.0 97%
DQ469986.1 Influenza A virus (A/swine/Manitoba/12707/2005(H3N2)) hemagglutinin (HA) gene, complete cds 3079 3079 100% 0.0 97%
DQ469970.1 Influenza A virus (A/swine/Alberta/14722/2005(H3N2)) hemagglutinin (HA) gene, complete cds 3079 3079 100% 0.0 97%
HQ315643.1 Influenza A virus (A/swine/Minnesota/1300/2007(H3N2)) segment 4 hemagglutinin (HA) gene, complete cds 3071 3071 100% 0.0 97%
EU743210.1 Influenza A virus (A/turkey/MN/366767/2005(H3N2)) segment 4 hemagglutinin (HA) gene, complete cds 3071 3071 100% 0.0 97%
DQ335771.1 Influenza A virus (A/turkey/Ohio/313053/04(H3N2)) hemagglutinin (HA) gene, complete cds 3071 3071 100% 0.0 97%
EU697204.1 Influenza A virus (A/turkey/Minnesota/366767/2005(H3N2)) hemagglutinin (HA) gene, complete cds 3047 3047 100% 0.0 97%
DQ470002.1 Influenza A virus (A/turkey/Ontario/31232/2005(H3N2)) hemagglutinin (HA) gene, complete cds 3047 3047 100% 0.0 97%
EF551045.1 Influenza A virus (A/turkey/Illinois/2004(H3N2)) segment 4 hemagglutinin (HA) gene, complete cds 3039 3039 100% 0.0 97%
CY035416.1 Influenza A virus (A/swine/Minnesota/SG-00234/2005(H3N2)) segment 4 sequence 3037 3037 99% 0.0 97%
FJ519972.1 Influenza A virus (A/swine/Minnesota/66853/2006(H3N2)) segment 4 hemagglutinin (HA) gene, complete cds 3015 3015 99% 0.0 97%
EU697209.1 Influenza A virus (A/turkey/North Carolina/353568/2005(H3N2)) hemagglutinin (HA) gene, complete cds 3015 3015 100% 0.0 97%
EU735826.1 Influenza A virus (A/turkey/NC/353568/2005(H3N2)) hemagglutinin (HA) gene, complete cds 3015 3015 100% 0.0 97%
CY035419.1 Influenza A virus (A/swine/Minnesota/SG-00235/2007(H3N2)) segment 4 sequence 3013 3013 99% 0.0 97%
CY035422.1 Influenza A virus (A/swine/Minnesota/SG-00236/2007(H3N2)) segment 4 sequence 3009 3009 99% 0.0 97%
CY041847.1 Influenza A virus (A/swine/North Carolina/R08-001877-D08-013371/2008 (H3N2)) segment 4 sequence 3007 3007 100% 0.0 97%
EU826543.2 Influenza A virus (A/swine/Quebec/4001/2005(H3N2)) segment 4 hemagglutinin (HA) gene, complete cds 3007 3007 100% 0.0 97%
FJ519971.1 Influenza A virus (A/swine/Minnesota/65767/2006(H3N2)) segment 4 hemagglutinin (HA) gene, complete cds 2999 2999 100% 0.0 97%
CY045567.1 Influenza A virus (A/swine/Oklahoma/008722/2007(H3N2)) segment 4 sequence 2991 2991 100% 0.0 97%
FJ519974.1 Influenza A virus (A/swine/Minnesota/578/2007(H3N2)) segment 4 hemagglutinin (HA) gene, complete cds 2983 2983 100% 0.0 97%
FJ410140.1 Influenza A virus (A/swine/Minnesota/1145/2007(H3N2)) segment 4, complete sequence 2983 2983 100% 0.0 97%
DQ469978.1 Influenza A virus (A/swine/British Columbia/28103/2005(H3N2)) hemagglutinin (HA) gene, complete cds 2983 2983 100% 0.0 97%
DQ150425.1 Influenza A virus (A/swine/MI/PU243/04 (H3N1)) hemagglutinin (HA) gene, complete cds 2977 2977 100% 0.0 97%
CY035442.1 Influenza A virus (A/swine/Minnesota/SG-00242/2006(H3N2)) segment 4 sequence 2974 2974 99% 0.0 97%
FJ519977.1 Influenza A virus (A/swine/Minnesota/7931/2007(H3N2)) segment 4 hemagglutinin (HA) gene, complete cds 2968 2968 100% 0.0 97%
EU399751.1 Influenza A virus (A/Ontario/1252/2007(H3N2)) hemagglutinin (HA) gene, complete cds 2968 2968 100% 0.0 97%
FJ519975.1 Influenza A virus (A/swine/Minnesota/761/2007(H3N2)) segment 4 hemagglutinin (HA) gene, complete cds 2960 2960 100% 0.0 96%
FJ519973.1 Influenza A virus (A/swine/Minnesota/66960/2006(H3N2)) segment 4 hemagglutinin (HA) gene, complete cds 2960 2960 100% 0.0 96%
FJ519976.1 Influenza A virus (A/swine/Minnesota/5947/2007(H3N2)) segment 4 hemagglutinin (HA) gene, complete cds 2944 2944 100% 0.0 96%
EU826551.2 Influenza A virus (A/mink/Nova Scotia/1055488/2007(H3N2)) segment 4 hemagglutinin (HA) gene, complete cds 2944 2944 100% 0.0 96%
JF263536.1 Influenza A virus (A/swine/Pennsylvania/62170-3/2010(H3N2)) segment 4 hemagglutinin (HA) gene, complete cds 2936 2936 100% 0.0 96%
JF263535.1 Influenza A virus (A/swine/Pennsylvania/62170-1/2010(H3N2)) segment 4 hemagglutinin (HA) gene, complete cds 2936 2936 100% 0.0 96%
CY045575.1 Influenza A virus (A/swine/Oklahoma/011506/2007(H3N2)) segment 4 sequence 2928 2928 99% 0.0 96%
GU937743.1 Influenza A virus (A/Kansas/13/2009(H3N2)) segment 4 hemagglutinin (HA) gene, complete cds 2896 2896 100% 0.0 96%
JF312071.1 Influenza A virus (A/swine/Iowa/A01057188/2010(H3N2)) segment 4 hemagglutinin (HA) gene, complete cds 2888 2888 100% 0.0 96%
HQ734189.1 Influenza A virus (A/swine/Illinois/53612-2/2009(H3N2)) segment 4 hemagglutinin (HA) gene, complete cds 2880 2880 100% 0.0 96%
HQ734186.1 Influenza A virus (A/swine/Illinois/53612-1/2009(H3N2)) segment 4 hemagglutinin (HA) gene, complete cds 2880 2880 100% 0.0 96%
HM217202.1 Influenza A virus (A/swine/Minnesota/03008/2010(H3N2)) segment 4 hemagglutinin (HA) gene, complete cds 2880 2880 100% 0.0 96%
CY045559.1 Influenza A virus (A/swine/Kansas/015252/2009(H3N2)) segment 4 sequence 2872 2872 100% 0.0 96%
HQ734198.1 Influenza A virus (A/swine/Illinois/53612-5/2009(H3N2)) segment 4 hemagglutinin (HA) gene, complete cds 2849 2849 100% 0.0 96%
GU289666.1 Influenza A virus (A/swine/Wisconsin/R7c/2001(H3N2)) segment 4 hemagglutinin (HA) gene, complete cds 2843 2843 100% 0.0 96%
HQ734195.1 Influenza A virus (A/swine/Illinois/53612-4/2009(H3N2)) segment 4 hemagglutinin (HA) gene, complete cds 2841 2841 100% 0.0 96%
JF312073.1 Influenza A virus (A/swine/Illinois/A01057088/2010(H3N2)) segment 4 hemagglutinin (HA) gene, complete cds 2833 2833 100% 0.0 96%
CY045551.1 Influenza A virus (A/swine/Oklahoma/001142/2009(H3N2)) segment 4 sequence 2833 2833 100% 0.0 96%
AY779253.1 Influenza A virus (A/turkey/North Carolina/12344/03(H3N2)) hemagglutinin (HA) gene, complete cds 2833 2833 100% 0.0 96%
HQ734201.1 Influenza A virus (A/swine/Illinois/53612-6/2010(H3N2)) segment 4 hemagglutinin (HA) gene, complete cds 2827 2827 99% 0.0 96%
JF312072.1 Influenza A virus (A/swine/Illinois/A01057087/2010(H3N2)) segment 4 hemagglutinin (HA) gene, complete cds 2825 2825 100% 0.0 95%
AY779254.1 Influenza A virus (A/turkey/Minnesota/764-2/03(H3N2)) hemagglutinin (HA) gene, complete cds 2825 2825 100% 0.0 95%
GU135891.1 Influenza A virus (A/swine/Iowa/H03BF5/2003(H3N2)) segment 4 hemagglutinin (HA) gene, complete cds 2823 2823 100% 0.0 96%
HQ734204.1 Influenza A virus (A/swine/Illinois/53612-7/2010(H3N2)) segment 4 hemagglutinin (HA) gene, complete cds 2809 2809 100% 0.0 95%
DQ145537.1 Influenza A virus (A/swine/Minnesota/00395/2004(H3N1)) hemagglutinin gene, complete cds 2803 2803 100% 0.0 95%
JF316643.1 Influenza A virus (A/swine/Pennsylvania/057108-1/2010(H3N2)) segment 4 hemagglutinin (HA) gene, complete cds 2793 2793 100% 0.0 95%
EU422988.1 Influenza A virus (A/swine/Iowa/H03HO7/2003(H3N2)) segment 4 hemagglutinin (HA) gene, complete cds 2740 2740 100% 0.0 95%
DQ150433.1 Influenza A virus (A/swine/IN/PU542/04 (H3N1)) hemagglutinin (HA) gene, complete cds 2732 2732 100% 0.0 95%
EU857004.1 Influenza A virus (A/Hong Kong/CUHK4147/1997(H3N2)) hemagglutinin (HA) gene, complete cds 2706 2706 100% 0.0 95%
CY009716.1 Influenza A virus (A/New York/587/1996(H3N2)) segment 4, complete sequence 2706 2706 100% 0.0 95%
CY009692.1 Influenza A virus (A/New York/581/1997(H3N2)) segment 4, complete sequence 2706 2706 100% 0.0 95%
CY009516.1 Influenza A virus (A/New York/579/1997(H3N2)) segment 4, complete sequence 2706 2706 100% 0.0 95%
AF363502.1 Influenza A virus (A/Paris/896/97(H3N2)) hemagglutinin gene, complete cds 2706 2706 100% 0.0 95%
CY006475.1 Influenza A virus (A/New York/518/1998(H3N2)) segment 4, complete sequence 2706 2706 100% 0.0 95%
CY011128.1 Influenza A virus (A/New York/599/1996(H3N2)) segment 4, complete sequence 2698 2698 100% 0.0 95%
CY010588.1 Influenza A virus (A/New York/572/1996(H3N2)) segment 4, complete sequence 2698 2698 100% 0.0 95%
CY010068.1 Influenza A virus (A/New York/600/1996(H3N2)) segment 4, complete sequence 2698 2698 100% 0.0 95%
CY010044.1 Influenza A virus (A/New York/594/1996(H3N2)) segment 4, complete sequence 2698 2698 100% 0.0 95%
CY009668.1 Influenza A virus (A/New York/574/1996(H3N2)) segment 4, complete sequence 2698 2698 100% 0.0 95%
CY009524.1 Influenza A virus (A/New York/583/1997(H3N2)) segment 4, complete sequence 2698 2698 100% 0.0 95%
CY009508.1 Influenza A virus (A/New York/575/1996(H3N2)) segment 4, complete sequence 2698 2698 100% 0.0 95%
CY009684.1 Influenza A virus (A/New York/580/1996(H3N2)) segment 4, complete sequence 2698 2698 100% 0.0 95%
HM778115.1 Influenza A virus (A/swine/Illinois/03040/2010(H3N2)) segment 4 hemagglutinin (HA) gene, partial cds 2694 2694 96% 0.0 95%
CY009676.1 Influenza A virus (A/New York/576/1997(H3N2)) segment 4, complete sequence 2690 2690 100% 0.0 94%
CY009476.1 Influenza A virus (A/New York/565/1996(H3N2)) segment 4, complete sequence 2690 2690 100% 0.0 94%
CY009460.1 Influenza A virus (A/New York/560/1997(H3N2)) segment 4, complete sequence 2690 2690 100% 0.0 94%
AF363503.1 Influenza A virus (A/Paris/906/97(H3N2)) hemagglutinin gene, complete cds 2690 2690 100% 0.0 94%
CY009652.1 Influenza A virus (A/New York/566/1997(H3N2)) segment 4, complete sequence 2682 2682 100% 0.0 94%
CY009468.1 Influenza A virus (A/New York/564/1997(H3N2)) segment 4, complete sequence 2682 2682 100% 0.0 94%
CY006587.1 Influenza A virus (A/New York/541/1998(H3N2)) segment 4, complete sequence 2682 2682 100% 0.0 94%
CY035426.1 Influenza A virus (A/swine/Minnesota/SG-00237/2007(H3N2)) segment 4 sequence 2674 2674 99% 0.0 95%
CY009740.1 Influenza A virus (A/New York/590/1996(H3N2)) segment 4, complete sequence 2674 2674 100% 0.0 94%
EF551053.1 Influenza A virus (A/swine/North Carolina/2003(H3N2)) segment 4 hemagglutinin (HA) gene, complete cds 2658 2658 100% 0.0 94%
CY010516.1 Influenza A virus (A/New York/617/1996(H3N2)) segment 4, complete sequence 2658 2658 100% 0.0 94%
GU135918.1 Influenza A virus (A/swine/Iowa/H03HB4/2003(H3N2)) segment 4 hemagglutinin (HA) gene, complete cds 2650 2650 100% 0.0 94%
CY010628.1 Influenza A virus (A/New York/608/1996(H3N2)) segment 4, complete sequence 2650 2650 100% 0.0 94%
CY010036.1 Influenza A virus (A/New York/592/1996(H3N2)) segment 4, complete sequence 2650 2650 100% 0.0 94%
AF251395.2 Influenza A virus (A/swine/Ontario/00130/97(H3N2)) hemagglutinin (HA) gene, complete cds 2644 2644 99% 0.0 94%
EU422987.1 Influenza A virus (A/swine/Iowa/H02AS8/2002(H3N2)) segment 4 hemagglutinin (HA) gene, complete cds 2642 2642 100% 0.0 94%
CY010716.1 Influenza A virus (A/New York/631/1996(H3N2)) segment 4, complete sequence 2642 2642 100% 0.0 94%
CY011816.1 Influenza A virus (A/New York/652/1996(H3N2)) segment 4, complete sequence 2629 2629 99% 0.0 94%
CY045828.1 Influenza A virus (A/X-119(Puerto Rico/8/1934-Harbin/15/1992)(H3N2)) segment 4, complete sequence 2627 2627 100% 0.0 94%
CY009908.1 Influenza A virus (A/New York/593/1996(H3N2)) segment 4, complete sequence 2627 2627 100% 0.0 94%
AF363504.1 Influenza A virus (A/Paris/908/97(H3N2)) hemagglutinin gene, complete cds 2619 2619 100% 0.0 94%
EU857017.1 Influenza A virus (A/Hong Kong/CUHK4803/1997(H3N2)) hemagglutinin (HA) gene, partial cds 2617 2617 99% 0.0 94%
EU856845.1 Influenza A virus (A/Hong Kong/CUHK12563/1997(H3N2)) hemagglutinin (HA) gene, partial cds 2617 2617 99% 0.0 94%
EU857015.1 Influenza A virus (A/Hong Kong/CUHK4542/1997(H3N2)) hemagglutinin (HA) gene, partial cds 2615 2615 99% 0.0 94%
EU856920.1 Influenza A virus (A/Hong Kong/CUHK22013/1997(H3N2)) hemagglutinin (HA) gene, partial cds 2615 2615 99% 0.0 94%
CY039880.1 Influenza A virus (A/New York/537/1998(H3N2)) segment 4 sequence 2611 2611 100% 0.0 94%
EU856902.1 Influenza A virus (A/Hong Kong/CUHK20992/1997(H3N2)) hemagglutinin (HA) gene, complete cds 2611 2611 100% 0.0 94%
EU856899.1 Influenza A virus (A/Hong Kong/CUHK20320/1997(H3N2)) hemagglutinin (HA) gene, partial cds 2611 2611 99% 0.0 94%

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Wed Mar 09, 2011 9:28 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 27403
Location: Pittsburgh, PA USA
Top 100 NA matches

CY086922.1 Influenza A virus (A/swine/Minnesota/239105/2009(H3N2)) neuraminidase (NA) gene, complete cds 2795 2795 100% 0.0 100%
DQ469976.1 Influenza A virus (A/swine/British Columbia/28103/2005(H3N2)) neuraminidase (NA) gene, complete cds 2579 2579 99% 0.0 98%
EU826544.2 Influenza A virus (A/swine/Quebec/4001/2005(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 2565 2565 100% 0.0 97%
EU735820.1 Influenza A virus (A/turkey/OH/313053/2004(H3N2)) neuraminidase (NA) gene, complete cds 2557 2557 100% 0.0 97%
DQ469992.1 Influenza A virus (A/swine/Ontario/33853/2005(H3N2)) neuraminidase (NA) gene, complete cds 2557 2557 100% 0.0 97%
DQ469960.1 Influenza A virus (A/Ontario/RV1273/2005(H3N2)) neuraminidase (NA) gene, complete cds 2557 2557 100% 0.0 97%
DQ335773.1 Influenza A virus (A/turkey/Ohio/313053/04(H3N2)) neuraminidase (NA) gene, complete cds 2557 2557 100% 0.0 97%
DQ470000.1 Influenza A virus (A/turkey/Ontario/31232/2005(H3N2)) neuraminidase (NA) gene, complete cds 2547 2547 99% 0.0 97%
EU735828.1 Influenza A virus (A/turkey/NC/353568/2005(H3N2)) neuraminidase (NA) gene, complete cds 2518 2518 100% 0.0 97%
EF551055.1 Influenza A virus (A/swine/North Carolina/2003(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 2518 2518 100% 0.0 97%
EF551047.1 Influenza A virus (A/turkey/Illinois/2004(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 2518 2518 100% 0.0 97%
DQ469984.1 Influenza A virus (A/swine/Manitoba/12707/2005(H3N2)) neuraminidase (NA) gene, complete cds 2518 2518 100% 0.0 97%
EU743212.1 Influenza A virus (A/turkey/MN/366767/2005(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 2510 2510 100% 0.0 97%
DQ469968.1 Influenza A virus (A/swine/Alberta/14722/2005(H3N2)) neuraminidase (NA) gene, complete cds 2510 2510 100% 0.0 97%
FJ410142.1 Influenza A virus (A/swine/Minnesota/1145/2007(H3N2)) segment 6, complete sequence 2502 2502 100% 0.0 97%
EU826553.2 Influenza A virus (A/mink/Nova Scotia/1055488/2007(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 2502 2502 100% 0.0 97%
EU697206.1 Influenza A virus (A/turkey/Minnesota/366767/2005(H3N2)) neuraminidase (NA) gene, complete cds 2502 2502 100% 0.0 97%
EU697211.1 Influenza A virus (A/turkey/North Carolina/353568/2005(H3N2)) neuraminidase (NA) gene, complete cds 2494 2494 100% 0.0 97%
FJ519965.1 Influenza A virus (A/swine/Minnesota/1300/2007(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 2486 2486 100% 0.0 97%
FJ519961.1 Influenza A virus (A/swine/Minnesota/66853/2006(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 2486 2486 100% 0.0 97%
EU399753.1 Influenza A virus (A/Ontario/1252/2007(H3N2)) neuraminidase (NA) gene, complete cds 2486 2486 100% 0.0 97%
FJ519960.1 Influenza A virus (A/swine/Minnesota/65767/2006(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 2478 2478 100% 0.0 97%
FJ519964.1 Influenza A virus (A/swine/Minnesota/761/2007(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 2470 2470 100% 0.0 97%
FJ519962.1 Influenza A virus (A/swine/Minnesota/66960/2006(H3N2)) segment 6 neuraminidase (NA) gene, complete cds 2470 2470 100% 0.0 97%
CY045569.1 Influenza A virus (A/swine/Oklahoma/008722/2007(H3N2)) segment 6 sequence 2470 2470 100% 0.0 97%
EU103887.1 Influenza A virus (A/Denmark/04/2004(H3N2)) clone M46803 neuraminidase (NA) gene, complete cds 2470 2470 100% 0.0 97%
EU103836.1 Influenza A virus (A/Denmark/4/2002(H3N2)) clone 4-02 neuraminidase (NA) gene, complete cds 2470 2470 100% 0.0 97%
EU103825.1 Influenza A virus (A/Denmark/01/2002(H3N2)) clone 1-02 neuraminidase (NA) gene, complete cds 2470 2470 100% 0.0 97%
EU100585.1 Influenza A virus (A/Nebraska/18/2003(N2)) segment 6 neuraminidase (NA) gene, complete cds 2470 2470 100% 0.0 97%
EU100582.1 Influenza A virus (A/Texas/152/2003(N2)) segment 6 neuraminidase (NA) gene, complete cds 2470 2470 100% 0.0 97%
EU100579.1 Influenza A virus (A/Texas/78/2003(N2)) segment 6 neuraminidase (NA) gene, complete cds 2470 2470 100% 0.0 97%
EU100575.1 Influenza A virus (A/Illinois/03/2004(N2)) segment 6 neuraminidase (NA) gene, complete cds 2470 2470 100% 0.0 97%
EU100565.1 Influenza A virus (A/Texas/133/2003(N2)) segment 6 neuraminidase (NA) gene, complete cds 2470 2470 100% 0.0 97%
EU100564.1 Influenza A virus (A/Texas/132/2003(N2)) segment 6 neuraminidase (NA) gene, complete cds 2470 2470 100% 0.0 97%
DQ059384.2 Influenza A virus (A/Oklahoma/323/03(H3N2)) neuraminidase mRNA, complete cds 2470 2470 100% 0.0 97%
CY002346.1 Influenza A virus (A/New York/272/2003(H3N2)) segment 6, complete sequence 2470 2470 100% 0.0 97%
CY008918.1 Influenza A virus (A/New York/479/2003(H3N2)) segment 6, complete sequence 2470 2470 100% 0.0 97%
CY001295.1 Influenza A virus (A/New York/37/2003(H3N2)) segment 6, complete sequence 2470 2470 100% 0.0 97%
CY001023.1 Influenza A virus (A/New York/1/2003(H3N2)) segment 6, complete sequence 2470 2470 100% 0.0 97%
CY000903.1 Influenza A virus (A/New York/13/2003(H3N2)) segment 6, complete sequence 2470 2470 100% 0.0 97%
CY007789.1 Influenza A virus (A/Canterbury/102/2002(H3N2)) segment 6, complete sequence 2470 2470 100% 0.0 97%
CY007733.1 Influenza A virus (A/Canterbury/56/2002(H3N2)) segment 6, complete sequence 2470 2470 100% 0.0 97%
CY007261.1 Influenza A virus (A/Canterbury/443/2003(H3N2)) segment 6, complete sequence 2470 2470 100% 0.0 97%
CY007237.1 Influenza A virus (A/Canterbury/440/2003(H3N2)) segment 6, complete sequence 2470 2470 100% 0.0 97%
CY007173.1 Influenza A virus (A/Canterbury/431/2003(H3N2)) segment 6, complete sequence 2470 2470 100% 0.0 97%
CY006941.1 Influenza A virus (A/Canterbury/386/2003(H3N2)) segment 6, complete sequence 2470 2470 100% 0.0 97%
CY000035.1 Influenza A virus (A/New York/33/2004(H3N2)) segment 6, complete sequence 2470 2470 100% 0.0 97%
CY000147.1 Influenza A virus (A/New York/40/2003(H3N2)) segment 6, complete sequence 2470 2470 100% 0.0 97%
CY000171.1 Influenza A virus (A/New York/43/2003(H3N2)) segment 6, complete sequence 2470 2470 100% 0.0 97%
EU100556.1 Influenza A virus (A/Texas/29/2003(N2)) segment 6 neuraminidase (NA) gene, complete cds 2466 2466 100% 0.0 97%
CY001714.1 Influenza A virus (A/New York/271/2003(H3N2)) segment 6, complete sequence 2464 2464 99% 0.0 97%
EU100581.1 Influenza A virus (A/South Dakota/19/2003(N2)) segment 6 neuraminidase (NA) gene, complete cds 2462 2462 100% 0.0 97%
EU100570.1 Influenza A virus (A/Texas/40e/2003(N2)) segment 6 neuraminidase (NA) gene, complete cds 2462 2462 100% 0.0 97%
EU100569.1 Influenza A virus (A/Texas/141e/2003(N2)) segment 6 neuraminidase (NA) gene, complete cds 2462 2462 100% 0.0 97%
EU100568.1 Influenza A virus (A/Texas/140e/2003(N2)) segment 6 neuraminidase (NA) gene, complete cds 2462 2462 100% 0.0 97%
EU100567.1 Influenza A virus (A/Oklahoma/8/2003(N2)) segment 6 neuraminidase (NA) gene, complete cds 2462 2462 100% 0.0 97%
EU100566.1 Influenza A virus (A/Oklahoma/7/2003(N2)) segment 6 neuraminidase (NA) gene, complete cds 2462 2462 100% 0.0 97%
EU100557.1 Influenza A virus (A/Texas/41/2003(N2)) segment 6 neuraminidase (NA) gene, complete cds 2462 2462 100% 0.0 97%
CY022207.1 Influenza A virus (A/Auckland/614/2002(H3N2)) segment 6, complete sequence 2462 2462 100% 0.0 97%
CY018999.1 Influenza A virus (A/Queensland/35/2003(H3N2)) segment 6, complete sequence 2462 2462 100% 0.0 97%
CY018991.1 Influenza A virus (A/Queensland/34/2003(H3N2)) segment 6, complete sequence 2462 2462 100% 0.0 97%
CY018975.1 Influenza A virus (A/Queensland/31/2003(H3N2)) segment 6, complete sequence 2462 2462 100% 0.0 97%
CY017951.1 Influenza A virus (A/Queensland/40/2003(H3N2)) segment 6, complete sequence 2462 2462 100% 0.0 97%
CY017935.1 Influenza A virus (A/Queensland/37/2003(H3N2)) segment 6, complete sequence 2462 2462 100% 0.0 97%
CY017565.1 Influenza A virus (A/Queensland/33/2003(H3N2)) segment 6, complete sequence 2462 2462 100% 0.0 97%
CY015846.1 Influenza A virus (A/Western Australia/46/2003(H3N2)) segment 6, complete sequence 2462 2462 100% 0.0 97%
CY015838.1 Influenza A virus (A/Western Australia/45/2003(H3N2)) segment 6, complete sequence 2462 2462 100% 0.0 97%
CY015798.1 Influenza A virus (A/Western Australia/40/2003(H3N2)) segment 6, complete sequence 2462 2462 100% 0.0 97%
CY015774.1 Influenza A virus (A/Western Australia/37/2003(H3N2)) segment 6, complete sequence 2462 2462 100% 0.0 97%
CY013431.1 Influenza A virus (A/Waikato/15/2003(H3N2)) segment 6, complete sequence 2462 2462 100% 0.0 97%
CY013138.1 Influenza A virus (A/Waikato/54/2003(H3N2)) segment 6, complete sequence 2462 2462 100% 0.0 97%
CY013130.1 Influenza A virus (A/Waikato/53/2003(H3N2)) segment 6, complete sequence 2462 2462 100% 0.0 97%
CY013122.1 Influenza A virus (A/Waikato/46/2003(H3N2)) segment 6, complete sequence 2462 2462 100% 0.0 97%
CY013114.1 Influenza A virus (A/Waikato/21/2003(H3N2)) segment 6, complete sequence 2462 2462 100% 0.0 97%
CY012658.1 Influenza A virus (A/Wellington/47/2003(H3N2)) segment 6, complete sequence 2462 2462 100% 0.0 97%
CY012650.1 Influenza A virus (A/Wellington/9/2003(H3N2)) segment 6, complete sequence 2462 2462 100% 0.0 97%
CY012642.1 Influenza A virus (A/Dunedin/3/2002(H3N2)) segment 6, complete sequence 2462 2462 100% 0.0 97%
CY012426.1 Influenza A virus (A/Waikato/148/2003(H3N2)) segment 6, complete sequence 2462 2462 100% 0.0 97%
CY012410.1 Influenza A virus (A/Waikato/139/2003(H3N2)) segment 6, complete sequence 2462 2462 100% 0.0 97%
CY012394.1 Influenza A virus (A/Waikato/129/2003(H3N2)) segment 6, complete sequence 2462 2462 100% 0.0 97%
CY012386.1 Influenza A virus (A/Waikato/122/2003(H3N2)) segment 6, complete sequence 2462 2462 100% 0.0 97%
CY012362.1 Influenza A virus (A/Waikato/29/2003(H3N2)) segment 6, complete sequence 2462 2462 100% 0.0 97%
CY012354.1 Influenza A virus (A/Waikato/156/2003(H3N2)) segment 6, complete sequence 2462 2462 100% 0.0 97%
CY012346.1 Influenza A virus (A/Waikato/155/2003(H3N2)) segment 6, complete sequence 2462 2462 100% 0.0 97%
CY012338.1 Influenza A virus (A/Wellington/63/2002(H3N2)) segment 6, complete sequence 2462 2462 100% 0.0 97%
CY012098.1 Influenza A virus (A/Waikato/150/2003(H3N2)) segment 6, complete sequence 2462 2462 100% 0.0 97%
CY012082.1 Influenza A virus (A/Waikato/91/2003(H3N2)) segment 6, complete sequence 2462 2462 100% 0.0 97%
CY012074.1 Influenza A virus (A/Waikato/154/2003(H3N2)) segment 6, complete sequence 2462 2462 100% 0.0 97%
CY012050.1 Influenza A virus (A/Waikato/52/2002(H3N2)) segment 6, complete sequence 2462 2462 100% 0.0 97%
CY011762.1 Influenza A virus (A/Waikato/75/2003(H3N2)) segment 6, complete sequence 2462 2462 100% 0.0 97%
CY011746.1 Influenza A virus (A/Wellington/28/2003(H3N2)) segment 6, complete sequence 2462 2462 100% 0.0 97%
CY011730.1 Influenza A virus (A/Waikato/3/2003(H3N2)) segment 6, complete sequence 2462 2462 100% 0.0 97%
CY011722.1 Influenza A virus (A/Wellington/10/2003(H3N2)) segment 6, complete sequence 2462 2462 100% 0.0 97%
CY011706.1 Influenza A virus (A/Wellington/4/2003(H3N2)) segment 6, complete sequence 2462 2462 100% 0.0 97%
CY011698.1 Influenza A virus (A/Wellington/3/2003(H3N2)) segment 6, complete sequence 2462 2462 100% 0.0 97%
CY009022.1 Influenza A virus (A/Canterbury/400/2003(H3N2)) segment 6, complete sequence 2462 2462 100% 0.0 97%
CY009254.1 Influenza A virus (A/New York/480/2004(H3N2)) segment 6, complete sequence 2462 2462 100% 0.0 97%
CY008542.1 Influenza A virus (A/Canterbury/425/2003(H3N2)) segment 6, complete sequence 2462 2462 100% 0.0 97%
CY008894.1 Influenza A Virus (A/New York/476/2003(H3N2)) segment 6, complete sequence 2462 2462 100% 0.0 97%
EU100558.1 Influenza A virus (A/Texas/32/2003(N2)) segment 6 neuraminidase (NA) gene, complete cds 2458 2458 100% 0.0 96%

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Wed Mar 09, 2011 9:29 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 27403
Location: Pittsburgh, PA USA
Top 100 PB2 matches

CY086917.1 Influenza A virus (A/swine/Minnesota/239105/2009(H3N2)) polymerase PB2 (PB2) gene, complete cds 4520 4520 100% 0.0 100%
DQ469995.1 Influenza A virus (A/turkey/Ontario/31232/2005(H3N2)) polymerase subunit PB2 (PB2) gene, complete cds 4163 4163 100% 0.0 98%
DQ469987.1 Influenza A virus (A/swine/Ontario/33853/2005(H3N2)) polymerase subunit PB2 (PB2) gene, complete cds 4163 4163 100% 0.0 98%
DQ469971.1 Influenza A virus (A/swine/British Columbia/28103/2005(H3N2)) polymerase subunit PB2 (PB2) gene, complete cds 4163 4163 100% 0.0 98%
DQ469955.1 Influenza A virus (A/Ontario/RV1273/2005(H3N2)) polymerase subunit PB2 (PB2) gene, complete cds 4163 4163 100% 0.0 98%
EU826550.2 Influenza A virus (A/swine/Quebec/4001/2005(H3N2)) segment 1 polymerase PB2 (PB2) gene, complete cds 4147 4147 100% 0.0 97%
EU735825.1 Influenza A virus (A/turkey/OH/313053/2004(H3N2)) polymerase PB2 (PB2) gene, complete cds 4115 4115 100% 0.0 97%
DQ335778.1 Influenza A virus (A/turkey/Ohio/313053/04(H3N2)) polymerase PB2 (PB2) gene, complete cds 4115 4115 100% 0.0 97%
EF551042.1 Influenza A virus (A/turkey/Illinois/2004(H3N2)) segment 1 polymerase PB2 (PB2) gene, complete cds 4107 4107 100% 0.0 97%
EU735833.1 Influenza A virus (A/turkey/NC/353568/2005(H3N2)) polymerase PB2 (PB2) gene, complete cds 4092 4092 100% 0.0 97%
CY045564.1 Influenza A virus (A/swine/Oklahoma/008722/2007(H3N2)) segment 1 sequence 4084 4084 100% 0.0 97%
EU743217.1 Influenza A virus (A/turkey/MN/366767/2005(H3N2)) segment 1 polymerase PB2 (PB2) gene, complete cds 4084 4084 100% 0.0 97%
FJ410137.1 Influenza A virus (A/swine/Minnesota/1145/2007(H3N2)) segment 1, complete sequence 4082 4082 99% 0.0 97%
DQ469979.1 Influenza A virus (A/swine/Manitoba/12707/2005(H3N2)) polymerase subunit PB2 (PB2) gene, complete cds 4078 4078 100% 0.0 97%
DQ150422.1 Influenza A virus (A/swine/MI/PU243/04 (H3N1)) polymerase (PB2) gene, complete cds 4076 4076 100% 0.0 97%
EU826558.2 Influenza A virus (A/mink/Nova Scotia/1055488/2007(H3N2)) segment 1 polymerase PB2 (PB2) gene, complete cds 4044 4044 100% 0.0 97%
FJ638311.1 Influenza A virus (A/swine/IL/07003243/2007(H1N2)) segment 1 polymerase PB2 (PB2) gene, complete cds 4044 4044 100% 0.0 97%
EU399758.1 Influenza A virus (A/Ontario/1252/2007(H3N2)) polymerase subunit PB2 (PB2) gene, complete cds 4044 4044 100% 0.0 97%
HM461839.1 Influenza A virus (A/swine/Iowa/02096/2008(H1N1)) segment 1 polymerase PB2 (PB2) gene, partial cds 4030 4030 99% 0.0 97%
CY035417.1 Influenza A virus (A/swine/Minnesota/SG-00235/2007(H3N2)) segment 1 sequence 4030 4030 98% 0.0 97%
EU409958.1 Influenza A virus (A/swine/Ohio/C62006/2006(H1N1)) polymerase PB2 (PB2) gene, partial cds 4016 4016 99% 0.0 97%
CY035439.1 Influenza A virus (A/swine/Minnesota/SG-00242/2006(H3N2)) segment 1 sequence 4014 4014 98% 0.0 97%
DQ469963.1 Influenza A virus (A/swine/Alberta/14722/2005(H3N2)) polymerase subunit PB2 (PB2) gene, complete cds 4014 4014 100% 0.0 97%
CY035414.1 Influenza A virus (A/swine/Minnesota/SG-00234/2005(H3N2)) segment 1 sequence 4010 4010 98% 0.0 97%
CY035420.1 Influenza A virus (A/swine/Minnesota/SG-00236/2007(H3N2)) segment 1 sequence 4002 4002 98% 0.0 97%
CY035436.1 Influenza A virus (A/swine/Minnesota/SG-00241/2007(H1N1)) segment 1 sequence 3998 3998 98% 0.0 97%
CY035433.1 Influenza A virus (A/swine/Minnesota/SG-00240/2007(H1N1)) segment 1 sequence 3998 3998 98% 0.0 97%
CY035423.1 Influenza A virus (A/swine/Minnesota/SG-00237/2007(H3N2)) segment 1 sequence 3975 3975 98% 0.0 97%
CY035430.2 Influenza A virus (A/swine/Minnesota/SG-00239/2007(H1N2)) segment 1 sequence 3973 3973 100% 0.0 96%
EU409953.1 Influenza A virus (A/swine/Ohio/75004/2004(H1N1)) polymerase PB2 (PB2) gene, complete cds 3971 3971 99% 0.0 96%
HM461847.1 Influenza A virus (A/swine/Texas/01976/2008(H1N2)) segment 1 polymerase PB2 (PB2) gene, partial cds 3967 3967 99% 0.0 96%
CY041844.1 Influenza A virus (A/swine/North Carolina/R08-001877-D08-013371/2008 (H3N2)) segment 1 sequence 3965 3965 100% 0.0 96%
EU604691.1 Influenza A virus (A/swine/OH/511445/2007(H1N1)) segment 1 polymerase PB2 (PB2) gene, complete cds 3965 3965 100% 0.0 96%
HM461799.1 Influenza A virus (A/swine/Minnesota/02011/2008(H1N2)) segment 1 polymerase PB2 (PB2) gene, partial cds 3959 3959 99% 0.0 96%
CY045572.1 Influenza A virus (A/swine/Oklahoma/011506/2007(H3N2)) segment 1 sequence 3957 3957 100% 0.0 96%
CY042313.1 Influenza A virus (A/swine/Illinois/Sg-00444/2008(H1N1)) segment 1 sequence 3957 3957 100% 0.0 96%
DQ150430.1 Influenza A virus (A/swine/IN/PU542/04 (H3N1)) polymerase (PB2) gene, complete cds 3957 3957 100% 0.0 96%
CY035427.1 Influenza A virus (A/swine/Minnesota/SG-00238/2006(H1N1)) segment 1 sequence 3955 3955 98% 0.0 97%
CY042317.1 Influenza A virus (A/swine/Illinois/Sg-00445/2008(H1N1)) segment 1 sequence 3953 3953 100% 0.0 96%
HM461791.1 Influenza A virus (A/swine/Minnesota/02093/2008(H1N1)) segment 1 polymerase PB2 (PB2) gene, partial cds 3951 3951 99% 0.0 96%
GU135896.1 Influenza A virus (A/swine/Iowa/H02AS8/2002(H3N2)) segment 1 polymerase PB2 (PB2) gene, complete cds 3949 3949 100% 0.0 96%
CY045580.1 Influenza A virus (A/swine/Texas/008648/2008(H1N2)) segment 1 sequence 3949 3949 100% 0.0 96%
CY042309.1 Influenza A virus (A/swine/Illinois/Sg-00443/2008(H1N1)) segment 1 sequence 3949 3949 100% 0.0 96%
CY045652.1 Influenza A virus (A/swine/Oklahoma/011521-4/2008(H1N2)) segment 1 sequence 3941 3941 100% 0.0 96%
CY045644.1 Influenza A virus (A/swine/Oklahoma/011521-5/2008(H1N2)) segment 1 sequence 3941 3941 100% 0.0 96%
CY045620.1 Influenza A virus (A/swine/Oklahoma/011289-9/2008(H1N2)) segment 1 sequence 3941 3941 100% 0.0 96%
CY045612.1 Influenza A virus (A/swine/Oklahoma/010710-8/2008(H1N2)) segment 1 sequence 3941 3941 100% 0.0 96%
AF455737.1 Influenza A virus (A/Swine/Illinois/100085A/01 (H1N2)) polymerase subunit (PB2) gene, complete cds 3941 3941 100% 0.0 96%
EU409946.1 Influenza A virus (A/swine/Ohio/24366/2007(H1N1)) polymerase PB2 (PB2) gene, partial cds 3937 3937 99% 0.0 96%
GQ457546.1 Influenza A virus (A/Saskatchewan/5351/2009(H1N1)) segment 1 polymerase PB2 (PB2) gene, complete cds 3933 3933 100% 0.0 96%
GQ457545.1 Influenza A virus (A/Saskatchewan/5350/2009(H1N1)) segment 1 polymerase PB2 (PB2) gene, complete cds 3933 3933 100% 0.0 96%
GQ457544.1 Influenza A virus (A/Saskatchewan/5131/2009(H1N1)) segment 1 polymerase PB2 (PB2) gene, complete cds 3933 3933 100% 0.0 96%
CY045684.1 Influenza A virus (A/swine/Oklahoma/020734-3/2008(H1N2)) segment 1 sequence 3933 3933 100% 0.0 96%
CY045668.1 Influenza A virus (A/swine/Oklahoma/016179-9/2008(H1N2)) segment 1 sequence 3933 3933 100% 0.0 96%
CY045660.1 Influenza A virus (A/swine/Oklahoma/016179-8/2008(H1N2)) segment 1 sequence 3933 3933 100% 0.0 96%
CY045636.1 Influenza A virus (A/swine/Oklahoma/011289-8/2008(H1N2)) segment 1 sequence 3933 3933 100% 0.0 96%
CY045628.1 Influenza A virus (A/swine/Oklahoma/011289-10/2008(H1N2)) segment 1 sequence 3933 3933 100% 0.0 96%
CY045604.1 Influenza A virus (A/swine/Oklahoma/010710-9/2008(H1N2)) segment 1 sequence 3933 3933 100% 0.0 96%
GQ484358.1 Influenza A virus (A/swine/Kansas/77778/2007(H1N1)) segment 1 polymerase PB2 (PB2) gene, complete cds 3933 3933 100% 0.0 96%
HM125972.1 Influenza A virus (A/swine/MN/48683/2002(H1N1)) segment 1 polymerase PB2 (PB2) gene, complete cds 3925 3925 100% 0.0 96%
CY045700.1 Influenza A virus (A/swine/Oklahoma/020736-1/2008(H1N2)) segment 1 sequence 3925 3925 100% 0.0 96%
CY045692.1 Influenza A virus (A/swine/Oklahoma/020736-2/2008(H1N2)) segment 1 sequence 3925 3925 100% 0.0 96%
CY045588.1 Influenza A virus (A/swine/Oklahoma/010226-16/2008(H1N2)) segment 1 sequence 3925 3925 100% 0.0 96%
CY035445.1 Influenza A virus (A/swine/Illinois/SG-00244/2007(H1N1)) segment 1 sequence 3925 3925 98% 0.0 96%
HM461759.1 Influenza A virus (A/swine/Minnesota/02053/2008(H1N1)) segment 1 polymerase PB2 (PB2) gene, partial cds 3919 3919 99% 0.0 96%
HM125979.1 Influenza A virus (A/swine/MN/23506/2009(H1N1)) segment 1 polymerase PB2 (PB2) gene, complete cds 3917 3917 100% 0.0 96%
CY045676.1 Influenza A virus (A/swine/Oklahoma/020734-2/2008(H1N2)) segment 1 sequence 3917 3917 100% 0.0 96%
CY045516.1 Influenza A virus (A/swine/Oklahoma/032726/2008(H1N2)) segment 1 sequence 3917 3917 100% 0.0 96%
HM461767.1 Influenza A virus (A/swine/Iowa/02039/2008(H1N2)) segment 1 polymerase PB2 (PB2) gene, partial cds 3911 3911 99% 0.0 96%
HM461775.1 Influenza A virus (A/swine/Ohio/02026/2008(H1N1)) segment 1 polymerase PB2 (PB2) gene, partial cds 3911 3911 99% 0.0 96%
CY045596.1 Influenza A virus (A/swine/Oklahoma/010226-17/2008(H1N2)) segment 1 sequence 3909 3909 100% 0.0 96%
CY045540.1 Influenza A virus (A/swine/Oklahoma/053259/2008(H1N2)) segment 1 sequence 3909 3909 100% 0.0 96%
CY033794.2 Influenza A virus (A/mallard/South Dakota/Sg-00128/2007(H3N2)) segment 1 sequence 3909 3909 100% 0.0 96%
CY032880.2 Influenza A virus (A/mallard/South Dakota/Sg-00127/2007(H3N2)) segment 1 sequence 3909 3909 100% 0.0 96%
CY032879.2 Influenza A virus (A/northern pintail/South Dakota/Sg-00126/2007(H3N2)) segment 1 sequence 3909 3909 100% 0.0 96%
CY032878.2 Influenza A virus (A/mallard/South Dakota/Sg-00125/2007(H3N2)) segment 1 sequence 3909 3909 100% 0.0 96%
EU798919.1 Influenza A virus (A/swine/Korea/CAS08/2005(H1N1)) segment 1 polymerase PB2 (PB2) gene, complete cds 3909 3909 100% 0.0 96%
AF455738.1 Influenza A virus (A/Swine/Illinois/100084/01 (H1N2)) polymerase subunit (PB2) gene, complete cds 3909 3909 100% 0.0 96%
HM461815.1 Influenza A virus (A/swine/North Carolina/02023/2008(H1N1)) segment 1 polymerase PB2 (PB2) gene, partial cds 3903 3903 99% 0.0 96%
HM461823.1 Influenza A virus (A/swine/North Carolina/02084/2008(H1N1)) segment 1 polymerase PB2 (PB2) gene, partial cds 3903 3903 99% 0.0 96%
GU135880.1 Influenza A virus (A/swine/Iowa/H02PW7/2002(H1N1)) segment 1 polymerase PB2 (PB2) gene, complete cds 3901 3901 100% 0.0 96%
GU135954.1 Influenza A virus (A/swine/Iowa/H03LS4/2003(H1N1)) segment 1 polymerase PB2 (PB2) gene, complete cds 3901 3901 100% 0.0 96%
CY045708.1 Influenza A virus (A/swine/Oklahoma/042169/2008(H1N2)) segment 1 sequence 3901 3901 100% 0.0 96%
CY045524.1 Influenza A virus (A/swine/Texas/050593/2008(H1N2)) segment 1 sequence 3901 3901 100% 0.0 96%
HM461807.1 Influenza A virus (A/swine/Missouri/02060/2008(H1N1)) segment 1 polymerase PB2 (PB2) gene, partial cds 3895 3895 99% 0.0 96%
GU937744.1 Influenza A virus (A/Kansas/13/2009(H3N2)) segment 1 polymerase PB2 (PB2) gene, partial cds 3893 3893 99% 0.0 96%
GU135938.1 Influenza A virus (A/swine/Iowa/H03LDH5/2003(H3N2)) segment 1 polymerase PB2 (PB2) gene, complete cds 3893 3893 100% 0.0 96%
EU798918.1 Influenza A virus (A/swine/Korea/CAN01/2004(H1N1)) segment 1 polymerase PB2 (PB2) gene, complete cds 3893 3893 100% 0.0 96%
AY129163.1 Influenza A virus (A/Swine/Korea/CY02/02(H1N2)) polymerase subunit 2 (PB2) mRNA, complete cds 3893 3893 100% 0.0 96%
GU135907.1 Influenza A virus (A/swine/Iowa/H03G1/2003(H1N1)) segment 1 polymerase PB2 (PB2) gene, complete cds 3885 3885 100% 0.0 96%
GU135888.1 Influenza A virus (A/swine/Iowa/H03BF5/2003(H3N2)) segment 1 polymerase PB2 (PB2) gene, complete cds 3877 3877 100% 0.0 96%
CY045532.1 Influenza A virus (A/swine/Texas/050625/2008(H1N2)) segment 1 sequence 3877 3877 100% 0.0 96%
FJ638303.1 Influenza A virus (A/swine/NC/00573/2005(H1N1)) segment 1 polymerase PB2 (PB2) gene, complete cds 3877 3877 100% 0.0 96%
AF455731.1 Influenza A virus (A/Swine/Ohio/891/01(H1N2)) polymerase subunit (PB2) gene, complete cds 3877 3877 100% 0.0 96%
GU135864.1 Influenza A virus (A/swine/Iowa/H02NJ56371/2002(H1N1)) segment 1 polymerase PB2 (PB2) gene, complete cds 3870 3870 100% 0.0 96%
FJ611896.1 Influenza A virus (A/swine/Minnesota/07002083/2007(H1N1)) segment 1 polymerase PB2 (PB2) gene, complete cds 3870 3870 100% 0.0 96%
FJ638295.1 Influenza A virus (A/swine/IL/00685/2005(H1N1)) segment 1 polymerase PB2 (PB2) gene, complete cds 3870 3870 100% 0.0 96%
GU135970.1 Influenza A virus (A/swine/Iowa/H03UWF2/2003(H1N1)) segment 1 polymerase PB2 (PB2) gene, complete cds 3866 3866 100% 0.0 96%
GU135930.1 Influenza A virus (A/swine/Iowa/H03HS5/2003(H1N1)) segment 1 polymerase PB2 (PB2) gene, complete cds 3862 3862 100% 0.0 96%
CY035443.1 Influenza A virus (A/swine/Minnesota/SG-00243/2006(H3N2)) segment 1 sequence 3862 3862 97% 0.0 96%

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Wed Mar 09, 2011 9:31 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 27403
Location: Pittsburgh, PA USA
Top 100 PB1 matches

CY086918.1 Influenza A virus (A/swine/Minnesota/239105/2009(H3N2)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 4514 4514 100% 0.0 100%
DQ469964.1 Influenza A virus (A/swine/Alberta/14722/2005(H3N2)) polymerase subunit PB1 (PB1) gene, complete cds 4224 4224 99% 0.0 98%
DQ469988.1 Influenza A virus (A/swine/Ontario/33853/2005(H3N2)) polymerase subunit PB1 (PB1) gene, complete cds 4216 4216 99% 0.0 98%
DQ469956.1 Influenza A virus (A/Ontario/RV1273/2005(H3N2)) polymerase subunit PB1 (PB1) gene, complete cds 4216 4216 99% 0.0 98%
EU826549.2 Influenza A virus (A/swine/Quebec/4001/2005(H3N2)) segment 2 polymerase PB1 (PB1) gene, complete cds 4211 4211 99% 0.0 98%
EU692890.1 Influenza A virus (A/swine/Minnesota/66853/2006(H3N2)) segment 2 polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 4189 4189 100% 0.0 98%
CY035437.1 Influenza A virus (A/swine/Minnesota/SG-00241/2007(H1N1)) segment 2 sequence 4189 4189 99% 0.0 98%
DQ469980.1 Influenza A virus (A/swine/Manitoba/12707/2005(H3N2)) polymerase subunit PB1 (PB1) gene, complete cds 4185 4185 99% 0.0 98%
EU743216.1 Influenza A virus (A/turkey/MN/366767/2005(H3N2)) segment 2 polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 4181 4181 100% 0.0 98%
EU692900.1 Influenza A virus (A/swine/Minnesota/2411/2007(H1N2)) segment 2 polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 4173 4173 100% 0.0 98%
DQ335777.1 Influenza A virus (A/turkey/Ohio/313053/04(H3N2)) polymerase PB1 (PB1) gene, complete cds 4169 4169 99% 0.0 98%
EU735824.1 Influenza A virus (A/turkey/OH/313053/2004(H3N2)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 4165 4165 100% 0.0 98%
DQ469972.1 Influenza A virus (A/swine/British Columbia/28103/2005(H3N2)) polymerase subunit PB1 (PB1) gene, complete cds 4145 4145 99% 0.0 98%
CY035415.1 Influenza A virus (A/swine/Minnesota/SG-00234/2005(H3N2)) segment 2 sequence 4143 4143 99% 0.0 98%
HQ315644.1 Influenza A virus (A/swine/Minnesota/5947/2007(H3N2)) segment 2 polymerase PB1 (PB1) gene, complete cds 4141 4141 100% 0.0 97%
FJ410138.1 Influenza A virus (A/swine/Minnesota/1145/2007(H3N2)) segment 2, complete sequence 4141 4141 100% 0.0 97%
HM461832.1 Influenza A virus (A/swine/Nebraska/02013/2008(H1N1)) segment 2 polymerase PB1 (PB1) gene, partial cds 4137 4137 99% 0.0 97%
EU692892.1 Influenza A virus (A/swine/Minnesota/578/2007(H3N2)) segment 2 polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 4137 4137 100% 0.0 97%
CY035431.2 Influenza A virus (A/swine/Minnesota/SG-00239/2007(H1N2)) segment 2 sequence 4133 4133 100% 0.0 97%
EF551043.1 Influenza A virus (A/turkey/Illinois/2004(H3N2)) segment 2 polymerase PB1 (PB1) gene, complete cds 4129 4129 99% 0.0 97%
EU692907.1 Influenza A virus (A/swine/Minnesota/69353/2006(H1N1)) segment 2 polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 4125 4125 100% 0.0 97%
EU735832.1 Influenza A virus (A/turkey/NC/353568/2005(H3N2)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 4125 4125 100% 0.0 97%
DQ150423.1 Influenza A virus (A/swine/MI/PU243/04 (H3N1)) polymerase (PB1) gene, complete cds 4125 4125 100% 0.0 97%
HM461800.1 Influenza A virus (A/swine/Minnesota/02011/2008(H1N2)) segment 2 polymerase PB1 (PB1) gene, partial cds 4121 4121 99% 0.0 97%
EU692902.1 Influenza A virus (A/swine/Minnesota/3239/2007(H1N2)) segment 2 polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 4117 4117 100% 0.0 97%
EU692899.1 Influenza A virus (A/swine/Minnesota/1900/2007(H1N2)) segment 2 polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 4117 4117 100% 0.0 97%
CY035434.1 Influenza A virus (A/swine/Minnesota/SG-00240/2007(H1N1)) segment 2 sequence 4115 4115 99% 0.0 97%
EU826557.2 Influenza A virus (A/mink/Nova Scotia/1055488/2007(H3N2)) segment 2 polymerase PB1 (PB1) gene, complete cds 4113 4113 99% 0.0 97%
CY035428.1 Influenza A virus (A/swine/Minnesota/SG-00238/2006(H1N1)) segment 2 sequence 4109 4109 99% 0.0 97%
GQ457567.1 Influenza A virus (A/Saskatchewan/5351/2009(H1N1)) segment 2 polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 4101 4101 100% 0.0 97%
FJ638312.1 Influenza A virus (A/swine/IL/07003243/2007(H1N2)) segment 2 polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 4101 4101 100% 0.0 97%
EU692896.1 Influenza A virus (A/swine/Minnesota/7931/2007(H3N2)) segment 2 polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 4101 4101 100% 0.0 97%
GQ457565.1 Influenza A virus (A/Saskatchewan/5350/2009(H1N1)) segment 2 polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 4094 4094 100% 0.0 97%
CY045565.1 Influenza A virus (A/swine/Oklahoma/008722/2007(H3N2)) segment 2 sequence 4094 4094 100% 0.0 97%
HM125980.1 Influenza A virus (A/swine/MN/23506/2009(H1N1)) segment 2 polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 4090 4090 99% 0.0 97%
GQ457566.1 Influenza A virus (A/Saskatchewan/5131/2009(H1N1)) segment 2 polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 4088 4088 100% 0.0 97%
EU692894.1 Influenza A virus (A/swine/Minnesota/1300/2007(H3N2)) segment 2 polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 4086 4086 100% 0.0 97%
EU399757.1 Influenza A virus (A/Ontario/1252/2007(H3N2)) polymerase subunit PB1 (PB1) gene, complete cds 4082 4082 99% 0.0 97%
CY045573.1 Influenza A virus (A/swine/Oklahoma/011506/2007(H3N2)) segment 2 sequence 4078 4078 100% 0.0 97%
HM461760.1 Influenza A virus (A/swine/Minnesota/02053/2008(H1N1)) segment 2 polymerase PB1 (PB1) gene, partial cds 4066 4066 99% 0.0 97%
DQ469996.1 Influenza A virus (A/turkey/Ontario/31232/2005(H3N2)) polymerase subunit PB1 (PB1) gene, complete cds 4066 4066 99% 0.0 97%
EU409959.1 Influenza A virus (A/swine/Ohio/C62006/06(H1N1)) polymerase PB1 (PB1) gene, complete cds 4062 4062 99% 0.0 97%
HM461824.1 Influenza A virus (A/swine/North Carolina/02084/2008(H1N1)) segment 2 polymerase PB1 (PB1) gene, partial cds 4058 4058 99% 0.0 97%
GU135939.1 Influenza A virus (A/swine/Iowa/H03LDH5/2003(H3N2)) segment 2 polymerase PB1 (PB1) gene, complete cds 4054 4054 99% 0.0 97%
EU604692.1 Influenza A virus (A/swine/OH/511445/2007(H1N1)) segment 2 polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 4054 4054 100% 0.0 97%
EU409945.1 Influenza A virus (A/swine/Ohio/24366/07(H1N1)) polymerase PB1 (PB1) gene, complete cds 4054 4054 100% 0.0 97%
DQ150431.1 Influenza A virus (A/swine/IN/PU542/04 (H3N1)) polymerase (PB1) gene, complete cds 4046 4046 100% 0.0 97%
HQ315645.1 Influenza A virus (A/swine/Minnesota/65767/2006(H3N2)) segment 2 polymerase PB1 (PB1) gene, complete cds 4038 4038 100% 0.0 97%
CY035424.1 Influenza A virus (A/swine/Minnesota/SG-00237/2007(H3N2)) segment 2 sequence 4032 4032 98% 0.0 97%
CY045677.1 Influenza A virus (A/swine/Oklahoma/020734-2/2008(H1N2)) segment 2 sequence 4030 4030 100% 0.0 97%
CY045669.1 Influenza A virus (A/swine/Oklahoma/016179-9/2008(H1N2)) segment 2 sequence 4030 4030 100% 0.0 97%
CY045661.1 Influenza A virus (A/swine/Oklahoma/016179-8/2008(H1N2)) segment 2 sequence 4030 4030 100% 0.0 97%
CY045653.1 Influenza A virus (A/swine/Oklahoma/011521-4/2008(H1N2)) segment 2 sequence 4030 4030 100% 0.0 97%
CY045645.1 Influenza A virus (A/swine/Oklahoma/011521-5/2008(H1N2)) segment 2 sequence 4030 4030 100% 0.0 97%
CY045637.1 Influenza A virus (A/swine/Oklahoma/011289-8/2008(H1N2)) segment 2 sequence 4030 4030 100% 0.0 97%
CY045629.1 Influenza A virus (A/swine/Oklahoma/011289-10/2008(H1N2)) segment 2 sequence 4030 4030 100% 0.0 97%
CY045621.1 Influenza A virus (A/swine/Oklahoma/011289-9/2008(H1N2)) segment 2 sequence 4030 4030 100% 0.0 97%
CY045605.1 Influenza A virus (A/swine/Oklahoma/010710-9/2008(H1N2)) segment 2 sequence 4030 4030 100% 0.0 97%
HM461808.1 Influenza A virus (A/swine/Missouri/02060/2008(H1N1)) segment 2 polymerase PB1 (PB1) gene, partial cds 4026 4026 99% 0.0 97%
CY045693.1 Influenza A virus (A/swine/Oklahoma/020736-2/2008(H1N2)) segment 2 sequence 4022 4022 100% 0.0 97%
CY045613.1 Influenza A virus (A/swine/Oklahoma/010710-8/2008(H1N2)) segment 2 sequence 4022 4022 100% 0.0 97%
EU692901.1 Influenza A virus (A/swine/Minnesota/2728/2007(H1N2)) segment 2 polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 4022 4022 100% 0.0 97%
EU692897.1 Influenza A virus (A/swine/Minnesota/64585/2006(H1N2)) segment 2 polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 4022 4022 100% 0.0 97%
GQ484357.1 Influenza A virus (A/swine/Kansas/77778/2007(H1N1)) segment 2 polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 4018 4018 99% 0.0 97%
CY035446.1 Influenza A virus (A/swine/Illinois/SG-00244/2007(H1N1)) segment 2 sequence 4018 4018 99% 0.0 97%
CY045709.1 Influenza A virus (A/swine/Oklahoma/042169/2008(H1N2)) segment 2 sequence 4014 4014 100% 0.0 97%
CY045701.1 Influenza A virus (A/swine/Oklahoma/020736-1/2008(H1N2)) segment 2 sequence 4014 4014 100% 0.0 97%
CY045685.1 Influenza A virus (A/swine/Oklahoma/020734-3/2008(H1N2)) segment 2 sequence 4014 4014 100% 0.0 97%
CY045597.1 Influenza A virus (A/swine/Oklahoma/010226-17/2008(H1N2)) segment 2 sequence 4014 4014 100% 0.0 97%
CY045589.1 Influenza A virus (A/swine/Oklahoma/010226-16/2008(H1N2)) segment 2 sequence 4014 4014 100% 0.0 97%
EU692898.1 Influenza A virus (A/swine/Minnesota/66743/2006(H1N2)) segment 2 polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 4014 4014 100% 0.0 97%
CY035440.1 Influenza A virus (A/swine/Minnesota/SG-00242/2006(H3N2)) segment 2 sequence 4012 4012 99% 0.0 97%
HM461816.1 Influenza A virus (A/swine/North Carolina/02023/2008(H1N1)) segment 2 polymerase PB1 (PB1) gene, partial cds 4010 4010 99% 0.0 97%
CY045541.1 Influenza A virus (A/swine/Oklahoma/053259/2008(H1N2)) segment 2 sequence 4006 4006 100% 0.0 97%
CY042310.1 Influenza A virus (A/swine/Illinois/Sg-00443/2008(H1N1)) segment 2 sequence 4006 4006 100% 0.0 97%
EU692895.1 Influenza A virus (A/swine/Minnesota/7209/2007(H3N2)) segment 2 polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 4006 4006 100% 0.0 97%
CY045533.1 Influenza A virus (A/swine/Texas/050625/2008(H1N2)) segment 2 sequence 3998 3998 100% 0.0 97%
CY045581.1 Influenza A virus (A/swine/Texas/008648/2008(H1N2)) segment 2 sequence 3990 3990 100% 0.0 97%
HM461768.1 Influenza A virus (A/swine/Iowa/02039/2008(H1N2)) segment 2 polymerase PB1 (PB1) gene, partial cds 3987 3987 99% 0.0 97%
CY045525.1 Influenza A virus (A/swine/Texas/050593/2008(H1N2)) segment 2 sequence 3975 3975 99% 0.0 97%
CY045517.1 Influenza A virus (A/swine/Oklahoma/032726/2008(H1N2)) segment 2 sequence 3975 3975 100% 0.0 97%
HM461792.1 Influenza A virus (A/swine/Minnesota/02093/2008(H1N1)) segment 2 polymerase PB1 (PB1) gene, partial cds 3971 3971 99% 0.0 97%
CY086926.1 Influenza A virus (A/swine/Minnesota/239106/2010(H1N2)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3959 3959 100% 0.0 96%
CY041845.1 Influenza A virus (A/swine/North Carolina/R08-001877-D08-013371/2008 (H3N2)) segment 2 sequence 3959 3959 100% 0.0 96%
CY042318.1 Influenza A virus (A/swine/Illinois/Sg-00445/2008(H1N1)) segment 2 sequence 3957 3957 98% 0.0 97%
GU937745.1 Influenza A virus (A/Kansas/13/2009(H3N2)) segment 2 polymerase PB1 (PB1) gene, complete cds 3955 3955 99% 0.0 96%
AF455727.1 Influenza A virus (A/Swine/Iowa/930/01(H1N2)) polymerase subunit (PB1) gene, complete cds 3953 3953 99% 0.0 96%
HQ840336.1 Influenza A virus (A/swine/South Dakota/152B/2009(H1N2)) segment 2 polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3947 3947 99% 0.0 96%
EU692893.1 Influenza A virus (A/swine/Minnesota/761/2007(H3N2)) segment 2 polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3943 3943 100% 0.0 96%
HQ734220.1 Influenza A virus (A/swine/Pennsylvania/62170-3/2010(H3N2)) segment 2 polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3915 3915 99% 0.0 96%
CY033790.2 Influenza A virus (A/mallard/South Dakota/Sg-00125/2007(H3N2)) segment 2 sequence 3913 3913 99% 0.0 96%
CY041861.1 Influenza A virus (A/northern pintail/South Dakota/Sg-00126/2007(H3N2)) segment 2 sequence 3913 3913 99% 0.0 96%
CY086894.1 Influenza A virus (A/swine/North Carolina/226125/2010(H1N2)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3911 3911 100% 0.0 96%
CY041877.1 Influenza A virus (A/mallard/South Dakota/Sg-00128/2007(H3N2)) segment 2 sequence 3905 3905 99% 0.0 96%
CY041869.1 Influenza A virus (A/mallard/South Dakota/Sg-00127/2007(H3N2)) segment 2 sequence 3905 3905 99% 0.0 96%
CY086902.1 Influenza A virus (A/swine/North Carolina/226126/2010(H1N2)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3903 3903 100% 0.0 96%
HQ734208.1 Influenza A virus (A/swine/Pennsylvania/62170-1/2010(H3N2)) segment 2 polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3899 3899 99% 0.0 96%
CY045557.1 Influenza A virus (A/swine/Kansas/015252/2009(H3N2)) segment 2 sequence 3887 3887 100% 0.0 96%
HM461840.1 Influenza A virus (A/swine/Iowa/02096/2008(H1N1)) segment 2 polymerase PB1 (PB1) gene, partial cds 3874 3874 97% 0.0 96%
AF342823.1 Influenza A virus (A/Wisconsin/10/98 (H1N1)) PB1 gene, complete cds 3866 3866 99% 0.0 96%

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Wed Mar 09, 2011 9:32 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 27403
Location: Pittsburgh, PA USA
Top 100 PA matches

CY086919.1 Influenza A virus (A/swine/Minnesota/239105/2009(H3N2)) polymerase PA (PA) gene, complete cds 4264 4264 100% 0.0 100%
CY087005.1 Influenza A virus (A/New York/3256/2009(N1)) polymerase PA (PA) gene, complete cds 4232 4232 100% 0.0 99%
CY086998.1 Influenza A virus (A/New York/3251/2009(H1N1)) polymerase PA (PA) gene, complete cds 4232 4232 100% 0.0 99%
CY086974.1 Influenza A virus (A/New York/3198/2009(H1N1)) polymerase PA (PA) gene, complete cds 4232 4232 100% 0.0 99%
CY040722.2 Influenza A virus (A/New York/3238/2009(H1N1)) polymerase PA (PA) gene, complete cds 4232 4232 100% 0.0 99%
CY083891.1 Influenza A virus (A/San Diego/INS72/2009(H1N1)) polymerase PA (PA) gene, complete cds 4232 4232 100% 0.0 99%
CY083718.1 Influenza A virus (A/Madrid/INS112/2009(H1N1)) polymerase PA (PA) gene, complete cds 4232 4232 100% 0.0 99%
CY083486.1 Influenza A virus (A/Mexico City/WRAIR1691N/2009(H1N1)) polymerase PA (PA) gene, complete cds 4232 4232 100% 0.0 99%
CY083422.1 Influenza A virus (A/San Diego/WRAIR1667P/2009(H1N1)) polymerase PA (PA) gene, complete cds 4232 4232 100% 0.0 99%
CY083366.1 Influenza A virus (A/South Carolina/WRAIR1660P/2009(H1N1)) polymerase PA (PA) gene, complete cds 4232 4232 100% 0.0 99%
CY083358.1 Influenza A virus (A/San Diego/WRAIR1658P/2009(H1N1)) polymerase PA (PA) gene, complete cds 4232 4232 100% 0.0 99%
CY083350.1 Influenza A virus (A/San Diego/WRAIR1657P/2009(H1N1)) polymerase PA (PA) gene, complete cds 4232 4232 100% 0.0 99%
CY083311.1 Influenza A virus (A/San Diego/WRAIR1649P/2009(H1N1)) polymerase PA (PA) gene, complete cds 4232 4232 100% 0.0 99%
CY083239.1 Influenza A virus (A/Virginia/WRAIR1511P/2009(H1N1)) polymerase PA (PA) gene, complete cds 4232 4232 100% 0.0 99%
CY074022.1 Influenza A virus (A/Argentina/HNRG32/2009(H1N1)) segment 3 sequence 4232 4232 100% 0.0 99%
CY075665.1 Influenza A virus (A/Boston/628/2009(H1N1)) segment 3, complete sequence 4232 4232 100% 0.0 99%
CY075609.1 Influenza A virus (A/Boston/681/2009(H1N1)) segment 3, complete sequence 4232 4232 100% 0.0 99%
CY075593.1 Influenza A virus (A/Boston/666/2009(H1N1)) segment 3, complete sequence 4232 4232 100% 0.0 99%
CY075537.1 Influenza A virus (A/Boston/612/2009(H1N1)) segment 3, complete sequence 4232 4232 100% 0.0 99%
CY075472.1 Influenza A virus (A/Chile/4438/2009(H1N1)) segment 3, complete sequence 4232 4232 100% 0.0 99%
CY075464.1 Influenza A virus (A/Chile/4406/2009(H1N1)) segment 3, complete sequence 4232 4232 100% 0.0 99%
CY075448.1 Influenza A virus (A/Chile/4182/2009(H1N1)) segment 3, complete sequence 4232 4232 100% 0.0 99%
CY075440.1 Influenza A virus (A/Chile/4181/2009(H1N1)) segment 3, complete sequence 4232 4232 100% 0.0 99%
CY075416.1 Influenza A virus (A/Chile/3905/2009(H1N1)) segment 3, complete sequence 4232 4232 100% 0.0 99%
CY075392.1 Influenza A virus (A/Chile/3760/2009(H1N1)) segment 3, complete sequence 4232 4232 100% 0.0 99%
CY075368.1 Influenza A virus (A/Chile/3467/2009(H1N1)) segment 3, complete sequence 4232 4232 100% 0.0 99%
CY075344.1 Influenza A virus (A/Chile/3361/2009(H1N1)) segment 3, complete sequence 4232 4232 100% 0.0 99%
CY075296.1 Influenza A virus (A/Chile/3123/2009(H1N1)) segment 3, complete sequence 4232 4232 100% 0.0 99%
CY075288.1 Influenza A virus (A/Chile/3056/2009(H1N1)) segment 3, complete sequence 4232 4232 100% 0.0 99%
CY075272.1 Influenza A virus (A/Chile/2994/2009(H1N1)) segment 3, complete sequence 4232 4232 100% 0.0 99%
CY075264.1 Influenza A virus (A/Chile/2911/2009(H1N1)) segment 3, complete sequence 4232 4232 100% 0.0 99%
CY075240.1 Influenza A virus (A/Chile/2851/2009(H1N1)) segment 3, complete sequence 4232 4232 100% 0.0 99%
CY075232.1 Influenza A virus (A/Chile/2239/2009(H1N1)) segment 3, complete sequence 4232 4232 100% 0.0 99%
CY075224.1 Influenza A virus (A/Chile/2009/2009(H1N1)) segment 3, complete sequence 4232 4232 100% 0.0 99%
CY075216.1 Influenza A virus (A/Chile/1624/2009(H1N1)) segment 3, complete sequence 4232 4232 100% 0.0 99%
CY075208.1 Influenza A virus (A/Chile/1603/2009(H1N1)) segment 3, complete sequence 4232 4232 100% 0.0 99%
CY075200.1 Influenza A virus (A/Chile/1600/2009(H1N1)) segment 3, complete sequence 4232 4232 100% 0.0 99%
CY075184.1 Influenza A virus (A/Chile/1598/2009(H1N1)) segment 3, complete sequence 4232 4232 100% 0.0 99%
CY075168.1 Influenza A virus (A/Chile/180/2009(H1N1)) segment 3, complete sequence 4232 4232 100% 0.0 99%
CY075160.1 Influenza A virus (A/Chile/158/2009(H1N1)) segment 3, complete sequence 4232 4232 100% 0.0 99%
CY075152.1 Influenza A virus (A/Chile/95/2009(H1N1)) segment 3, complete sequence 4232 4232 100% 0.0 99%
CY075144.1 Influenza A virus (A/Chile/88/2009(H1N1)) segment 3, complete sequence 4232 4232 100% 0.0 99%
CY075136.1 Influenza A virus (A/Chile/56/2009(H1N1)) segment 3, complete sequence 4232 4232 100% 0.0 99%
CY075088.1 Influenza A virus (A/Chile/28/2009(H1N1)) segment 3, complete sequence 4232 4232 100% 0.0 99%
CY075013.1 Influenza A virus (A/Thailand/CU-H910/2009(H1N1)) segment 3 sequence 4232 4232 100% 0.0 99%
CY074973.1 Influenza A virus (A/Thailand/CU-C161/2009(H1N1)) segment 3 sequence 4232 4232 100% 0.0 99%
CY073417.1 Influenza A virus (A/San Diego/WR1640P/2009(H1N1)) segment 3 sequence 4232 4232 100% 0.0 99%
CY073409.1 Influenza A virus (A/San Diego/WR1639P/2009(H1N1)) segment 3 sequence 4232 4232 100% 0.0 99%
CY073253.1 Influenza A virus (A/Athens/WRAIR2962N/2009(H1N1)) segment 3 sequence 4232 4232 100% 0.0 99%
CY072787.1 Influenza A virus (A/Managua/5401.01/2009(H1N1)) segment 3, complete sequence 4232 4232 100% 0.0 99%
CY072731.1 Influenza A virus (A/Managua/4407.02/2009(H1N1)) segment 3, complete sequence 4232 4232 100% 0.0 99%
CY071473.1 Influenza A virus (A/California/WR1313P/2009(H1N1)) segment 3 sequence 4232 4232 100% 0.0 99%
CY071052.1 Influenza A virus (A/New York/NHRC0004/2009(H1N1)) segment 3, complete sequence 4232 4232 100% 0.0 99%
CY071044.1 Influenza A virus (A/New York/NHRC0003/2009(H1N1)) segment 3, complete sequence 4232 4232 100% 0.0 99%
CY069111.1 Influenza A virus (A/Guam/NHRC0028/2009(H1N1)) segment 3, complete sequence 4232 4232 100% 0.0 99%
CY069087.1 Influenza A virus (A/Guam/NHRC0025/2009(H1N1)) segment 3, complete sequence 4232 4232 100% 0.0 99%
CY068919.1 Influenza A virus (A/Japan/NHRC0003/2009(H1N1)) segment 3, complete sequence 4232 4232 100% 0.0 99%
HM849037.1 Influenza A virus (A/Kurume/K0910/2009(H1N1)) segment 3 polymerase PA (PA) gene, complete cds 4232 4232 100% 0.0 99%
CY067020.1 Influenza A virus (A/Bochum/INS249/2009(H1N1)) segment 3, complete sequence 4232 4232 100% 0.0 99%
CY066828.1 Influenza A virus (A/Antwerp/INS221/2009(H1N1)) segment 3, complete sequence 4232 4232 100% 0.0 99%
CY065965.1 Influenza A virus (A/Japan/NHRC0002/2009(H1N1)) segment 3, complete sequence 4232 4232 100% 0.0 99%
CY065761.1 Influenza A virus (A/British Columbia/GFA0401/2009(H1N1)) segment 3 sequence 4232 4232 100% 0.0 99%
CY064900.1 Influenza A virus (A/Boston/136/2009(H1N1)) segment 3, complete sequence 4232 4232 100% 0.0 99%
CY064737.1 Influenza A virus (A/Mexico City/023/2009(H1N1)) segment 3, complete sequence 4232 4232 100% 0.0 99%
CY064729.1 Influenza A virus (A/Mexico City/022/2009(H1N1)) segment 3, complete sequence 4232 4232 100% 0.0 99%
CY064721.1 Influenza A virus (A/Mexico City/021/2009(H1N1)) segment 3, complete sequence 4232 4232 100% 0.0 99%
CY064713.1 Influenza A virus (A/Mexico City/020/2009(H1N1)) segment 3, complete sequence 4232 4232 100% 0.0 99%
CY064705.1 Influenza A virus (A/Mexico City/019/2009(H1N1)) segment 3, complete sequence 4232 4232 100% 0.0 99%
CY064657.1 Influenza A virus (A/Boston/137/2009(H1N1)) segment 3, complete sequence 4232 4232 100% 0.0 99%
CY064649.1 Influenza A virus (A/Boston/135/2009(H1N1)) segment 3, complete sequence 4232 4232 100% 0.0 99%
CY064601.1 Influenza A virus (A/Boston/129/2009(H1N1)) segment 3, complete sequence 4232 4232 100% 0.0 99%
CY064593.1 Influenza A virus (A/Boston/127/2009(H1N1)) segment 3, complete sequence 4232 4232 100% 0.0 99%
CY064577.1 Influenza A virus (A/Boston/125/2009(H1N1)) segment 3, complete sequence 4232 4232 100% 0.0 99%
CY064521.1 Influenza A virus (A/Boston/117/2009(H1N1)) segment 3, complete sequence 4232 4232 100% 0.0 99%
CY064505.1 Influenza A virus (A/Boston/115/2009(H1N1)) segment 3, complete sequence 4232 4232 100% 0.0 99%
CY064497.1 Influenza A virus (A/Boston/109/2009(H1N1)) segment 3, complete sequence 4232 4232 100% 0.0 99%
CY064481.1 Influenza A virus (A/Boston/106/2009(H1N1)) segment 3, complete sequence 4232 4232 100% 0.0 99%
CY064473.1 Influenza A virus (A/Boston/103/2009(H1N1)) segment 3, complete sequence 4232 4232 100% 0.0 99%
CY063539.1 Influenza A virus (A/Boston/148/2009(H1N1)) segment 3, complete sequence 4232 4232 100% 0.0 99%
CY063507.1 Influenza A virus (A/Boston/113/2009(H1N1)) segment 3, complete sequence 4232 4232 100% 0.0 99%
CY063491.1 Influenza A virus (A/Boston/110/2009(H1N1)) segment 3, complete sequence 4232 4232 100% 0.0 99%
CY062640.1 Influenza A virus (A/Mexico City/014/2009(H1N1)) segment 3, complete sequence 4232 4232 100% 0.0 99%
CY062497.1 Influenza A virus (A/Mexico city/CIA2/2009(H1N1)) segment 3 sequence 4232 4232 100% 0.0 99%
HM173604.1 Influenza A virus (A/Blagovechensk/01/2009(H1N1)) segment 3 polymerase PA (PA) gene, complete cds 4232 4232 100% 0.0 99%
CY061567.1 Influenza A virus (A/Texas/JMS367/2009(H1N1)) segment 3, complete sequence 4232 4232 100% 0.0 99%
CY060741.1 Influenza A virus (A/Ontario/9698/2009(H1N1)) segment 3 sequence 4232 4232 100% 0.0 99%
CY060733.1 Influenza A virus (A/Ontario/35273/2009(H1N1)) segment 3 sequence 4232 4232 100% 0.0 99%
CY058665.1 Influenza A virus (A/Wisconsin/629-D01913/2009(H1N1)) segment 3, complete sequence 4232 4232 100% 0.0 99%
CY058649.1 Influenza A virus (A/Wisconsin/629-D02329/2009(H1N1)) segment 3, complete sequence 4232 4232 100% 0.0 99%
CY058265.1 Influenza A virus (A/Managua/164.01/2009(H1N1)) segment 3, complete sequence 4232 4232 100% 0.0 99%
CY058035.1 Influenza A virus (A/Wisconsin/629-D00636/2009(H1N1)) segment 3, complete sequence 4232 4232 100% 0.0 99%
CY057891.1 Influenza A virus (A/Wisconsin/629-D00533/2009(H1N1)) segment 3, complete sequence 4232 4232 100% 0.0 99%
CY057395.1 Influenza A virus (A/Wisconsin/629-D00036/2009(H1N1)) segment 3, complete sequence 4232 4232 100% 0.0 99%
CY056576.1 Influenza A virus (A/New York/5755/2009(H1N1)) segment 3, complete sequence 4232 4232 100% 0.0 99%
CY055650.1 Influenza A virus (A/Australia/26/2009(H1N1)) segment 3, complete sequence 4232 4232 100% 0.0 99%
CY055468.1 Influenza A virus (A/California/VRDL14/2009(H1N1)) segment 3, complete sequence 4232 4232 100% 0.0 99%
CY055420.1 Influenza A virus (A/Wisconsin/629-D00809/2009(H1N1)) segment 3, complete sequence 4232 4232 100% 0.0 99%
GU562455.1 Influenza A virus (A/Perm/01/2009(H1N1)) segment 3 polymerase PA (PA) gene, complete cds 4232 4232 100% 0.0 99%
CY055032.1 Influenza A virus (A/California/VRDL68/2009(H1N1)) segment 3, complete sequence 4232 4232 100% 0.0 99%
CY072891.1 Influenza A virus (A/Managua/12.01/2009(H1N1)) segment 3, complete sequence 4228 4228 100% 0.0 99%

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Wed Mar 09, 2011 9:33 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 27403
Location: Pittsburgh, PA USA
Top 100 NP matches

CY086921.1 Influenza A virus (A/swine/Minnesota/239105/2009(H3N2)) nucleocapsid protein (NP) gene, complete cds 2968 2968 100% 0.0 100%
CY087011.1 Influenza A virus (A/New York/3565/2009(H1N1)) nucleocapsid protein (NP) gene, complete cds 2960 2960 100% 0.0 99%
CY086996.1 Influenza A virus (A/New York/3251/2009(H1N1)) nucleocapsid protein (NP) gene, complete cds 2960 2960 100% 0.0 99%
CY086988.1 Influenza A virus (A/New York/3250/2009(H1N1)) nucleocapsid protein (NP) gene, complete cds 2960 2960 100% 0.0 99%
CY086980.1 Influenza A virus (A/New York/3217/2009(H1N1)) nucleocapsid protein (NP) gene, complete cds 2960 2960 100% 0.0 99%
CY086972.1 Influenza A virus (A/New York/3198/2009(H1N1)) nucleocapsid protein (NP) gene, complete cds 2960 2960 100% 0.0 99%
CY084449.1 Influenza A virus (A/New York/6902/2009(H1N1)) nucleocapsid protein (NP) gene, complete cds 2960 2960 100% 0.0 99%
CY083716.1 Influenza A virus (A/Madrid/INS112/2009(H1N1)) nucleocapsid protein (NP) gene, complete cds 2960 2960 100% 0.0 99%
CY083664.1 Influenza A virus (A/San Diego/INS41/2009(H1N1)) nucleocapsid protein (NP) gene, complete cds 2960 2960 100% 0.0 99%
CY083650.1 Influenza A virus (A/District of Columbia/INS22/2009(H1N1)) nucleocapsid protein (NP) gene, complete cds 2960 2960 100% 0.0 99%
CY083568.1 Influenza A virus (A/Lima/WRAIR8511F/2009(H1N1)) nucleocapsid protein (NP) gene, complete cds 2960 2960 100% 0.0 99%
CY083512.1 Influenza A virus (A/Piura/WRAIR1694P/2009(H1N1)) nucleocapsid protein (NP) gene, complete cds 2960 2960 100% 0.0 99%
CY083416.1 Influenza A virus (A/San Diego/WRAIR1666P/2009(H1N1)) nucleocapsid protein (NP) gene, complete cds 2960 2960 100% 0.0 99%
CY083392.1 Influenza A virus (A/San Diego/WRAIR1663P/2009(H1N1)) nucleocapsid protein (NP) gene, complete cds 2960 2960 100% 0.0 99%
CY083384.1 Influenza A virus (A/San Diego/WRAIR1662P/2009(H1N1)) nucleocapsid protein (NP) gene, complete cds 2960 2960 100% 0.0 99%
CY083360.1 Influenza A virus (A/San Diego/WRAIR1658P/2009(H1N1)) nucleocapsid protein (NP) gene, complete cds 2960 2960 100% 0.0 99%
CY083257.1 Influenza A virus (A/San Diego/WRAIR1642P/2009(H1N1)) nucleocapsid protein (NP) gene, complete cds 2960 2960 100% 0.0 99%
CY083233.1 Influenza A virus (A/Guam/WRAIR1510P/2009(H1N1)) nucleocapsid protein (NP) gene, complete cds 2960 2960 100% 0.0 99%
CY083225.1 Influenza A virus (A/California/WRAIR1507P/2009(H1N1)) nucleocapsid protein (NP) gene, complete cds 2960 2960 100% 0.0 99%
CY083121.1 Influenza A virus (A/Quito/WRAIR0617T/2009(H1N1)) nucleocapsid protein (NP) gene, complete cds 2960 2960 100% 0.0 99%
CY083105.1 Influenza A virus (A/Piura/WRAIR0603F/2009(H1N1)) nucleocapsid protein (NP) gene, complete cds 2960 2960 100% 0.0 99%
CY083097.1 Influenza A virus (A/Lima/WRAIR0519F/2009(H1N1)) nucleocapsid protein (NP) gene, complete cds 2960 2960 100% 0.0 99%
CY083081.1 Influenza A virus (A/Bogota/WRAIR0440T/2009(H1N1)) nucleocapsid protein (NP) gene, complete cds 2960 2960 100% 0.0 99%
CY083049.1 Influenza A virus (A/Lima/WRAIR0285F/2009(H1N1)) nucleocapsid protein (NP) gene, complete cds 2960 2960 100% 0.0 99%
CY081545.1 Influenza A virus (A/Cambodia/NHRCC00008/2009(H1N1)) nucleocapsid protein (NP) gene, complete cds 2960 2960 100% 0.0 99%
CY081537.1 Influenza A virus (A/Cambodia/NHRCC00007/2009(H1N1)) nucleocapsid protein (NP) gene, complete cds 2960 2960 100% 0.0 99%
CY081529.1 Influenza A virus (A/Cambodia/NHRCC00006/2009(H1N1)) nucleocapsid protein (NP) gene, complete cds 2960 2960 100% 0.0 99%
CY081521.1 Influenza A virus (A/Cambodia/NHRCC00005/2009(H1N1)) nucleocapsid protein (NP) gene, complete cds 2960 2960 100% 0.0 99%
CY081513.1 Influenza A virus (A/Cambodia/NHRCC00004/2009(H1N1)) nucleocapsid protein (NP) gene, complete cds 2960 2960 100% 0.0 99%
CY081505.1 Influenza A virus (A/Cambodia/NHRCC00003/2009(H1N1)) nucleocapsid protein (NP) gene, complete cds 2960 2960 100% 0.0 99%
CY081497.1 Influenza A virus (A/Cambodia/NHRCC00002/2009(H1N1)) nucleocapsid protein (NP) gene, complete cds 2960 2960 100% 0.0 99%
CY081489.1 Influenza A virus (A/Cambodia/NHRCC00001/2009(H1N1)) nucleocapsid protein (NP) gene, complete cds 2960 2960 100% 0.0 99%
CY074079.1 Influenza A virus (A/Argentina/HNRG84/2009(H1N1)) segment 5 sequence 2960 2960 100% 0.0 99%
CY074072.1 Influenza A virus (A/Argentina/HNRG83/2009(H1N1)) segment 5 sequence 2960 2960 100% 0.0 99%
CY074051.1 Influenza A virus (A/Argentina/HNRG5/2009(H1N1)) segment 5 sequence 2960 2960 100% 0.0 99%
CY074043.1 Influenza A virus (A/Argentina/HNRG45/2009(H1N1)) segment 5 sequence 2960 2960 100% 0.0 99%
CY074033.1 Influenza A virus (A/Argentina/HNRG36/2009(H1N1)) segment 5 sequence 2960 2960 100% 0.0 99%
CY074023.1 Influenza A virus (A/Argentina/HNRG32/2009(H1N1)) segment 5 sequence 2960 2960 100% 0.0 99%
CY074013.1 Influenza A virus (A/Argentina/HNRG21/2009(H1N1)) segment 5 sequence 2960 2960 100% 0.0 99%
CY074003.1 Influenza A virus (A/Argentina/HNRG14/2009(H1N1)) segment 5 sequence 2960 2960 100% 0.0 99%
CY073996.1 Influenza A virus (A/Argentina/HNRG107/2009(H1N1)) segment 5 sequence 2960 2960 100% 0.0 99%
CY073982.1 Influenza A virus (A/Argentina/HNRG105/2009(H1N1)) segment 5 sequence 2960 2960 100% 0.0 99%
CY073975.1 Influenza A virus (A/Argentina/HNRG104/2009(H1N1)) segment 5 sequence 2960 2960 100% 0.0 99%
HM598305.1 Influenza A virus (A/Hamburg/NY1580/2009(H1N1)) segment 5 nucleocapsid protein (NP) gene, complete cds 2960 2960 100% 0.0 99%
CY075655.1 Influenza A virus (A/Boston/617/2009(H1N1)) segment 5, complete sequence 2960 2960 100% 0.0 99%
CY075639.1 Influenza A virus (A/Boston/703/2009(H1N1)) segment 5, complete sequence 2960 2960 100% 0.0 99%
CY075615.1 Influenza A virus (A/Boston/682/2009(H1N1)) segment 5, complete sequence 2960 2960 100% 0.0 99%
CY075559.1 Influenza A virus (A/Boston/653/2009(H1N1)) segment 5, complete sequence 2960 2960 100% 0.0 99%
CY075551.1 Influenza A virus (A/Boston/648/2009(H1N1)) segment 5, complete sequence 2960 2960 100% 0.0 99%
CY075543.1 Influenza A virus (A/Boston/634/2009(H1N1)) segment 5, complete sequence 2960 2960 100% 0.0 99%
CY075382.1 Influenza A virus (A/Chile/3586/2009(H1N1)) segment 5, complete sequence 2960 2960 100% 0.0 99%
CY075358.1 Influenza A virus (A/Chile/3375/2009(H1N1)) segment 5, complete sequence 2960 2960 100% 0.0 99%
CY075350.1 Influenza A virus (A/Chile/3369/2009(H1N1)) segment 5, complete sequence 2960 2960 100% 0.0 99%
CY075302.1 Influenza A virus (A/Chile/3220/2009(H1N1)) segment 5, complete sequence 2960 2960 100% 0.0 99%
CY074991.1 Influenza A virus (A/Thailand/CU-H567/2009(H1N1)) segment 5 sequence 2960 2960 100% 0.0 99%
CY074975.1 Influenza A virus (A/Thailand/CU-C161/2009(H1N1)) segment 5 sequence 2960 2960 100% 0.0 99%
HQ011419.1 Influenza A virus (A/Guangdong/45/2009(H1N1)) segment 5 nucleocapsid protein (NP) gene, complete cds 2960 2960 100% 0.0 99%
CY069101.1 Influenza A virus (A/Guam/NHRC0027/2009(H1N1)) segment 5, complete sequence 2960 2960 100% 0.0 99%
CY069077.1 Influenza A virus (A/Guam/NHRC0024/2009(H1N1)) segment 5, complete sequence 2960 2960 100% 0.0 99%
CY069053.1 Influenza A virus (A/Guam/NHRC0021/2009(H1N1)) segment 5, complete sequence 2960 2960 100% 0.0 99%
CY069045.1 Influenza A virus (A/Guam/NHRC0020/2009(H1N1)) segment 5, complete sequence 2960 2960 100% 0.0 99%
CY069029.1 Influenza A virus (A/Guam/NHRC0018/2009(H1N1)) segment 5, complete sequence 2960 2960 100% 0.0 99%
CY068981.1 Influenza A virus (A/Guam/NHRC0012/2009(H1N1)) segment 5, complete sequence 2960 2960 100% 0.0 99%
CY068949.1 Influenza A virus (A/Japan/NHRC0004/2009(H1N1)) segment 5, complete sequence 2960 2960 100% 0.0 99%
CY068941.1 Influenza A virus (A/Guam/NHRC0008/2009(H1N1)) segment 5, complete sequence 2960 2960 100% 0.0 99%
CY068933.1 Influenza A virus (A/Guam/NHRC0005/2009(H1N1)) segment 5, complete sequence 2960 2960 100% 0.0 99%
CY068917.1 Influenza A virus (A/Japan/NHRC0003/2009(H1N1)) segment 5, complete sequence 2960 2960 100% 0.0 99%
CY067654.1 Influenza A virus (A/Brussels/INS244/2009(H1N1)) segment 5, complete sequence 2960 2960 100% 0.0 99%
CY066994.1 Influenza A virus (A/Brussels/INS245/2009(H1N1)) segment 5, complete sequence 2960 2960 100% 0.0 99%
CY066938.1 Influenza A virus (A/Aarhus/INS236/2009(H1N1)) segment 5, complete sequence 2960 2960 100% 0.0 99%
CY066898.1 Influenza A virus (A/District of Columbia/INS231/2009(H1N1)) segment 5, complete sequence 2960 2960 100% 0.0 99%
CY066874.1 Influenza A virus (A/District of Columbia/INS228/2009(H1N1)) segment 5, complete sequence 2960 2960 100% 0.0 99%
CY066858.1 Influenza A virus (A/District of Columbia/INS226/2009(H1N1)) segment 5, complete sequence 2960 2960 100% 0.0 99%
CY066842.1 Influenza A virus (A/Madrid/INS223/2009(H1N1)) segment 5, complete sequence 2960 2960 100% 0.0 99%
CY066690.1 Influenza A virus (A/Hvidovre/INS289/2009(H1N1)) segment 5, complete sequence 2960 2960 100% 0.0 99%
CY066642.1 Influenza A virus (A/Bonn/INS278/2009(H1N1)) segment 5, complete sequence 2960 2960 100% 0.0 99%
CY066210.1 Influenza A virus (A/California/VRDL104/2009(H1N1)) segment 5, complete sequence 2960 2960 100% 0.0 99%
CY066186.1 Influenza A virus (A/Boston/144/2009(H1N1)) segment 5, complete sequence 2960 2960 100% 0.0 99%
CY065963.1 Influenza A virus (A/Japan/NHRC0002/2009(H1N1)) segment 5, complete sequence 2960 2960 100% 0.0 99%
CY065955.1 Influenza A virus (A/Japan/NHRC0001/2009(H1N1)) segment 5, complete sequence 2960 2960 100% 0.0 99%
CY065939.1 Influenza A virus (A/Guam/NHRC0002/2009(H1N1)) segment 5, complete sequence 2960 2960 100% 0.0 99%
CY065875.1 Influenza A virus (A/Netherlands/2631b/2009(H1N1)) segment 5, complete sequence 2960 2960 100% 0.0 99%
CY065827.1 Influenza A virus (A/Netherlands/2243/2009(H1N1)) segment 5, complete sequence 2960 2960 100% 0.0 99%
CY065763.1 Influenza A virus (A/British Columbia/GFA0401/2009(H1N1)) segment 5 sequence 2960 2960 100% 0.0 99%
HM569686.1 Influenza A virus (A/Argentina/19618/2009(H1N1)) segment 5 nucleocapsid protein (NP) gene, complete cds 2960 2960 100% 0.0 99%
CY065078.1 Influenza A virus (A/New York/7421/2009(H1N1)) segment 5, complete sequence 2960 2960 100% 0.0 99%
CY065046.1 Influenza A virus (A/New York/4294/2010(H1N1)) segment 5, complete sequence 2960 2960 100% 0.0 99%
CY064898.1 Influenza A virus (A/Boston/136/2009(H1N1)) segment 5, complete sequence 2960 2960 100% 0.0 99%
CY064775.1 Influenza A virus (A/Berlin/INS170/2009(H1N1)) segment 5, complete sequence 2960 2960 100% 0.0 99%
CY064679.1 Influenza A virus (A/Boston/141/2009(H1N1)) segment 5, complete sequence 2960 2960 100% 0.0 99%
CY064639.1 Influenza A virus (A/Boston/134/2009(H1N1)) segment 5, complete sequence 2960 2960 100% 0.0 99%
CY064559.1 Influenza A virus (A/Boston/123/2009(H1N1)) segment 5, complete sequence 2960 2960 100% 0.0 99%
CY064551.1 Influenza A virus (A/Boston/122/2009(H1N1)) segment 5, complete sequence 2960 2960 100% 0.0 99%
CY064463.1 Influenza A virus (A/Boston/96/2009(H1N1)) segment 5, complete sequence 2960 2960 100% 0.0 99%
CY063849.1 Influenza A virus (A/Singapore/KK066/2010(H1N1)) segment 5 sequence 2960 2960 100% 0.0 99%
CY063755.1 Influenza A virus (A/Singapore/GP3084/2009(H1N1)) segment 5 sequence 2960 2960 100% 0.0 99%
HM241704.1 Influenza A virus (A/Jalna/NIV9436/2009(H1N1)) segment 5 nucleocapsid protein (NP) gene, complete cds 2960 2960 100% 0.0 99%
CY063585.1 Influenza A virus (A/Oslo/INS110/2009(H1N1)) segment 5, complete sequence 2960 2960 100% 0.0 99%
CY063561.1 Influenza A virus (A/Boston/152/2009(H1N1)) segment 5, complete sequence 2960 2960 100% 0.0 99%
CY063545.1 Influenza A virus (A/Boston/149/2009(H1N1)) segment 5, complete sequence 2960 2960 100% 0.0 99%

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Wed Mar 09, 2011 9:34 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 27403
Location: Pittsburgh, PA USA
Top 100 MP sequences

CY086923.1 Influenza A virus (A/swine/Minnesota/239105/2009(H3N2)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1957 1957 100% 0.0 100%
CY084463.1 Influenza A virus (A/New York/6537/2009(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1949 1949 100% 0.0 99%
CY083943.1 Influenza A virus (A/San Diego/INS194/2009(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1949 1949 100% 0.0 99%
CY083927.1 Influenza A virus (A/Warsaw/INS148/2009(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1949 1949 100% 0.0 99%
CY083911.1 Influenza A virus (A/Aalborg/INS132/2009(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1949 1949 100% 0.0 99%
CY083887.1 Influenza A virus (A/San Diego/INS72/2009(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1949 1949 100% 0.0 99%
CY083879.1 Influenza A virus (A/San Diego/INS50/2009(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1949 1949 100% 0.0 99%
CY083847.1 Influenza A virus (A/District of Columbia/INS23/2009(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1949 1949 100% 0.0 99%
CY083839.1 Influenza A virus (A/San Diego/INS14/2009(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1949 1949 100% 0.0 99%
CY083831.1 Influenza A virus (A/San Diego/INS07/2009(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1949 1949 100% 0.0 99%
CY083826.1 Influenza A virus (A/Wroclaw/INS435/2009(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1949 1949 100% 0.0 99%
CY083795.1 Influenza A virus (A/Athens/INS328/2009) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1949 1949 100% 0.0 99%
CY083769.1 Influenza A virus (A/Athens/INS256/2009(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1949 1949 100% 0.0 99%
CY083714.1 Influenza A virus (A/Madrid/INS112/2009(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1949 1949 100% 0.0 99%
CY083678.1 Influenza A virus (A/Madrid/INS77/2009(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1949 1949 100% 0.0 99%
CY083656.1 Influenza A virus (A/San Diego/INS36/2009(H1N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1949 1949 100% 0.0 99%
HQ728113.1 Influenza A virus (A/swine/Taiwan/CH-1204/2009(H1N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1949 1949 100% 0.0 99%
HQ728105.1 Influenza A virus (A/swine/Taiwan/PT-1204/2009(H1N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1949 1949 100% 0.0 99%
HQ661365.1 Influenza A virus (A/Russia/01-MA/2009(H1N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1949 1949 100% 0.0 99%
CY076719.1 Influenza A virus (A/ferret/Washington/WADDL13230/2009(H1N1)) segment 7 sequence 1949 1949 100% 0.0 99%
HQ393496.1 Influenza A virus (A/swine/Taiwan/TD-2542/2010(H1N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1949 1949 100% 0.0 99%
CY069644.1 Influenza A virus (A/Singapore/527/2009(H1N1)) segment 7 sequence 1949 1949 100% 0.0 99%
CY069629.1 Influenza A virus (A/Singapore/471/2009(H1N1)) segment 7 sequence 1949 1949 100% 0.0 99%
HQ011421.1 Influenza A virus (A/Guangdong/45/2009(H1N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1949 1949 100% 0.0 99%
CY063851.1 Influenza A virus (A/Singapore/KK066/2010(H1N1)) segment 7 sequence 1949 1949 100% 0.0 99%
CY063791.1 Influenza A virus (A/Singapore/ON1868/2009(H1N1)) segment 7 sequence 1949 1949 100% 0.0 99%
CY063783.1 Influenza A virus (A/Singapore/ON0801/2009(H1N1)) segment 7 sequence 1949 1949 100% 0.0 99%
HM241706.1 Influenza A virus (A/Jalna/NIV9436/2009(H1N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1949 1949 100% 0.0 99%
HM241699.1 Influenza A virus (A/Che/NIV658/2009(H1N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1949 1949 100% 0.0 99%
AB538392.1 Influenza A virus (A/Nagano/RC1/2009(H1N1)) M2, M1 genes for matrix protein 2, matrix protein 1, complete cds, segment: 7 1949 1949 100% 0.0 99%
CY060721.1 Influenza A virus (A/Ontario/320266/2009(H1N1)) segment 7 sequence 1949 1949 100% 0.0 99%
CY060713.1 Influenza A virus (A/Ontario/315637/2009(H1N1)) segment 7 sequence 1949 1949 100% 0.0 99%
CY060705.1 Influenza A virus (A/Ontario/315613/2009(H1N1)) segment 7 sequence 1949 1949 100% 0.0 99%
CY060697.1 Influenza A virus (A/Ontario/315187/2009(H1N1)) segment 7 sequence 1949 1949 100% 0.0 99%
CY060689.1 Influenza A virus (A/Ontario/315181/2009(H1N1)) segment 7 sequence 1949 1949 100% 0.0 99%
CY060673.1 Influenza A virus (A/Ontario/315047/2009(H1N1)) segment 7 sequence 1949 1949 100% 0.0 99%
CY060665.1 Influenza A virus (A/Ontario/315015/2009(H1N1)) segment 7 sequence 1949 1949 100% 0.0 99%
CY060649.1 Influenza A virus (A/Ontario/314603/2009(H1N1)) segment 7 sequence 1949 1949 100% 0.0 99%
CY060641.1 Influenza A virus (A/Ontario/314137/2009(H1N1)) segment 7 sequence 1949 1949 100% 0.0 99%
CY060633.1 Influenza A virus (A/Ontario/314095/2009(H1N1)) segment 7 sequence 1949 1949 100% 0.0 99%
CY060625.1 Influenza A virus (A/Ontario/313762/2009(H1N1)) segment 7 sequence 1949 1949 100% 0.0 99%
CY060601.1 Influenza A virus (A/Ontario/305598/2009(H1N1)) segment 7 sequence 1949 1949 100% 0.0 99%
CY060593.1 Influenza A virus (A/Ontario/305139/2009(H1N1)) segment 7 sequence 1949 1949 100% 0.0 99%
CY060585.1 Influenza A virus (A/Ontario/304434/2009(H1N1)) segment 7 sequence 1949 1949 100% 0.0 99%
CY060577.1 Influenza A virus (A/Ontario/29801/2009(H1N1)) segment 7 sequence 1949 1949 100% 0.0 99%
CY060569.1 Influenza A virus (A/Ontario/296008/2009(H1N1)) segment 7 sequence 1949 1949 100% 0.0 99%
CY060529.1 Influenza A virus (A/Ontario/235657/2009(H1N1)) segment 7 sequence 1949 1949 100% 0.0 99%
GU592890.1 Influenza A virus (A/Barnaul/04/2009(H1N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1949 1949 100% 0.0 99%
GU562459.1 Influenza A virus (A/Karasuk/01/2010(H1N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1949 1949 100% 0.0 99%
GU560017.1 Influenza A virus (A/Tomsk/06/2009(H1N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1949 1949 100% 0.0 99%
GU560009.1 Influenza A virus (A/Tomsk/05/2009(H1N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1949 1949 100% 0.0 99%
CY054665.1 Influenza A virus (A/Russia/100/2009(H1N1)) segment 7 sequence 1949 1949 100% 0.0 99%
CY054657.1 Influenza A virus (A/Russia/61/2009(H1N1)) segment 7 sequence 1949 1949 100% 0.0 99%
GU433034.1 Influenza A virus (A/Novosibirsk/02/2009(H1N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1949 1949 100% 0.0 99%
GU433026.1 Influenza A virus (A/Tomsk/03/2009(H1N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1949 1949 100% 0.0 99%
GU367318.1 Influenza A virus (A/Tomsk/07/2009(H1N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1949 1949 100% 0.0 99%
CY053509.1 Influenza A virus (A/Taiwan/206/2009(H1N1)) segment 7 sequence 1949 1949 100% 0.0 99%
CY053501.1 Influenza A virus (A/Taiwan/177/2009(H1N1)) segment 7 sequence 1949 1949 100% 0.0 99%
CY053493.1 Influenza A virus (A/Taiwan/167/2009(H1N1)) segment 7 sequence 1949 1949 100% 0.0 99%
CY053477.1 Influenza A virus (A/Taiwan/143/2009(H1N1)) segment 7 sequence 1949 1949 100% 0.0 99%
GU211228.1 Influenza A virus (A/Russia/01/2009(H1N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1949 1949 100% 0.0 99%
CY049063.1 Influenza A virus (A/Singapore/ON305/2009(H1N1)) segment 7 sequence 1949 1949 100% 0.0 99%
GU108489.1 Influenza A virus (A/Zhejiang-Yiwu/11/2009(H1N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1949 1949 100% 0.0 99%
CY047747.1 Influenza A virus (A/Taiwan/526/2009(H1N1)) segment 7 sequence 1949 1949 100% 0.0 99%
CY045245.1 Influenza A virus (A/Taiwan/137/2009(H1N1)) segment 7 sequence 1949 1949 100% 0.0 99%
CY045237.1 Influenza A virus (A/Taiwan/126/2009(H1N1)) segment 7 sequence 1949 1949 100% 0.0 99%
CY045229.1 Influenza A virus (A/Taiwan/115/2009(H1N1)) segment 7 sequence 1949 1949 100% 0.0 99%
CY045957.1 Influenza A virus (A/Toronto/T0106/2009(H1N1)) segment 7 sequence 1949 1949 100% 0.0 99%
CY045498.1 Influenza A virus (A/Baden-Wurttemberg/448/2009(H1N1)) segment 7 sequence 1949 1949 100% 0.0 99%
GQ494352.1 Influenza A virus (A/Moscow/IIV05/2009(H1N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1949 1949 100% 0.0 99%
GQ485662.1 Influenza A virus (A/Almati/01/2009(H1N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1949 1949 100% 0.0 99%
CY043337.1 Influenza A virus (A/Denmark/523/2009(H1N1)) segment 7 sequence 1949 1949 100% 0.0 99%
GQ392024.1 Influenza A virus (A/Moscow/IIV04/2009(H1N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1949 1949 100% 0.0 99%
GQ360066.1 Influenza A virus (A/Stockholm/32/2009(H1N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1949 1949 100% 0.0 99%
FN423715.1 Influenza A virus (A/Luxembourg/43/2009(H1N1)) partial matrix protein 1 (M gene), segment 7, viral cRNA 1949 1949 100% 0.0 99%
GQ330648.1 Influenza A virus (A/Moscow/IIV03/2009(H1N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1949 1949 100% 0.0 99%
GQ247728.1 Influenza A virus (A/Moscow/IIV02/2009(H1N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1949 1949 100% 0.0 99%
GQ219584.1 Influenza A virus (A/Moscow/IIV01/2009(H1N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1949 1949 100% 0.0 99%
HM189450.1 Influenza A virus (A/Korea/CJ04/2009(H1N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1947 1947 99% 0.0 99%
CY047351.1 Influenza A virus (A/New York/3365/2009(H1N1)) segment 7, complete sequence 1947 1947 99% 0.0 99%
CY043353.1 Influenza A virus (A/Denmark/528/2009(H1N1)) segment 7 sequence 1947 1947 99% 0.0 99%
CY087001.1 Influenza A virus (A/New York/3256/2009(N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1945 1945 99% 0.0 99%
CY080427.1 Influenza A virus (A/swine/VIC/09-02767-01/2009(H1N1)) segment 7 sequence 1945 1945 99% 0.0 99%
CY067917.1 Influenza A virus (A/Lisboa/88/2009(H1N1)) segment 7 sequence 1945 1945 99% 0.0 99%
CY067911.1 Influenza A virus (A/Lisboa/86/2009(H1N1)) segment 7 sequence 1945 1945 99% 0.0 99%
CY067908.1 Influenza A virus (A/Lisboa/85/2009(H1N1)) segment 7 sequence 1945 1945 99% 0.0 99%
CY067905.1 Influenza A virus (A/Lisboa/84/2009(H1N1)) segment 7 sequence 1945 1945 99% 0.0 99%
CY067896.1 Influenza A virus (A/Lisboa/81/2009(H1N1)) segment 7 sequence 1945 1945 99% 0.0 99%
CY067893.1 Influenza A virus (A/Lisboa/80/2009(H1N1)) segment 7 sequence 1945 1945 99% 0.0 99%
CY067890.1 Influenza A virus (A/Lisboa/79/2009(H1N1)) segment 7 sequence 1945 1945 99% 0.0 99%
CY067884.1 Influenza A virus (A/Lisboa/77/2009(H1N1)) segment 7 sequence 1945 1945 99% 0.0 99%
CY067881.1 Influenza A virus (A/Lisboa/76/2009(H1N1)) segment 7 sequence 1945 1945 99% 0.0 99%
CY067878.1 Influenza A virus (A/Lisboa/75/2009(H1N1)) segment 7 sequence 1945 1945 99% 0.0 99%
CY067869.1 Influenza A virus (A/Lisboa/72/2009(H1N1)) segment 7 sequence 1945 1945 99% 0.0 99%
CY067863.1 Influenza A virus (A/Lisboa/70/2009(H1N1)) segment 7 sequence 1945 1945 99% 0.0 99%
CY067860.1 Influenza A virus (A/Lisboa/69/2009(H1N1)) segment 7 sequence 1945 1945 99% 0.0 99%
CY067857.1 Influenza A virus (A/Lisboa/68/2009(H1N1)) segment 7 sequence 1945 1945 99% 0.0 99%
CY067854.1 Influenza A virus (A/Lisboa/67/2009(H1N1)) segment 7 sequence 1945 1945 99% 0.0 99%
CY067851.1 Influenza A virus (A/Lisboa/66/2009(H1N1)) segment 7 sequence 1945 1945 99% 0.0 99%
CY067839.1 Influenza A virus (A/Lisboa/62/2009(H1N1)) segment 7 sequence 1945 1945 99% 0.0 99%

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Wed Mar 09, 2011 9:35 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 27403
Location: Pittsburgh, PA USA
Top 100 NS matches

CY086924.1 Influenza A virus (A/swine/Minnesota/239105/2009(H3N2)) nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1663 1663 100% 0.0 100%
DQ469998.1 Influenza A virus (A/turkey/Ontario/31232/2005(H3N2)) nonstructural protein 2 (NS2) and nonstructural protein 1 (NS1) genes, complete cds 1566 1566 99% 0.0 98%
DQ469966.1 Influenza A virus (A/swine/Alberta/14722/2005(H3N2)) nonstructural protein 2 (NS2) and nonstructural protein 1 (NS1) genes, complete cds 1566 1566 99% 0.0 98%
EU826547.2 Influenza A virus (A/swine/Quebec/4001/2005(H3N2)) segment 8 nonstructural protein 2 (NS2) and nonstructural protein 1 (NS1) genes, complete cds 1558 1558 99% 0.0 98%
DQ469990.1 Influenza A virus (A/swine/Ontario/33853/2005(H3N2)) nonstructural protein 2 (NS2) and nonstructural protein 1 (NS1) genes, complete cds 1558 1558 99% 0.0 98%
DQ469982.1 Influenza A virus (A/swine/Manitoba/12707/2005(H3N2)) nonstructural protein 2 (NS2) and nonstructural protein 1 (NS1) genes, complete cds 1558 1558 99% 0.0 98%
DQ469958.1 Influenza A virus (A/Ontario/RV1273/2005(H3N2)) nonstructural protein 2 (NS2) and nonstructural protein 1 (NS1) genes, complete cds 1558 1558 99% 0.0 98%
GQ910962.1 Influenza A virus (A/swine/Oklahoma/00813/2005(H1N2)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1552 1552 100% 0.0 98%
GQ910924.1 Influenza A virus (A/swine/Minnesota/SG242/2006(H3N2)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1552 1552 100% 0.0 98%
HM461798.1 Influenza A virus (A/swine/Minnesota/02093/2008(H1N1)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1550 1550 99% 0.0 98%
DQ469974.1 Influenza A virus (A/swine/British Columbia/28103/2005(H3N2)) nonstructural protein 2 (NS2) and nonstructural protein 1 (NS1) genes, complete cds 1550 1550 99% 0.0 98%
EU735822.1 Influenza A virus (A/turkey/OH/313053/2004(H3N2)) nonstructural protein 2 (NS2) and nonstructural protein 1 (NS1) genes, complete cds 1544 1544 100% 0.0 98%
FJ410144.1 Influenza A virus (A/swine/Minnesota/1145/2007(H3N2)) segment 8, complete sequence 1536 1536 100% 0.0 98%
CY045571.1 Influenza A virus (A/swine/Oklahoma/008722/2007(H3N2)) segment 8 sequence 1536 1536 100% 0.0 98%
EU697208.1 Influenza A virus (A/turkey/Minnesota/366767/2005(H3N2)) nonstructural protein 2 (NS2) and nonstructural protein 1 (NS1) genes, complete cds 1536 1536 100% 0.0 98%
EU743214.1 Influenza A virus (A/turkey/MN/366767/2005(H3N2)) segment 8 nonstructural protein 2 (NS2) and nonstructural protein 1 (NS1) genes, complete cds 1536 1536 100% 0.0 98%
GQ910971.1 Influenza A virus (A/swine/Minnesota/28374.35/2006(H1N1)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1528 1528 100% 0.0 97%
DQ335775.1 Influenza A virus (A/turkey/Ohio/313053/04(H3N2)) nonstructural protein (NS) gene, complete cds 1528 1528 100% 0.0 97%
HM461766.1 Influenza A virus (A/swine/Minnesota/02053/2008(H1N1)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1526 1526 99% 0.0 97%
AY060136.1 Influenza A virus (A/SW/IN/14810-S/01(H1N2)) nonstructural protein (NS) gene, complete cds 1526 1526 99% 0.0 97%
AY060135.1 Influenza A virus (A/SW/IN/14810-T/01(H1N2)) nonstructural protein (NS) gene, complete cds 1526 1526 99% 0.0 97%
GU135977.1 Influenza A virus (A/swine/Iowa/H03UWF2/2003(H1N1)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1520 1520 100% 0.0 97%
EU735830.1 Influenza A virus (A/turkey/NC/353568/2005(H3N2)) nonstructural protein 2 (NS2) and nonstructural protein 1 (NS1) genes, complete cds 1520 1520 100% 0.0 97%
DQ150429.1 Influenza A virus (A/swine/MI/PU243/04 (H3N1)) nonstructural protein (NS1) gene, complete cds 1520 1520 100% 0.0 97%
GU135895.1 Influenza A virus (A/swine/Iowa/H03BF5/2003(H3N2)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1518 1518 99% 0.0 97%
HM461806.1 Influenza A virus (A/swine/Minnesota/02011/2008(H1N2)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1518 1518 99% 0.0 97%
FJ611902.1 Influenza A virus (A/swine/Minnesota/07002083/2007(H1N1)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1513 1513 100% 0.0 97%
GQ910956.1 Influenza A virus (A/swine/Minnesota/01279/2006(H3N2)) segment 8 nuclear export protein (NEP) gene, partial cds; and nonstructural protein 1 (NS1) gene, complete cds 1513 1513 97% 0.0 98%
EU697213.1 Influenza A virus (A/turkey/North Carolina/353568/2005(H3N2)) nonstructural protein 2 (NS2) and nonstructural protein 1 (NS1) genes, complete cds 1513 1513 100% 0.0 97%
GU135961.1 Influenza A virus (A/swine/Iowa/H03LS4/2003(H1N1)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1511 1511 99% 0.0 97%
HM461838.1 Influenza A virus (A/swine/Nebraska/02013/2008(H1N1)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1511 1511 99% 0.0 97%
EU798872.1 Influenza A virus (A/swine/Korea/CAS09/2006(H3N2)) segment 8 nonstructural protein 2 (NS2) and nonstructural protein 1 (NS1) genes, complete cds 1511 1511 99% 0.0 97%
GU135902.1 Influenza A virus (A/swine/Iowa/H02AS8/2002(H3N2)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1505 1505 100% 0.0 97%
GU135914.1 Influenza A virus (A/swine/Iowa/H03G1/2003(H1N1)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1505 1505 100% 0.0 97%
GQ910946.1 Influenza A virus (A/swine/Minnesota/058068/2006(H1N1)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1505 1505 100% 0.0 97%
CY041851.1 Influenza A virus (A/swine/North Carolina/R08-001877-D08-013371/2008 (H3N2)) segment 8 sequence 1505 1505 100% 0.0 97%
EF551057.1 Influenza A virus (A/swine/North Carolina/2003(H3N2)) nonstructural protein 2 (NS2) and nonstructural protein 1 (NS1) genes, complete cds 1505 1505 100% 0.0 97%
EF551049.1 Influenza A virus (A/turkey/Illinois/2004(H3N2)) nonstructural protein 2 (NS2) and nonstructural protein 1 (NS1) genes, complete cds 1505 1505 100% 0.0 97%
AY779259.1 Influenza A virus (A/turkey/North Carolina/12344/03(H3N2)) nonstructural protein 2 and nonstructural protein 1 (NS) gene, complete cds 1505 1505 100% 0.0 97%
GU135871.1 Influenza A virus (A/swine/Iowa/H02NJ56371/2002(H1N1)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1503 1503 99% 0.0 97%
GQ910965.1 Influenza A virus (A/swine/NorthCarolina/25464/2005(H3N2)) segment 8 nuclear export protein (NEP) gene, partial cds; and nonstructural protein 1 (NS1) gene, complete cds 1503 1503 97% 0.0 98%
GQ910949.1 Influenza A virus (A/swine/Minnesota/00709/2005(H3N2)) segment 8 nuclear export protein (NEP) gene, partial cds; and nonstructural protein 1 (NS1) gene, complete cds 1503 1503 97% 0.0 98%
EU826555.2 Influenza A virus (A/mink/Nova Scotia/1055488/2007(H3N2)) segment 8 nonstructural protein 2 (NS2) and nonstructural protein 1 (NS1) genes, complete cds 1503 1503 99% 0.0 97%
EU798871.1 Influenza A virus (A/swine/Korea/CAS07/2005(H3N2)) segment 8 nonstructural protein 2 (NS2) and nonstructural protein 1 (NS1) genes, complete cds 1503 1503 99% 0.0 97%
EU798870.1 Influenza A virus (A/swine/Korea/CAN04/2005(H3N2)) segment 8 nonstructural protein 2 (NS2) and nonstructural protein 1 (NS1) genes, complete cds 1503 1503 99% 0.0 97%
EU798859.1 Influenza A virus (A/swine/Korea/CAS08/2005(H1N1)) segment 8 nonstructural protein 2 (NS2) and nonstructural protein 1 (NS1) genes, complete cds 1503 1503 99% 0.0 97%
EU399755.1 Influenza A virus (A/Ontario/1252/2007(H3N2)) nonstructural protein 2 (NS2) and nonstructural protein 1 (NS1) genes, complete cds 1503 1503 99% 0.0 97%
AF455707.1 Influenza A virus (A/Swine/Ohio/891/01(H1N2)) nonstructural protein 1 and nonstructural protein 2 genes, complete cds 1503 1503 99% 0.0 97%
GQ910969.1 Influenza A virus (A/swine/Minnesota/00965/2006(H1N1)) segment 8 nuclear export protein (NEP) gene, partial cds; and nonstructural protein 1 (NS1) gene, complete cds 1497 1497 97% 0.0 98%
GQ910951.1 Influenza A virus (A/swine/Minnesota/01645/2007(H3N2)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1497 1497 100% 0.0 97%
GQ910954.1 Influenza A virus (A/swine/Minnesota/01581/2007(H1N1)) segment 8 nuclear export protein (NEP) gene, partial cds; and nonstructural protein 1 (NS1) gene, complete cds 1495 1495 97% 0.0 98%
GQ910952.1 Influenza A virus (A/swine/Minnesota/01444/2007(H3N2)) segment 8 nuclear export protein (NEP) gene, partial cds; and nonstructural protein 1 (NS1) gene, complete cds 1495 1495 97% 0.0 98%
GQ910919.1 Influenza A virus (A/swine/Minnesota/SG237/2007(H3N2)) segment 8 nuclear export protein (NEP) gene, partial cds; and nonstructural protein 1 (NS1) gene, complete cds 1495 1495 97% 0.0 98%
EU798858.1 Influenza A virus (A/swine/Korea/CAN01/2004(H1N1)) segment 8 nonstructural protein 2 (NS2) and nonstructural protein 1 (NS1) genes, complete cds 1495 1495 99% 0.0 97%
AY129160.1 Influenza A virus (A/Swine/Korea/CY02/02(H1N2)) nonstructural protein (NS) mRNA, complete cds 1495 1495 99% 0.0 97%
HM125978.1 Influenza A virus (A/swine/MN/48683/2002(H1N1)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1493 1493 99% 0.0 97%
GU135887.1 Influenza A virus (A/swine/Iowa/H02PW7/2002(H1N1)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1489 1489 100% 0.0 97%
GU135969.1 Influenza A virus (A/swine/Iowa/H03US3/2003(H1N1)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1489 1489 100% 0.0 97%
CY045579.1 Influenza A virus (A/swine/Oklahoma/011506/2007(H3N2)) segment 8 sequence 1489 1489 100% 0.0 97%
CY041883.1 Influenza A virus (A/mallard/South Dakota/Sg-00128/2007(H3N2)) segment 8 sequence 1489 1489 100% 0.0 97%
CY041875.1 Influenza A virus (A/mallard/South Dakota/Sg-00127/2007(H3N2)) segment 8 sequence 1489 1489 100% 0.0 97%
CY041859.1 Influenza A virus (A/mallard/South Dakota/Sg-00125/2007(H3N2)) segment 8 sequence 1489 1489 100% 0.0 97%
AY779260.1 Influenza A virus (A/turkey/Minnesota/764-2/03(H3N2)) nonstructural protein 2 and nonstructural protein 1 (NS) gene, complete cds 1489 1489 100% 0.0 97%
AF153262.1 Influenza A virus (A/Swine/Minnesota/9088-2/98 (H3N2)) segment 8 NS1 and NS2 genes, complete cds 1489 1489 100% 0.0 97%
AF153261.1 Influenza A virus (A/Swine/Texas/4199-2/98 (H3N2)) segment 8 NS1 and NS2 genes, complete cds 1489 1489 100% 0.0 97%
CY086940.1 Influenza A virus (A/swine/North Carolina/239108/2010(H1N2)) nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1487 1487 99% 0.0 97%
GU135879.1 Influenza A virus (A/swine/Iowa/H02NJ56391/2002(H1N1)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1487 1487 99% 0.0 97%
GU135929.1 Influenza A virus (A/swine/Iowa/H03HO7/2003(H3N2)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1487 1487 99% 0.0 97%
AF455713.1 Influenza A virus (A/Swine/Illinois/100085A/01 (H1N2)) nonstructural protein 1 and nonstructural protein 2 genes, complete cds 1487 1487 99% 0.0 97%
GQ457561.1 Influenza A virus (A/Saskatchewan/5351/2009(H1N1)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1481 1481 100% 0.0 97%
GQ457560.1 Influenza A virus (A/Saskatchewan/5350/2009(H1N1)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1481 1481 100% 0.0 97%
GQ910920.1 Influenza A virus (A/swine/Minnesota/SG238/2006(H1N1)) segment 8 nuclear export protein (NEP) gene, partial cds; and nonstructural protein 1 (NS1) gene, complete cds 1481 1481 97% 0.0 97%
CY041867.1 Influenza A virus (A/northern pintail/South Dakota/Sg-00126/2007(H3N2)) segment 8 sequence 1481 1481 100% 0.0 97%
DQ150437.1 Influenza A virus (A/swine/IN/PU542/04 (H3N1)) nonstructural protein (NS1) gene, complete cds 1481 1481 100% 0.0 97%
AF153263.1 Influenza A virus (A/Swine/Iowa/8548-1/98) segment 8 NS1 and NS2 genes, complete cds 1481 1481 100% 0.0 97%
HM461814.1 Influenza A virus (A/swine/Missouri/02060/2008(H1N1)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1479 1479 99% 0.0 97%
GQ910972.1 Influenza A virus (A/swine/Minnesota/01153/2006(H3N2)) segment 8 nuclear export protein (NEP) gene, partial cds; and nonstructural protein 1 (NS1) gene, complete cds 1479 1479 97% 0.0 97%
GQ910959.1 Influenza A virus (A/swine/North Carolina/01487/2007(H3N2)) segment 8 nuclear export protein (NEP) gene, partial cds; and nonstructural protein 1 (NS1) gene, complete cds 1479 1479 97% 0.0 97%
GQ910953.1 Influenza A virus (A/swine/Minnesota/01200/2006(H1N1)) segment 8 nuclear export protein (NEP) gene, partial cds; and nonstructural protein 1 (NS1) gene, complete cds 1479 1479 97% 0.0 97%
GQ910928.1 Influenza A virus (A/swine/North Carolina/SG251/2005(H3N2)) segment 8 nuclear export protein (NEP) gene, partial cds; and nonstructural protein 1 (NS1) gene, complete cds 1479 1479 97% 0.0 97%
GQ910925.1 Influenza A virus (A/swine/Minnesota/SG243/2006(H3N2)) segment 8 nuclear export protein (NEP) gene, partial cds; and nonstructural protein 1 (NS1) gene, complete cds 1479 1479 97% 0.0 97%
AF455714.1 Influenza A virus (A/Swine/Illinois/100084/01 (H1N2)) nonstructural protein 1 and nonstructural protein 2 genes, complete cds 1479 1479 99% 0.0 97%
FJ638318.1 Influenza A virus (A/swine/IL/07003243/2007(H1N2)) segment 8 nuclear export protein (NEP) gene, partial cds; and nonstructural protein 1 (NS1) gene, complete cds 1475 1475 97% 0.0 97%
GU135953.1 Influenza A virus (A/swine/Iowa/H03LJ10/2003(H1N1)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1473 1473 100% 0.0 97%
HM461774.1 Influenza A virus (A/swine/Iowa/02039/2008(H1N2)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1473 1473 100% 0.0 97%
HM461822.1 Influenza A virus (A/swine/North Carolina/02023/2008(H1N1)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1473 1473 100% 0.0 97%
GQ457559.1 Influenza A virus (A/Saskatchewan/5131/2009(H1N1)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1473 1473 100% 0.0 97%
CY045691.1 Influenza A virus (A/swine/Oklahoma/020734-3/2008(H1N2)) segment 8 sequence 1473 1473 100% 0.0 97%
CY045675.1 Influenza A virus (A/swine/Oklahoma/016179-9/2008(H1N2)) segment 8 sequence 1473 1473 100% 0.0 97%
CY045659.1 Influenza A virus (A/swine/Oklahoma/011521-4/2008(H1N2)) segment 8 sequence 1473 1473 100% 0.0 97%
CY045651.1 Influenza A virus (A/swine/Oklahoma/011521-5/2008(H1N2)) segment 8 sequence 1473 1473 100% 0.0 97%
CY045643.1 Influenza A virus (A/swine/Oklahoma/011289-8/2008(H1N2)) segment 8 sequence 1473 1473 100% 0.0 97%
CY045635.1 Influenza A virus (A/swine/Oklahoma/011289-10/2008(H1N2)) segment 8 sequence 1473 1473 100% 0.0 97%
CY045627.1 Influenza A virus (A/swine/Oklahoma/011289-9/2008(H1N2)) segment 8 sequence 1473 1473 100% 0.0 97%
CY045619.1 Influenza A virus (A/swine/Oklahoma/010710-8/2008(H1N2)) segment 8 sequence 1473 1473 100% 0.0 97%
CY045595.1 Influenza A virus (A/swine/Oklahoma/010226-16/2008(H1N2)) segment 8 sequence 1473 1473 100% 0.0 97%
CY045555.1 Influenza A virus (A/swine/Oklahoma/001142/2009(H3N2)) segment 8 sequence 1473 1473 100% 0.0 97%
CY045539.1 Influenza A virus (A/swine/Texas/050625/2008(H1N2)) segment 8 sequence 1473 1473 100% 0.0 97%
CY045531.1 Influenza A virus (A/swine/Texas/050593/2008(H1N2)) segment 8 sequence 1473 1473 100% 0.0 97%
CY045523.1 Influenza A virus (A/swine/Oklahoma/032726/2008(H1N2)) segment 8 sequence 1473 1473 100% 0.0 97%

_________________
www.twitter.com/hniman


Top
 Profile  
 
Display posts from previous:  Sort by  
Post new topic Reply to topic  [ 11 posts ]  Go to page 1, 2  Next

All times are UTC - 5 hours [ DST ]


Who is online

Users browsing this forum: gsgs, LucustaEl and 38 guests


You cannot post new topics in this forum
You cannot reply to topics in this forum
You cannot edit your posts in this forum
You cannot delete your posts in this forum
You cannot post attachments in this forum

Search for:
Jump to:  
Powered by phpBB® Forum Software © phpBB Group