Rhiza Labs FluTracker Forum

The place to discuss the flu

Support This Site

 

Old Comment Archive

It is currently Thu Sep 02, 2010 10:33 am

All times are UTC - 5 hours [ DST ]




Post new topic Reply to topic  [ 27 posts ]  Go to page 1, 2, 3  Next
Author Message
 Post subject: Re: Rapid H1N1 Evolution in Beijing
PostPosted: Mon Dec 14, 2009 11:58 pm 
Online

Joined: Wed Aug 19, 2009 10:42 am
Posts: 6528
Location: Pittsburgh, PA USA
NP from Iowa swine

gb|CY053354.1| Influenza A virus (A/Beijing/721/2009(H1N1)) s... 40.1 0.049
gb|CY053349.1| Influenza A virus (A/Beijing/720/2009(H1N1)) s... 40.1 0.049
gb|CY053343.1| Influenza A virus (A/Beijing/719/2009(H1N1)) s... 40.1 0.049
gb|CY053339.1| Influenza A virus (A/Beijing/718/2009(H1N1)) s... 40.1 0.049
gb|CY053333.1| Influenza A virus (A/Beijing/717/2009(H1N1)) s... 40.1 0.049
gb|CY022072.1| Influenza A virus (A/swine/Iowa/1/1976(H1N1)) ... 40.1 0.049

_________________
www.twitter.com/hniman


Top
 Profile  
 
 Post subject: Re: Rapid H1N1 Evolution in Beijing
PostPosted: Tue Dec 15, 2009 12:59 am 
Online

Joined: Wed Aug 19, 2009 10:42 am
Posts: 6528
Location: Pittsburgh, PA USA
LOCUS CY053338 1724 bp cRNA linear VRL 14-DEC-2009
DEFINITION Influenza A virus (A/Beijing/718/2009(H1N1)) segment 4 sequence.
ACCESSION CY053338
VERSION CY053338.1 GI:280967902
DBLINK Project:37813
KEYWORDS .
SOURCE Influenza A virus (A/Beijing/718/2009(H1N1))
ORGANISM Influenza A virus (A/Beijing/718/2009(H1N1))
Viruses; ssRNA negative-strand viruses; Orthomyxoviridae;
Influenzavirus A.
REFERENCE 1 (bases 1 to 1724)
AUTHORS Liu,W., Wei,M., Zhang,L., Tang,F., Xu,L., Yang,J., Yang,H. and
Cao,W.
TITLE Sequences from an outbreak of pandemic influenza in Beijing, China
JOURNAL Unpublished
REFERENCE 2 (bases 1 to 1724)
AUTHORS Liu,W., Wei,M., Zhang,L., Tang,F., Xu,L., Yang,J., Yang,H. and
Cao,W.
TITLE Direct Submission
JOURNAL Submitted (14-DEC-2009) Beijing Institute of Microbiology and
Epidemiology, 20#, Dongdajie street, Fengtai District, Beijing,
China
FEATURES Location/Qualifiers
source 1..1724
/organism="Influenza A virus (A/Beijing/718/2009(H1N1))"
/mol_type="viral cRNA"
/strain="A/Beijing/718/2009(H1N1)"
/serotype="H1N1"
/isolation_source="nasal swab"
/host="human"
/db_xref="taxon:699001"
/segment="4"
/country="China: Beijing"
/collection_date="Nov-2009"
gene 15..1715
/gene="HA"
CDS 15..1715
/gene="HA"
/function="receptor binding and fusion protein"
/codon_start=1
/product="hemagglutinin"
/protein_id="ACZ98546.1"
/db_xref="GI:280967903"
/translation="MKAILVVLLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVT
HSVNLLEDKHNGKLCKLRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETSSS
DNGTCYPGDFIDYEELREQLSSVSSFERFEIFPKTSSWPNHDPNKGVTAACPHAGAKS
FYKNLIWLVKKGNSYPKLSKSYINDKGKEVLVLWGIHHPSTSADQQSLYQNADAYVFV
GTSRYSKKFKPEIAIRPKVRDQEGRMNYYWTLVEPGDKITFEATGNLVVPRYAFAMER
NAGSGIIISDTPVHDCNTTCQTPKGAINTSLPFQNIHPITIGKCPKYVKSTKLRLTTG
LRNVPSIQYRGLFGAITGFIEGGWTGMVDGWYGYHHQNEQGSGYAADLKSTQNAIDEI
TNKVNSVIEKMNTQFTAVGKEFNHLEKRIENLNKKVDDGFLDIWTYNAELLVLLENER
TLDYHDSNVKNLYEKVRSQLKNNAKEIGNGCFEFYHKCDNTCMESVKNGTYDYPKYSE
EAKLNREEIDGVKLESTRIYQILAIYSTVASSLVLVVSLGAISFWMCSNGSLQCRICI"
sig_peptide 15..65
/gene="HA"
mat_peptide 66..1046
/gene="HA"
/product="HA1"
mat_peptide 1047..1712
/gene="HA"
/product="HA2"
ORIGIN
1 caaaagcaac aaaaatgaag gcaatactag tagttctgct atatacattt gcaaccgcaa
61 atgcagacac attatgtata ggttatcatg cgaacaattc aacagacact gtagacacag
121 tactagaaaa gaatgtaaca gtaacacact ctgttaacct tctagaagac aagcataacg
181 ggaaactatg caaactaaga ggggtagccc cattgcattt gggtaaatgt aacattgctg
241 gctggatcct gggaaatcca gagtgtgaat cactctccac agcaagctca tggtcctaca
301 ttgtggaaac atctagttca gacaatggaa cgtgttaccc aggagatttc atcgattatg
361 aggagctaag agagcaattg agctcagtgt catcatttga aaggtttgag atattcccca
421 agacaagttc atggcccaat catgacccga acaaaggtgt aacggcagca tgtcctcatg
481 ctggagcaaa aagcttctac aaaaatttaa tatggctagt taaaaaagga aattcatacc
541 caaagctcag caaatcctac attaatgata aagggaaaga agtcctcgtg ctatggggca
601 ttcaccatcc atctactagt gctgaccaac aaagtctcta tcagaatgca gatgcatatg
661 tttttgtggg gacatcaaga tacagcaaga agttcaagcc ggaaatagca ataagaccca
721 aagtgaggga tcaagaaggg agaatgaact attactggac actagtagag ccgggagaca
781 aaataacatt cgaagcaact ggaaatctag tggtaccgag atatgcattc gcaatggaaa
841 gaaatgctgg atctggtatt atcatttcag atacaccagt ccacgattgc aatacaactt
901 gtcagacacc caagggtgct ataaacacca gcctcccatt tcagaatata catccgatca
961 caattggaaa atgtccaaaa tatgtaaaaa gcacaaaatt gagactgacc acaggattga
1021 ggaatgtacc gtctattcaa tatagaggct tatttggggc catcaccggt ttcattgaag
1081 gggggtggac agggatggta gatggatggt acggttatca ccatcaaaat gagcaggggt
1141 caggatatgc agccgacctg aagagcacac agaatgccat tgacgagatt actaacaaag
1201 taaattctgt tattgaaaag atgaatacac agttcacagc agtaggtaaa gagttcaatc
1261 acctggaaaa aagaatagag aatttaaata aaaaagttga tgatggtttc ctggacattt
1321 ggacttacaa tgccgaactg ttggttctat tggaaaatga aagaactttg gactaccacg
1381 attcaaatgt gaagaactta tatgaaaagg taagaagcca gttaaaaaac aatgccaagg
1441 aaattggaaa cggctgcttt gaattttacc acaaatgcga taacacgtgc atggaaagtg
1501 tcaaaaatgg gacttatgac tacccaaaat actcagagga agcaaaatta aacagagaag
1561 aaatagatgg ggtaaaactg gaatcaacaa ggatttacca gattttggcg atctattcaa
1621 ctgtcgccag ttcattggta ctggtagtct ccctgggggc aatcagtttc tggatgtgct
1681 ctaatgggtc tctacagtgt agaatatgta tttaacatta ggat

_________________
www.twitter.com/hniman


Top
 Profile  
 
 Post subject: Re: Rapid H1N1 Evolution in Beijing
PostPosted: Tue Dec 15, 2009 1:19 am 
Online

Joined: Wed Aug 19, 2009 10:42 am
Posts: 6528
Location: Pittsburgh, PA USA
The HA sequence has three changes which flank the cleavage site. The change S-->Y at the penultimate position in HA1 matches WSN/33.

_________________
www.twitter.com/hniman


Top
 Profile  
 
 Post subject: Re: Rapid H1N1 Evolution in Beijing
PostPosted: Tue Dec 15, 2009 2:02 am 
Online

Joined: Wed Aug 19, 2009 10:42 am
Posts: 6528
Location: Pittsburgh, PA USA
HA travel log (only three HA sequences have been released)

gb|CY053353.1| Influenza A virus (A/Beijing/721/2009(H1N1)) s... 34.2 3.0
gb|CY053348.1| Influenza A virus (A/Beijing/720/2009(H1N1)) s... 34.2 3.0
gb|CY053338.1| Influenza A virus (A/Beijing/718/2009(H1N1)) s... 34.2 3.0
gb|GU271944.1| Influenza A virus (A/Chita/01/2009(H1N1)) segm... 34.2 3.0
gb|CY050845.1| Influenza A virus (A/Ulaanbaatar/6266/2009(H1N... 34.2 3.0
gb|CY050844.1| Influenza A virus (A/Ulaanbaatar/5882/2009(H1N... 34.2 3.0
gb|CY051695.1| Influenza A virus (A/New York/4777/2009(H1N1))... 34.2 3.0
gb|GU198201.1| Influenza A virus (A/Nanjing/3/2009(H1N1)) seg... 34.2 3.0
gb|CY047713.1| Influenza A virus (A/Hangzhou/2/2009(H1N1)) se... 34.2 3.0
gb|GU057021.1| Influenza A virus (A/Chengdu/54/2009(H1N1)) se... 34.2 3.0
gb|GU057020.1| Influenza A virus (A/Chengdu/47/2009(H1N1)) se... 34.2 3.0
gb|GU057019.1| Influenza A virus (A/Chengdu/40/2009(H1N1)) se... 34.2 3.0
gb|GU057018.1| Influenza A virus (A/Chengdu/39/2009(H1N1)) se... 34.2 3.0
gb|GU057017.1| Influenza A virus (A/Chengdu/33/2009(H1N1)) se... 34.2 3.0
gb|GU057016.1| Influenza A virus (A/Chengdu/31/2009(H1N1)) se... 34.2 3.0
gb|GU057015.1| Influenza A virus (A/Chengdu/21/2009(H1N1)) se... 34.2 3.0
gb|GU057014.1| Influenza A virus (A/Chengdu/18/2009(H1N1)) se... 34.2 3.0
gb|GU057013.1| Influenza A virus (A/Chengdu/14/2009(H1N1)) se... 34.2 3.0
gb|GU057012.1| Influenza A virus (A/Chengdu/06/2009(H1N1)) se... 34.2 3.0
gb|GU057011.1| Influenza A virus (A/Chengdu/04/2009(H1N1)) se... 34.2 3.0
gb|GU057010.1| Influenza A virus (A/Chengdu/03/2009(H1N1)) se... 34.2 3.0

_________________
www.twitter.com/hniman


Top
 Profile  
 
 Post subject: Re: Rapid H1N1 Evolution in Beijing
PostPosted: Tue Dec 15, 2009 2:03 am 
Online

Joined: Wed Aug 19, 2009 10:42 am
Posts: 6528
Location: Pittsburgh, PA USA
gb|CY053353.1| Influenza A virus (A/Beijing/721/2009(H1N1)) s... 36.2 0.76
gb|CY053348.1| Influenza A virus (A/Beijing/720/2009(H1N1)) s... 36.2 0.76
gb|CY053338.1| Influenza A virus (A/Beijing/718/2009(H1N1)) s... 36.2 0.76
gb|CY051127.1| Influenza A virus (A/Wisconsin/629-D00119/2009... 36.2 0.76

_________________
www.twitter.com/hniman


Top
 Profile  
 
 Post subject: Re: Rapid H1N1 Evolution in Beijing
PostPosted: Tue Dec 15, 2009 2:03 am 
Online

Joined: Wed Aug 19, 2009 10:42 am
Posts: 6528
Location: Pittsburgh, PA USA
gb|CY053353.1| Influenza A virus (A/Beijing/721/2009(H1N1)) s... 32.2 12
gb|CY053348.1| Influenza A virus (A/Beijing/720/2009(H1N1)) s... 32.2 12
gb|CY053338.1| Influenza A virus (A/Beijing/718/2009(H1N1)) s... 32.2 12
gb|CY052202.1| Influenza A virus (A/Texas/42303371/2009(H1N1)... 32.2 12
gb|CY051399.1| Influenza A virus (A/Wisconsin/629-S0252/2009(... 32.2 12
gb|CY051247.1| Influenza A virus (A/Wisconsin/629-S0035/2009(... 32.2 12
gb|CY051111.1| Influenza A virus (A/Wisconsin/629-D02263/2009... 32.2 12
gb|CY050951.1| Influenza A virus (A/Wisconsin/629-D00724/2009... 32.2 12
gb|CY044220.1| Influenza A virus (A/Taiwan/T1773/2009(H1N1)) ... 32.2 12
gb|CY044251.1| Influenza A virus (A/San Antonio/PR923/2009(H1... 32.2 12
gb|CY044243.1| Influenza A virus (A/San Antonio/PR922/2009(H1... 32.2 12
gb|CY044235.1| Influenza A virus (A/San Antonio/PR921/2009(H1... 32.2 12
gb|GQ457487.1| Influenza A virus (A/Texas/05/2009(H1N1)) segm... 32.2 12
gb|GQ377072.1| Influenza A virus (A/Texas/04/2009(H1N1)) segm... 32.2 12
gb|GQ374897.1| Influenza A virus (A/reassortant/IDCDC-RG22(Ne... 32.2 12
gb|GQ374895.1| Influenza A virus (A/reassortant/IDCDC-RG20(Te... 32.2 12
gb|GQ374893.1| Influenza A virus (A/reassortant/IDCDC-RG18(Te... 32.2 12
gb|GQ229309.1| Influenza A virus (A/swine/Hong Kong/78/2003(H... 32.2 12
gb|GQ232076.1| Influenza A virus (A/Texas/11/2009(H1N1)) segm... 32.2 12
gb|GQ232002.1| Influenza A virus (A/Texas/10/2009(H1N1)) segm... 32.2 12
gb|GQ221798.1| Influenza A virus (A/Texas/04/2009(H1N1)) segm... 32.2 12
gb|GQ221791.1| Influenza A virus (A/Oklahoma/01/2009(H1N1)) s... 32.2 12
gb|GQ219781.1| Influenza A virus (A/reassortant/IDCDC-RG15(Te... 32.2 12
gb|GQ200221.1| Influenza A virus (A/Texas/12/2009(H1N1)) segm... 32.2 12
gb|GQ168861.1| Influenza A virus (A/Texas/05/2009(H1N1)) segm... 32.2 12
gb|GQ168671.1| Influenza A virus (A/Texas/09/2009(H1N1)) segm... 32.2 12
gb|GQ168633.1| Influenza A virus (A/Texas/08/2009(H1N1)) segm... 32.2 12
gb|GQ160586.1| Influenza A virus (A/North Carolina/05/2009(H1... 32.2 12
gb|GQ160574.1| Influenza A virus (A/Texas/22/2009(H1N1)) segm... 32.2 12
gb|GQ117059.1| Influenza A virus (A/Kansas/02/2009(H1N1)) seg... 32.2 12
gb|GQ117051.1| Influenza A virus (A/Texas/08/2009(H1N1)) segm... 32.2 12
gb|GQ117032.1| Influenza A virus (A/Texas/09/2009(H1N1)) segm... 32.2 12
gb|FJ984385.1| Influenza A virus (A/Texas/06/2009(H1N1)) segm... 32.2 12
gb|FJ981615.1| Influenza A virus (A/Texas/04/2009(H1N1)) segm... 32.2 12
gb|FJ981612.1| Influenza A virus (A/Texas/04/2009(H1N1)) segm... 32.2 12
gb|FJ966982.1| Influenza A virus (A/Texas/04/2009(H1N1)) segm... 32.2 12
gb|FJ966959.1| Influenza A virus (A/Texas/05/2009(H1N1)) segm... 32.2 12
gb|FJ688266.1| Influenza A virus (A/swine/Thailand/HF6/2005(H... 32.2 12
dbj|AB434296.1| Influenza A virus (A/swine/Ratchaburi/NIAH550... 32.2 12
gb|EU296603.1| Influenza A virus (A/swine/Chonburi/05CB1/2005... 32.2 12

_________________
www.twitter.com/hniman


Top
 Profile  
 
 Post subject: Re: Rapid H1N1 Evolution in Beijing
PostPosted: Tue Dec 15, 2009 3:46 am 
Offline

Joined: Fri Nov 27, 2009 4:13 am
Posts: 1
Dr niman,could you explain the consequences of this rapid evolution?


Top
 Profile  
 
 Post subject: Re: Rapid H1N1 Evolution in Beijing
PostPosted: Tue Dec 15, 2009 5:41 am 
Online

Joined: Wed Aug 19, 2009 10:42 am
Posts: 6528
Location: Pittsburgh, PA USA
Xiastou, Welcome to Flutrackers!
The rapid evolution indicates the virus has run out of easy targets (those with no immunity) and now has to find changes that will allow for new infections. Researchers in Beijing deposted sequences from eight isolates from Beijing, which were collected in November.

http://www.ncbi.nlm.nih.gov/genomes/FLU/SwineFlu.html

The sequences from all 8 were released for two genes, but those genes didn't have any changes. The NP gene however was present for 5 isolates and had a number of changes and these changes were in all 5 Beijing sequences, showing that the same evolving virus had infected many individuals in Beijing. The travel logs show which other viruses in the database have those changes, and there was quite a mixture, showing that the gene was picking up changes (largely from other H1N1's) via recombination.

However, the rapid evolution that will have the biggest impact is in HA, becasue that is were most of the immune response is, including the vaccine. Previously, the H1N1 has been evolvingly slowly becasue the virus could infect almost everyone (only those over 65 had significant immunity). These rapid changes however, are designed to defeat the immune response, including the vaccine. The number of changes were high and concentrated around the HA cleavage site. So far there are only 3 HA sequences, but many of the changes are found in 2 or 3 of the sequences, indicating the changes are real. The source of the changes is unclear, but since H1N1 can infect MANY species, the flu genes may be comg from species which are not well represented in the data base.

The bottom line however, is that the virus is now going to show how it can adapt and defeat current immunity. It is something that the virus does well, and a swine virus in humans that can infect many species is likley to result in quite a display, which will be a good show, but not a good result for hosts.

_________________
www.twitter.com/hniman


Last edited by niman on Tue Dec 15, 2009 6:07 am, edited 1 time in total.

Top
 Profile  
 
 Post subject: Re: Rapid H1N1 Evolution in Beijing
PostPosted: Tue Dec 15, 2009 5:51 am 
Offline

Joined: Thu Sep 03, 2009 5:21 am
Posts: 319
Quote:
(only those over 5 had significant immunity).

small typo -- I think Dr. Niman meant 65


Top
 Profile  
 
 Post subject: Re: Rapid H1N1 Evolution in Beijing
PostPosted: Tue Dec 15, 2009 6:08 am 
Online

Joined: Wed Aug 19, 2009 10:42 am
Posts: 6528
Location: Pittsburgh, PA USA
zombie wrote:
Quote:
(only those over 5 had significant immunity).

small typo -- I think Dr. Niman meant 65

Thanks, it has been corrected.

_________________
www.twitter.com/hniman


Top
 Profile  
 
Display posts from previous:  Sort by  
Post new topic Reply to topic  [ 27 posts ]  Go to page 1, 2, 3  Next

All times are UTC - 5 hours [ DST ]


Who is online

Users browsing this forum: MSN [Bot] and 12 guests


You cannot post new topics in this forum
You cannot reply to topics in this forum
You cannot edit your posts in this forum
You cannot delete your posts in this forum
You cannot post attachments in this forum

Search for:
Jump to:  
Powered by phpBB © 2000, 2002, 2005, 2007 phpBB Group