Rhiza Labs FluTracker Forum
http://fluboard.rhizalabs.com/forum/

Fujian H5N8 In Klamath Co OR With Wild Bird PB1 & PA
http://fluboard.rhizalabs.com/forum/viewtopic.php?f=5&t=14464
Page 2 of 2

Author:  niman [ Sun Dec 27, 2015 11:58 am ]
Post subject:  Re: Fujian H5N8 In Klamath Co OR With Wild Bird PB1 & PA

LOCUS KU201752 1704 bp cRNA linear VRL 22-DEC-2015
DEFINITION Influenza A virus (A/American wigeon/Oregon/AH0012525/2015(H5N8))
segment 4 hemagglutinin (HA) gene, complete cds.
ACCESSION KU201752
VERSION KU201752.1 GI:965568983
KEYWORDS .
SOURCE Influenza A virus (A/American wigeon/Oregon/AH0012525/2015(H5N8))
ORGANISM Influenza A virus (A/American wigeon/Oregon/AH0012525/2015(H5N8))
Viruses; ssRNA viruses; ssRNA negative-strand viruses;
Orthomyxoviridae; Influenzavirus A.
REFERENCE 1 (bases 1 to 1704)
AUTHORS Killian,M.L.
TITLE Direct Submission
JOURNAL Submitted (25-NOV-2015) Diagnostic Virology Laboratory, National
Veterinary Services Laboratories (NVSL), USDA APHIS VS, 1920 Dayton
Avenue, Ames, IA 50010, USA
COMMENT GenBank Accession Numbers KU201749-KU201756 represent sequences
from the 8 segments of Influenza A virus (A/American
wigeon/Oregon/AH0012525/2015(H5N8)).

##Assembly-Data-START##
Assembly Method :: SeqMan NGen v. v4
Sequencing Technology :: Illumina; IonTorrent
##Assembly-Data-END##
FEATURES Location/Qualifiers
source 1..1704
/organism="Influenza A virus (A/American
wigeon/Oregon/AH0012525/2015(H5N8))"
/mol_type="viral cRNA"
/strain="A/American wigeon/Oregon/AH0012525/2015"
/serotype="H5N8"
/isolation_source="oropharyngeal/cloacal swab pool from
individual bird"
/host="American wigeon; hunter harvest"
/db_xref="taxon:1763694"
/segment="4"
/country="USA: Klamath County, Oregon"
/collection_date="18-Jan-2015"
/note="NVSL 15-002957-11; EP1; Eurasian origin (EA-H5N8
clade 2.3.4.4)-North American reassortant"
gene 1..1704
/gene="HA"
CDS 1..1704
/gene="HA"
/function="receptor binding and fusion protein"
/codon_start=1
/product="hemagglutinin"
/protein_id="ALT19333.1"
/db_xref="GI:965568984"
/translation="MEKIVLLLAVISLVKSDQICIGYHANNSTKQVDTIMEKNVTVTH
AQDILEKTHNGKLCDLNGVKPLILKDCSVAGWLLGNPMCDEFIRVPEWSYIVERANPA
NDLCYPGTLNDYEELKHLLSRINHFEKTLIIPRSSWPNHETSLGVSAACPYQGASSFF
RNVVWLIKKNDAYPTIKISYNNTNREDLLILWGIHHSNNAAEQTNLYKNPDTYVSVGT
STLNQRLVPKIATRSQVNGQSGRMDFFWTILKPNDAIHFESNGNFIAPEYAYKIVKKG
DSTIMKSEMEYGHCNTKCQTPIGAINSSMPFHNIHPLTIGECPKYVKSNKLVLATGLR
NSPLRERRRKRGLFGAIAGFIEGGWQGMVDGWYGYHHSNEQGSGYAADKESTQKAIDG
VTNKVNSIIDKMNTQFEAVGREFNNLERRIENLNKKMEDGFLDVWTYNAELLVLMENE
RTLDFHDSNVKNLYDKVRLQLRDNAKELGNGCFEFYHKCDNECIESVRNGTYDYPKYS
EEAILKREEISGVKLESIGTYQILSIYSTVASSLALAIIVAGLSLWMCSNGSLQCRIC
I"
sig_peptide 1..48
/gene="HA"
mat_peptide 49..1035
/gene="HA"
/product="HA1"
mat_peptide 1036..1701
/gene="HA"
/product="HA2"
ORIGIN
1 atggagaaaa tagtgcttct tcttgcagtg attagccttg ttaaaagtga tcagatttgc
61 attggttacc atgcaaacaa ctcaacaaag caggttgaca cgataatgga gaaaaacgtc
121 actgttacac atgcccaaga catactggaa aagacacaca acgggaagct ctgcgatctt
181 aatggagtga agcccctgat tctaaaggat tgtagcgtag ctgggtggct ccttggaaat
241 ccaatgtgcg acgagtttat cagggtaccg gaatggtctt acatcgtgga gagggctaac
301 ccagccaacg acctctgtta cccagggacc ctcaatgact atgaggaact gaaacaccta
361 ttgagcagaa taaatcattt tgagaaaact ctgatcatcc ccaggagttc ttggcccaat
421 catgaaacat cattaggggt gagcgcagca tgtccatacc agggagcatc ctcatttttc
481 agaaatgtgg tatggctcat caaaaagaac gatgcatacc cgacaataaa gataagctac
541 aataatacca atcgggaaga tcttttgata ctgtggggga ttcatcattc caacaatgca
601 gcagagcaga caaatctcta taaaaaccca gacacttatg tttccgttgg gacatcaaca
661 ttaaaccaga gattggtgcc aaaaatagct actagatccc aagtaaacgg gcagagtgga
721 agaatggatt tcttctggac aattttaaaa ccgaatgatg caatccactt tgagagtaat
781 ggaaatttca ttgctccaga atatgcatac aaaattgtca agaaagggga ttcaacaatt
841 atgaaaagtg aaatggagta tggccactgc aacaccaaat gtcaaactcc aataggggct
901 ataaactcta gcatgccatt ccacaatata caccctctca ccatcgggga atgccccaaa
961 tacgtgaagt caaacaaatt agtccttgcg actgggctca gaaatagtcc tctaagagaa
1021 agaagaagaa aaagaggact atttggagct atagcagggt ttatagaggg aggatggcag
1081 ggaatggtag acggttggta tgggtatcat catagcaatg agcaggggag tgggtacgct
1141 gcagacaaag aatccaccca aaaggcaata gatggagtta ccaataaggt caactcaatc
1201 attgacaaaa tgaacactca atttgaggcc gttggaaggg aatttaataa cttagaaagg
1261 agaatagaga atttaaacaa gaaaatggaa gacggattcc tagatgtctg gacttataat
1321 gctgaacttt tagttctcat ggaaaatgag agaactctag atttccatga ctcaaatgtc
1381 aagaaccttt acgacaaagt ccgactacag cttagggata atgcaaagga gctgggtaat
1441 ggttgtttcg agttctatca caaatgtgat aacgaatgta tagagagcgt aagaaatggg
1501 acgtatgact accctaagta ttcagaagaa gcaatattaa aaagagaaga aataagcgga
1561 gtgaaattag aatcaatagg aacttaccag atactgtcaa tttattcaac agtggcgagt
1621 tccctagcac tggcaatcat agtggctggt ttatctttat ggatgtgctc taatgggtcg
1681 ttacaatgca gaatttgcat ctaa

Author:  niman [ Sun Dec 27, 2015 12:01 pm ]
Post subject:  Re: Fujian H5N8 In Klamath Co OR With Wild Bird PB1 & PA

Select seq gb|KU201752.1| Influenza A virus (A/American wigeon/Oregon/AH0012525/2015(H5N8)) segment 4 hemagglutinin (HA) gene, complete cds 3074 3074 100% 0.0 100% KU201752.1
Select seq gb|KR150901.1| Influenza A virus (A/turkey/California/K1500169-1.2/2015(H5N8)) segment 4 hemagglutinin (HA) gene, complete cds 3059 3059 100% 0.0 99% KR150901.1
Select seq gb|KU201744.1| Influenza A virus (A/Canada goose/Oregon/AH0012452/2015(H5N8)) segment 4 hemagglutinin (HA) gene, complete cds 3056 3056 100% 0.0 99% KU201744.1
Select seq gb|KU201856.1| Influenza A virus (A/American wigeon/Washington/196336/2015(H5N1)) segment 4 hemagglutinin (HA) gene, complete cds 3050 3050 100% 0.0 99% KU201856.1
Select seq gb|KU201872.1| Influenza A virus (A/mallard/Oregon/195536/2014(H5N8)) segment 4 hemagglutinin (HA) gene, complete cds 3050 3050 100% 0.0 99% KU201872.1
Select seq gb|KU201864.1| Influenza A virus (A/American wigeon/Washington/196340/2015(H5N1)) segment 4 hemagglutinin (HA) gene, complete cds 3047 3047 100% 0.0 99% KU201864.1
Select seq gb|KP739421.1| Influenza A virus (A/American green-winged teal/Washington/195750/2014(H5N1)) segment 4 hemagglutinin (HA) gene, complete cds 3047 3047 100% 0.0 99% KP739421.1
Select seq gb|KU201608.1| Influenza A virus (A/snow goose/Missouri/15-011246-1/2015(H5N2)) segment 4 hemagglutinin (HA) gene, complete cds 3041 3041 100% 0.0 99% KU201608.1
Select seq gb|KU201632.1| Influenza A virus (A/Northern pintail/Oregon/AH0003967/2015(H5N2)) segment 4 hemagglutinin (HA) gene, complete cds 3041 3041 100% 0.0 99% KU201632.1
Select seq gb|KU201640.1| Influenza A virus (A/wood duck/Oregon/AH0007244/2015(H5N2)) segment 4 hemagglutinin (HA) gene, complete cds 3041 3041 100% 0.0 99% KU201640.1
Select seq gb|KU201648.1| Influenza A virus (A/wood duck/Oregon/AH0007257/2015(H5N2)) segment 4 hemagglutinin (HA) gene, complete cds 3041 3041 100% 0.0 99% KU201648.1
Select seq gb|KU201728.1| Influenza A virus (A/American green-winged teal/Idaho/AH0011899/2015(H5N2)) segment 4 hemagglutinin (HA) gene, complete cds 3041 3041 100% 0.0 99% KU201728.1
Select seq gb|KU201736.1| Influenza A virus (A/American green-winged teal/Oregon/AH0012403/2015(H5N2)) segment 4 hemagglutinin (HA) gene, complete cds 3041 3041 100% 0.0 99% KU201736.1
Select seq gb|KU201784.1| Influenza A virus (A/mallard/Oregon/AH0003821/2014(H5N2)) segment 4 hemagglutinin (HA) gene, complete cds 3041 3041 100% 0.0 99% KU201784.1
Select seq gb|KU201832.1| Influenza A virus (A/mallard/Washington/196262/2015(H5N2)) segment 4 hemagglutinin (HA) gene, complete cds 3041 3041 100% 0.0 99% KU201832.1
Select seq gb|KP307976.1| Influenza A virus (A/Northern pintail/Washington/40964/2014(H5N2)) segment 4 hemagglutinin (HA) gene, complete cds 3041 3041 100% 0.0 99% KP307976.1
Select seq gb|KP307957.1| Influenza A virus (A/turkey/BC/FAV10/2014(H5N2)) segment 4 hemagglutinin (HA) gene, complete cds 3041 3041 100% 0.0 99% KP307957.1
Select seq gb|KU201656.1| Influenza A virus (A/wood duck/Oregon/AH0007263/2015(H5N2)) segment 4 hemagglutinin (HA) gene, complete cds 3038 3038 100% 0.0 99% KU201656.1
Select seq gb|KU201696.1| Influenza A virus (A/mallard/Oregon/AH0008887/2015(H5N2)) segment 4 hemagglutinin (HA) gene, complete cds 3038 3038 100% 0.0 99% KU201696.1
Select seq gb|KU201704.1| Influenza A virus (A/Northern pintail/Oregon/AH0003871/2015(H5N2)) segment 4 hemagglutinin (HA) gene, complete cds 3038 3038 100% 0.0 99% KU201704.1
Select seq gb|KU201808.1| Influenza A virus (A/Northern pintail/Washington/195365/2014(H5N2)) segment 4 hemagglutinin (HA) gene, complete cds 3038 3038 100% 0.0 99% KU201808.1
Select seq gb|KU201816.1| Influenza A virus (A/mallard/Oregon/195547/2014(H5N2)) segment 4 hemagglutinin (HA) gene, complete cds 3038 3038 100% 0.0 99% KU201816.1
Select seq gb|KU201848.1| Influenza A virus (A/mallard/Washington/196865/2015(H5N2)) segment 4 hemagglutinin (HA) gene, complete cds 3038 3038 100% 0.0 99% KU201848.1
Select seq gb|KU201880.1| Influenza A virus (A/American American wigeon/Washington/195198/2014(H5N8)) segment 4 hemagglutinin (HA) gene, complete cds 3038 3038 100% 0.0 99% KU201880.1
Select seq gb|KU201888.1| Influenza A virus (A/American wigeon/Washington/195205/2014(H5N8)) segment 4 hemagglutinin (HA) gene, complete cds 3038 3038 100% 0.0 99% KU201888.1
Select seq gb|KT762932.1| Influenza A virus (A/turkey/South Dakota/15-010371/2015(H5N2)) segment 4 hemagglutinin (HA) gene, complete cds 3038 3038 100% 0.0 99% KT762932.1
Select seq gb|KT762956.1| Influenza A virus (A/chicken/Wisconsin/15-012160-1/2015(H5N2)) segment 4 hemagglutinin (HA) gene, complete cds 3038 3038 100% 0.0 99% KT762956.1
Select seq gb|KR234038.1| Influenza A virus (A/turkey/Minnesota/9845-4/2015(H5N2)) segment 4 hemagglutinin (HA) gene, complete cds 3038 3038 100% 0.0 99% KR234038.1
Select seq gb|KR234030.1| Influenza A virus (A/chicken/Kansas/8395-3/2015(H5N2)) segment 4 hemagglutinin (HA) gene, complete cds 3038 3038 100% 0.0 99% KR234030.1
Select seq gb|KR234014.1| Influenza A virus (A/turkey/Missouri/7458-1/2015(H5N2)) segment 4 hemagglutinin (HA) gene, complete cds 3038 3038 100% 0.0 99% KR234014.1
Select seq gb|KR150909.1| Influenza A virus (A/pheasant/Washington/3147-2/2015(H5N2)) segment 4 hemagglutinin (HA) gene, complete cds 3038 3038 100% 0.0 99% KR150909.1
Select seq gb|KP795729.1| Influenza A virus (A/chicken/BC/FAV8/2014(H5N2)) segment 4 hemagglutinin (HA) gene, complete cds 3038 3038 100% 0.0 99% KP795729.1
Select seq gb|KP307984.1| Influenza A virus (A/gyrfalcon/Washington/41088-6/2014(H5N8)) segment 4 hemagglutinin (HA) gene, complete cds 3038 3038 100% 0.0 99% KP307984.1
Select seq gb|KU201616.1| Influenza A virus (A/American wigeon/Utah/AH0007824/2015(H5N8)) segment 4 hemagglutinin (HA) gene, complete cds 3032 3032 100% 0.0 99% KU201616.1
Select seq gb|KU201672.1| Influenza A virus (A/Northern shoveler/Oregon/AH0007337/2015(H5N2)) segment 4 hemagglutinin (HA) gene, complete cds 3032 3032 100% 0.0 99% KU201672.1
Select seq gb|KU201688.1| Influenza A virus (A/mallard/Idaho/AH0008597/2015(H5N8)) segment 4 hemagglutinin (HA) gene, complete cds 3032 3032 100% 0.0 99% KU201688.1
Select seq gb|KU201760.1| Influenza A virus (A/mallard/Nevada/AH0006855/2015(H5N8)) segment 4 hemagglutinin (HA) gene, complete cds 3032 3032 100% 0.0 99% KU201760.1
Select seq gb|KU201776.1| Influenza A virus (A/mallard/Idaho/AH0005955/2014(H5N8)) segment 4 hemagglutinin (HA) gene, complete cds 3032 3032 100% 0.0 99% KU201776.1
Select seq gb|KU201800.1| Influenza A virus (A/bald eagle/Idaho/15-002892-2/2015(H5N8)) segment 4 hemagglutinin (HA) gene, complete cds 3032 3032 100% 0.0 99% KU201800.1
Select seq gb|KU201896.1| Influenza A virus (A/mallard/Washington/195246/2014(H5N2)) segment 4 hemagglutinin (HA) gene, complete cds 3032 3032 100% 0.0 99% KU201896.1
Select seq gb|KU201912.1| Influenza A virus (A/mallard/Washington/195810/2014(H5N2)) segment 4 hemagglutinin (HA) gene, complete cds 3032 3032 100% 0.0 99% KU201912.1
Select seq gb|KU201920.1| Influenza A virus (A/Canada goose/Washington/197619/2014(H5N2)) segment 4 hemagglutinin (HA) gene, complete cds 3032 3032 100% 0.0 99% KU201920.1
Select seq gb|KU201928.1| Influenza A virus (A/Cooper's hawk/Minnesota/198225/2015(H5N2)) segment 4 hemagglutinin (HA) gene, complete cds 3032 3032 100% 0.0 99% KU201928.1
Select seq gb|KT762908.1| Influenza A virus (A/turkey/Wisconsin/15-012012-2/2015(H5N2)) segment 4 hemagglutinin (HA) gene, complete cds 3032 3032 100% 0.0 99% KT762908.1
Select seq gb|KT762948.1| Influenza A virus (A/chicken/Wisconsin/15-011595-1/2015(H5N2)) segment 4 hemagglutinin (HA) gene, complete cds 3032 3032 100% 0.0 99% KT762948.1
Select seq gb|KT002473.1| Influenza A virus (A/turkey/Iowa/11762-1/2015(H5N2)) segment 4 hemagglutinin (HA) gene, complete cds 3032 3032 100% 0.0 99% KT002473.1
Select seq gb|KR234022.1| Influenza A virus (A/turkey/Arkansas/7791-1/2015(H5N2)) segment 4 hemagglutinin (HA) gene, complete cds 3032 3032 100% 0.0 99% KR234022.1
Select seq gb|KR233990.1| Influenza A virus (A/chicken/Washington/3490-18/2015(H5N2)) segment 4 hemagglutinin (HA) gene, complete cds 3032 3032 100% 0.0 99% KR233990.1
Select seq gb|KR233998.1| Influenza A virus (A/chicken/Oregon/A01819044/2015(H5N2)) segment 4 hemagglutinin (HA) gene, complete cds 3032 3032 100% 0.0 99% KR233998.1
Select seq gb|KR234006.1| Influenza A virus (A/turkey/Minnesota/7172-1/2015(H5N2)) segment 4 hemagglutinin (HA) gene, complete cds 3032 3032 100% 0.0 99% KR234006.1
Select seq gb|KP795737.1| Influenza A virus (A/chicken/BC/FAV9/2014(H5N2)) segment 4 hemagglutinin (HA) gene, complete cds 3032 3032 100% 0.0 99% KP795737.1
Select seq gb|KP739397.1| Influenza A virus (A/turkey/Washington/61-22/2014(H5N2)) segment 4 hemagglutinin (HA) gene, complete cds 3032 3032 100% 0.0 99% KP739397.1
Select seq gb|KU201624.1| Influenza A virus (A/mallard/Oregon/AH0003952/2015(H5N2)) segment 4 hemagglutinin (HA) gene, complete cds 3029 3029 100% 0.0 99% KU201624.1
Select seq gb|KU201664.1| Influenza A virus (A/Northern shoveler/Oregon/AH0007332/2015(H5N2)) segment 4 hemagglutinin (HA) gene, complete cds 3029 3029 100% 0.0 99% KU201664.1
Select seq gb|KU201680.1| Influenza A virus (A/Northern shoveler/Oregon/AH0007339/2015(H5N2)) segment 4 hemagglutinin (HA) gene, complete cds 3029 3029 100% 0.0 99% KU201680.1
Select seq gb|KU201712.1| Influenza A virus (A/mallard/Idaho/AH0007412/2015(H5N2)) segment 4 hemagglutinin (HA) gene, complete cds 3029 3029 100% 0.0 99% KU201712.1
Select seq gb|KU201720.1| Influenza A virus (A/mallard/Idaho/AH0007413/2015(H5N2)) segment 4 hemagglutinin (HA) gene, complete cds 3029 3029 100% 0.0 99% KU201720.1
Select seq gb|KU201936.1| Influenza A virus (A/snowy owl/Wisconsin/198399/2015(H5N2)) segment 4 hemagglutinin (HA) gene, complete cds 3029 3029 100% 0.0 99% KU201936.1
Select seq gb|KT762892.1| Influenza A virus (A/turkey/North Dakota/15-011420-13/2015(H5N2)) segment 4 hemagglutinin (HA) gene, complete cds 3029 3029 100% 0.0 99% KT762892.1
Select seq gb|KT762916.1| Influenza A virus (A/turkey/North Dakota/15-013049-1/2015(H5N2)) segment 4 hemagglutinin (HA) gene, complete cds 3029 3029 100% 0.0 99% KT762916.1
Select seq gb|KR233982.1| Influenza A virus (A/turkey/Minnesota/9892-2/2015(H5N2)) segment 4 hemagglutinin (HA) gene, complete cds 3029 3029 100% 0.0 99% KR233982.1
Select seq gb|KP739381.1| Influenza A virus (A/chicken/Washington/61-9/2014(H5N2)) segment 4 hemagglutinin (HA) gene, complete cds 3029 3029 100% 0.0 99% KP739381.1
Select seq gb|KU201768.1| Influenza A virus (A/mallard/Idaho/AH0005954/2014(H5N8)) segment 4 hemagglutinin (HA) gene, complete cds 3023 3023 100% 0.0 99% KU201768.1
Select seq gb|KU201792.1| Influenza A virus (A/chicken/California/15-004912/2015(H5N8)) segment 4 hemagglutinin (HA) gene, complete cds 3023 3023 100% 0.0 99% KU201792.1
Select seq gb|KT762924.1| Influenza A virus (A/chicken/Minnesota/15-013533-1/2015(H5N2)) segment 4 hemagglutinin (HA) gene, complete cds 3023 3023 100% 0.0 99% KT762924.1
Select seq gb|KP739389.1| Influenza A virus (A/domestic duck/Washington/61-16/2014(H5N2)) segment 4 hemagglutinin (HA) gene, complete cds 3023 3023 100% 0.0 99% KP739389.1
Select seq gb|KU201840.1| Influenza A virus (A/Northern pintail/Washington/196271/2014(H5N8)) segment 4 hemagglutinin (HA) gene, complete cds 3020 3020 100% 0.0 99% KU201840.1
Select seq gb|KT388572.1| Influenza A virus (A/goose/Taiwan/TNO3/2015(H5N8)) segment 4 cRNA sequence 3020 3020 100% 0.0 99% KT388572.1
Select seq gb|KT388700.1| Influenza A virus (A/goose/Taiwan/TNO19/2015(H5N8)) segment 4 cRNA sequence 3014 3014 100% 0.0 99% KT388700.1
Select seq gb|KT388692.1| Influenza A virus (A/goose/Taiwan/TNO18/2015(H5N8)) segment 4 cRNA sequence 3014 3014 100% 0.0 99% KT388692.1
Select seq gb|KT388684.1| Influenza A virus (A/goose/Taiwan/TNO17/2015(H5N8)) segment 4 cRNA sequence 3014 3014 100% 0.0 99% KT388684.1
Select seq gb|KT388652.1| Influenza A virus (A/goose/Taiwan/TNO13/2015(H5N8)) segment 4 cRNA sequence 3014 3014 100% 0.0 99% KT388652.1
Select seq gb|KT388644.1| Influenza A virus (A/goose/Taiwan/TNO12/2015(H5N8)) segment 4 cRNA sequence 3014 3014 100% 0.0 99% KT388644.1
Select seq gb|KT388636.1| Influenza A virus (A/goose/Taiwan/TNO11/2015(H5N8)) segment 4 cRNA sequence 3014 3014 100% 0.0 99% KT388636.1
Select seq gb|KT388612.1| Influenza A virus (A/goose/Taiwan/TNO8/2015(H5N8)) segment 4 cRNA sequence 3014 3014 100% 0.0 99% KT388612.1
Select seq gb|KT388556.1| Influenza A virus (A/goose/Taiwan/TNO1/2015(H5N8)) segment 4 cRNA sequence 3014 3014 100% 0.0 99% KT388556.1
Select seq gb|KT388548.1| Influenza A virus (A/goose/Taiwan/TNC14/2015(H5N8)) segment 4 cRNA sequence 3014 3014 100% 0.0 99% KT388548.1
Select seq gb|KT388532.1| Influenza A virus (A/goose/Taiwan/TNC12/2015(H5N8)) segment 4 cRNA sequence 3014 3014 100% 0.0 99% KT388532.1
Select seq gb|KT388516.1| Influenza A virus (A/goose/Taiwan/TNC10/2015(H5N8)) segment 4 cRNA sequence 3014 3014 100% 0.0 99% KT388516.1
Select seq gb|KT388500.1| Influenza A virus (A/goose/Taiwan/TNC8/2015(H5N8)) segment 4 cRNA sequence 3014 3014 100% 0.0 99% KT388500.1
Select seq gb|KT388492.1| Influenza A virus (A/goose/Taiwan/TNC7/2015(H5N8)) segment 4 cRNA sequence 3014 3014 100% 0.0 99% KT388492.1
Select seq gb|KT388484.1| Influenza A virus (A/goose/Taiwan/TNC6/2015(H5N8)) segment 4 cRNA sequence 3014 3014 100% 0.0 99% KT388484.1
Select seq gb|KT388452.1| Influenza A virus (A/goose/Taiwan/TNC2/2015(H5N8)) segment 4 cRNA sequence 3014 3014 100% 0.0 99% KT388452.1
Select seq gb|KT762900.1| Influenza A virus (A/chicken/Nebraska/15-017897-1/2015(H5N2)) segment 4 hemagglutinin (HA) gene, complete cds 3014 3014 100% 0.0 99% KT762900.1
Select seq gb|KT762940.1| Influenza A virus (A/chicken/Nebraska/15-017990-5/2015(H5N2)) segment 4 hemagglutinin (HA) gene, complete cds 3014 3014 100% 0.0 99% KT762940.1
Select seq gb|KT002489.1| Influenza A virus (A/chicken/Iowa/13542-2/2015(H5N2)) segment 4 hemagglutinin (HA) gene, complete cds 3014 3014 100% 0.0 99% KT002489.1
Select seq gb|KU201824.1| Influenza A virus (A/American wigeon/Washington/195968/2014(H5N8)) segment 4 hemagglutinin (HA) gene, complete cds 3011 3011 100% 0.0 99% KU201824.1
Select seq gb|KU201904.1| Influenza A virus (A/peregrine falcon/Washington/196426/2014(H5N8)) segment 4 hemagglutinin (HA) gene, complete cds 3011 3011 100% 0.0 99% KU201904.1
Select seq gb|KU201943.1| Influenza A virus (A/Canada goose/Kansas/197850/2015(H5N2)) segment 4 hemagglutinin (HA) gene, complete cds 3011 3011 100% 0.0 99% KU201943.1
Select seq gb|KT388660.1| Influenza A virus (A/goose/Taiwan/TNO14/2015(H5N8)) segment 4 cRNA sequence 3011 3011 100% 0.0 99% KT388660.1
Select seq gb|KT388628.1| Influenza A virus (A/goose/Taiwan/TNO10/2015(H5N8)) segment 4 cRNA sequence 3011 3011 100% 0.0 99% KT388628.1
Select seq gb|KT388604.1| Influenza A virus (A/goose/Taiwan/TNO7/2015(H5N8)) segment 4 cRNA sequence 3011 3011 100% 0.0 99% KT388604.1
Select seq gb|KT388540.1| Influenza A virus (A/goose/Taiwan/TNC13/2015(H5N8)) segment 4 cRNA sequence 3011 3011 100% 0.0 99% KT388540.1
Select seq gb|KT388508.1| Influenza A virus (A/goose/Taiwan/TNC9/2015(H5N8)) segment 4 cRNA sequence 3011 3011 100% 0.0 99% KT388508.1
Select seq gb|KT388460.1| Influenza A virus (A/goose/Taiwan/TNC3/2015(H5N8)) segment 4 cRNA sequence 3011 3011 100% 0.0 99% KT388460.1
Select seq gb|KT388444.1| Influenza A virus (A/goose/Taiwan/TNC1/2015(H5N8)) segment 4 cRNA sequence 3011 3011 100% 0.0 99% KT388444.1
Select seq gb|KT762884.1| Influenza A virus (A/chicken/Montana/15-010559-1/2015(H5N2)) segment 4 hemagglutinin (HA) gene, complete cds 3011 3011 100% 0.0 99% KT762884.1
Select seq gb|KT280932.1| Influenza A virus (A/chicken/Iowa/21981/2015(H5N2)) segment 4 hemagglutinin (HA) gene, complete cds 3011 3011 100% 0.0 99% KT280932.1
Select seq gb|KR492974.3| Influenza A virus (A/chicken/Iowa/04-20/2015(H5N2)) segment 4 hemagglutinin (HA) gene, complete cds 3011 3011 100% 0.0 99% KR492974.3
Select seq gb|KT002505.1| Influenza A virus (A/turkey/Iowa/14319-1/2015(H5N2)) segment 4 hemagglutinin (HA) gene, complete cds 3011 3011 100% 0.0 99% KT002505.1
Select seq gb|KT002481.1| Influenza A virus (A/turkey/Iowa/13541-1/2015(H5N2)) segment 4 hemagglutinin (HA) gene, complete cds 3005 3005 100% 0.0 99% KT002481.1
Select seq gb|KT002513.1| Influenza A virus (A/chicken/Iowa/14322-6/2015(H5N2)) segment 4 hemagglutinin (HA) gene, complete cds 3005 3005 100% 0.0 99% KT002513.1
Select seq gb|KT002521.1| Influenza A virus (A/chicken/Iowa/14399-4/2015(H5N2)) segment 4 hemagglutinin (HA) gene, complete cds 3005 3005 100% 0.0 99% KT002521.1
Select seq gb|KT002528.1| Influenza A virus (A/chicken/Iowa/14589-1/2015(H5N2)) segment 4 hemagglutinin (HA) gene, complete cds 3005 3005 100% 0.0 99% KT002528.1
Select seq gb|KT388708.1| Influenza A virus (A/goose/Taiwan/TNO20/2015(H5N8)) segment 4 cRNA sequence 3002 3002 100% 0.0 99% KT388708.1
Select seq gb|KT388676.1| Influenza A virus (A/goose/Taiwan/TNO16/2015(H5N8)) segment 4 cRNA sequence 3002 3002 100% 0.0 99% KT388676.1
Select seq gb|KT388668.1| Influenza A virus (A/goose/Taiwan/TNO15/2015(H5N8)) segment 4 cRNA sequence 3002 3002 100% 0.0 99% KT388668.1
Select seq gb|KT388620.1| Influenza A virus (A/goose/Taiwan/TNO9/2015(H5N8)) segment 4 cRNA sequence 3002 3002 100% 0.0 99% KT388620.1
Select seq gb|KT388596.1| Influenza A virus (A/goose/Taiwan/TNO6/2015(H5N8)) segment 4 cRNA sequence 3002 3002 100% 0.0 99% KT388596.1
Select seq gb|KT388580.1| Influenza A virus (A/goose/Taiwan/TNO4/2015(H5N8)) segment 4 cRNA sequence 3002 3002 100% 0.0 99% KT388580.1
Select seq gb|KT388564.1| Influenza A virus (A/goose/Taiwan/TNO2/2015(H5N8)) segment 4 cRNA sequence 3002 3002 100% 0.0 99% KT388564.1
Select seq gb|KT388524.1| Influenza A virus (A/goose/Taiwan/TNC11/2015(H5N8)) segment 4 cRNA sequence 3002 3002 100% 0.0 99% KT388524.1
Select seq gb|KT388476.1| Influenza A virus (A/goose/Taiwan/TNC5/2015(H5N8)) segment 4 cRNA sequence 3002 3002 100% 0.0 99% KT388476.1
Select seq gb|KT388468.1| Influenza A virus (A/goose/Taiwan/TNC4/2015(H5N8)) segment 4 cRNA sequence 3002 3002 100% 0.0 99% KT388468.1
Select seq gb|KT002497.1| Influenza A virus (A/turkey/Iowa/14318-1/2015(H5N2)) segment 4 hemagglutinin (HA) gene, complete cds 3002 3002 100% 0.0 99% KT002497.1
Select seq gb|KJ509036.1| Influenza A virus (A/Baikal teal/Korea/H96/2014(H5N8)) segment 4 hemagglutinin (HA) gene, complete cds 3002 3002 100% 0.0 99% KJ509036.1
Select seq gb|KJ756628.1| Influenza A virus (A/baikal teal/Korea/1456/2014(H5N8)) segment 4 hemagglutinin (HA) gene, complete cds 2996 2996 100% 0.0 99% KJ756628.1
Select seq gb|KJ509108.1| Influenza A virus (A/breeder duck/Korea/H249/2014(H5N8)) segment 4 hemagglutinin (HA) gene, complete cds 2996 2996 100% 0.0 99% KJ509108.1
Select seq gb|KJ756636.1| Influenza A virus (A/baikal teal/Korea/2416/2014(H5N8)) segment 4 hemagglutinin (HA) gene, complete cds 2993 2993 100% 0.0 99% KJ756636.1
Select seq gb|KJ756632.1| Influenza A virus (A/baikal teal/Korea/2402/2014(H5N8)) segment 4 hemagglutinin (HA) gene, complete cds 2993 2993 100% 0.0 99% KJ756632.1
Select seq gb|KJ756624.1| Influenza A virus (A/baikal teal/Korea/1448/2014(H5N8)) segment 4 hemagglutinin (HA) gene, complete cds 2993 2993 100% 0.0 99% KJ756624.1
Select seq gb|KJ756623.1| Influenza A virus (A/baikal teal/Korea/1447/2014(H5N8)) segment 4 hemagglutinin (HA) gene, complete cds 2993 2993 100% 0.0 99% KJ756623.1
Select seq gb|KJ756621.1| Influenza A virus (A/baikal teal/Korea/1445/2014(H5N8)) segment 4 hemagglutinin (HA) gene, complete cds 2993 2993 100% 0.0 99% KJ756621.1
Select seq gb|KJ756619.1| Influenza A virus (A/baikal teal/Korea/1437/2014(H5N8)) segment 4 hemagglutinin (HA) gene, complete cds 2993 2993 100% 0.0 99% KJ756619.1
Select seq gb|KJ508988.1| Influenza A virus (A/broiler duck/Korea/H65/2014(H5N8)) segment 4 hemagglutinin (HA) gene, complete cds 2993 2993 100% 0.0 99% KJ508988.1
Select seq gb|KJ509004.1| Influenza A virus (A/Baikal teal/Korea/H68/2014(H5N8)) segment 4 hemagglutinin (HA) gene, complete cds 2993 2993 100% 0.0 99% KJ509004.1
Select seq gb|KJ509028.1| Influenza A virus (A/Baikal teal/Korea/H84/2014(H5N8)) segment 4 hemagglutinin (HA) gene, complete cds 2993 2993 100% 0.0 99% KJ509028.1
Select seq gb|KJ509044.1| Influenza A virus (A/breeder chicken/Korea/H122/2014(H5N8)) segment 4 hemagglutinin (HA) gene, complete cds 2993 2993 100% 0.0 99% KJ509044.1
Select seq gb|KJ509076.1| Influenza A virus (A/breeder duck/Korea/H158/2014(H5N8)) segment 4 hemagglutinin (HA) gene, complete cds 2993 2993 100% 0.0 99% KJ509076.1
Select seq gb|KJ509140.1| Influenza A virus (A/bean goose/Korea/H328/2014(H5N8)) segment 4 hemagglutinin (HA) gene, complete cds 2993 2993 100% 0.0 99% KJ509140.1
Select seq gb|KJ509164.1| Influenza A virus (A/spot-billed duck/Korea/H455-42/2014(H5N8)) segment 4 hemagglutinin (HA) gene, complete cds 2993 2993 100% 0.0 99% KJ509164.1
Select seq gb|KJ756629.1| Influenza A virus (A/baikal teal/Korea/1457/2014(H5N8)) segment 4 hemagglutinin (HA) gene, complete cds 2987 2987 100% 0.0 99% KJ756629.1
Select seq gb|KJ756625.1| Influenza A virus (A/baikal teal/Korea/1449/2014(H5N8)) segment 4 hemagglutinin (HA) gene, complete cds 2987 2987 100% 0.0 99% KJ756625.1
Select seq gb|KJ508924.1| Influenza A virus (A/bean goose/Korea/H40/2014(H5N8)) segment 4 hemagglutinin (HA) gene, complete cds 2987 2987 100% 0.0 99% KJ508924.1
Select seq gb|KJ509100.1| Influenza A virus (A/white-fronted goose/Korea/H231/2014(H5N8)) segment 4 hemagglutinin (HA) gene, complete cds 2987 2987 100% 0.0 99% KJ509100.1
Select seq gb|KJ509116.1| Influenza A virus (A/breeder chicken/Korea/H250/2014(H5N8)) segment 4 hemagglutinin (HA) gene, complete cds 2987 2987 100% 0.0 99% KJ509116.1
Select seq gb|KJ509132.1| Influenza A virus (A/mallard/Korea/H297/2014(H5N8)) segment 4 hemagglutinin (HA) gene, complete cds 2987 2987 100% 0.0 99% KJ509132.1
Select seq gb|KJ413842.1| Influenza A virus (A/broiler duck/Korea/Buan2/2014(H5N8)) segment 4 hemagglutinin (HA) gene, complete cds 2987 2987 100% 0.0 99% KJ413842.1
Select seq gb|KJ756622.1| Influenza A virus (A/baikal teal/Korea/1446/2014(H5N8)) segment 4 hemagglutinin (HA) gene, complete cds 2984 2984 100% 0.0 99% KJ756622.1
Select seq gb|KJ508948.1| Influenza A virus (A/broiler duck/Korea/H48/2014(H5N8)) segment 4 hemagglutinin (HA) gene, complete cds 2984 2984 100% 0.0 99% KJ508948.1
Select seq gb|KJ508956.1| Influenza A virus (A/broiler duck/Korea/H49/2014(H5N8)) segment 4 hemagglutinin (HA) gene, complete cds 2984 2984 100% 0.0 99% KJ508956.1
Select seq gb|KJ509124.1| Influenza A virus (A/Korean native chicken/Korea/H257/2014(H5N8)) segment 4 hemagglutinin (HA) gene, complete cds 2984 2984 100% 0.0 99% KJ509124.1
Select seq gb|KJ509148.1| Influenza A virus (A/tundra swan/Korea/H411/2014(H5N8)) segment 4 hemagglutinin (HA) gene, complete cds 2984 2984 100% 0.0 99% KJ509148.1
Select seq gb|KJ511812.1| Influenza A virus (A/waterfowl/Korea/S005/2014(H5N8)) segment 4 hemagglutinin (HA) gene, complete cds 2984 2984 100% 0.0 99% KJ511812.1
Select seq dbj|AB932556.1| Influenza A virus (A/chicken/kumamoto/1-7/2014(H5N8)) HA gene for hemagglutinin, complete cds 2984 2984 100% 0.0 99% AB932556.1
Select seq gb|KJ756630.1| Influenza A virus (A/baikal teal/Korea/1458/2014(H5N8)) segment 4 hemagglutinin (HA) gene, complete cds 2978 2978 100% 0.0 99% KJ756630.1
Select seq gb|KJ756627.1| Influenza A virus (A/baikal teal/Korea/1454/2014(H5N8)) segment 4 hemagglutinin (HA) gene, complete cds 2978 2978 100% 0.0 99% KJ756627.1
Select seq gb|KJ508980.1| Influenza A virus (A/Baikal teal/Korea/H62/2014(H5N8)) segment 4 hemagglutinin (HA) gene, complete cds 2978 2978 100% 0.0 99% KJ508980.1
Select seq gb|KJ509020.1| Influenza A virus (A/Coot/Korea/H81/2014(H5N8)) segment 4 hemagglutinin (HA) gene, complete cds 2978 2978 100% 0.0 99% KJ509020.1
Select seq gb|KJ509156.1| Influenza A virus (A/common teal/Korea/H455-30/2014(H5N8)) segment 4 hemagglutinin (HA) gene, complete cds 2978 2978 100% 0.0 99% KJ509156.1
Select seq gb|KJ413850.1| Influenza A virus (A/baikal teal/Korea/Donglim3/2014(H5N8)) segment 4 hemagglutinin (HA) gene, complete cds 2978 2978 100% 0.0 99% KJ413850.1
Select seq gb|KJ756620.1| Influenza A virus (A/baikal teal/Korea/1441/2014(H5N8)) segment 4 hemagglutinin (HA) gene, complete cds 2975 2975 100% 0.0 99% KJ756620.1
Select seq gb|KJ508916.1| Influenza A virus (A/broiler duck/Korea/H32/2014(H5N8)) segment 4 hemagglutinin (HA) gene, complete cds 2975 2975 100% 0.0 99% KJ508916.1
Select seq gb|KJ509084.1| Influenza A virus (A/breeder duck/Korea/H200/2014(H5N8)) segment 4 hemagglutinin (HA) gene, complete cds 2969 2969 100% 0.0 99% KJ509084.1
Select seq gb|KJ746111.1| Influenza A virus (A/mallard/Korea/W452/2014(H5N8)) segment 4 hemagglutinin (HA) gene, complete cds 2966 2966 100% 0.0 99% KJ746111.1
Select seq gb|KR232364.1| Influenza A virus (A/eurasian wigeon/Netherlands/1/2015(H5N8)) segment 4 hemagglutinin (HA) gene, partial cds 2899 2899 99% 0.0 98% KR232364.1
Select seq gb|KR233690.1| Influenza A virus (A/chicken/Netherlands/emc-3/2014(H5N8)) segment 4 hemagglutinin (HA) gene, partial cds 2893 2893 98% 0.0 98% KR233690.1
Select seq gb|KR233682.1| Influenza A virus (A/eurasian wigeon/Netherlands/2/2014(H5N8)) segment 4 hemagglutinin (HA) gene, partial cds 2892 2892 99% 0.0 98% KR233682.1
Select seq gb|KR233674.1| Influenza A virus (A/eurasian wigeon/Netherlands/1/2014(H5N8)) segment 4 hemagglutinin (HA) gene, partial cds 2854 2854 96% 0.0 98% KR233674.1
Select seq gb|KP735806.1| Influenza A virus (A/goose/Shandong/k1201/2009(H5N1)) segment 4 hemagglutinin (HA) gene, complete cds 2803 2803 100% 0.0 96% KP735806.1
Select seq gb|JQ973694.1| Influenza A virus (A/duck/Jiangsu/k1203/2010(H5N8)) segment 4 hemagglutinin (HA) gene, complete cds 2803 2803 100% 0.0 96% JQ973694.1
Select seq gb|JX534565.1| Influenza A virus (A/wild duck/Shandong/628/2011(H5N1)) segment 4 hemagglutinin (HA) gene, complete cds 2798 2798 100% 0.0 96% JX534565.1
Select seq gb|JX507355.1| Influenza A virus (A/duck/Jiangsu/m234/2012(H5N2)) segment 4 hemagglutinin (HA) gene, complete cds 2767 2767 100% 0.0 96% JX507355.1
Select seq gb|JQ041402.1| Influenza A virus (A/goose/Eastern China/1112/2011(H5N2)) segment 4 hemagglutinin (HA) gene, complete cds 2762 2762 100% 0.0 96% JQ041402.1
Select seq gb|KT383486.1| Influenza A virus (A/duck/Guangdong/s14044/2014(H5N8)) segment 4 hemagglutinin (HA) gene, complete cds 2753 2753 100% 0.0 96% KT383486.1
Select seq gb|KP286109.1| Influenza A virus (A/chicken/Dongguan/3363/2013(H5N6)) segment 4 hemagglutinin (HA) gene, complete cds 2749 2749 100% 0.0 96% KP286109.1
Select seq gb|KP286101.1| Influenza A virus (A/chicken/Dongguan/2690/2013(H5N6)) segment 4 hemagglutinin (HA) gene, complete cds 2749 2749 100% 0.0 96% KP286101.1
Select seq gb|JQ041401.1| Influenza A virus (A/duck/Eastern China/1111/2011(H5N2)) segment 4 hemagglutinin (HA) gene, complete cds 2749 2749 100% 0.0 96% JQ041401.1
Select seq gb|KP286563.1| Influenza A virus (A/chicken/Dongguan/4190/2013(mixed)) clone b segment 4 hemagglutinin (HA) gene, complete cds 2746 2746 100% 0.0 96% KP286563.1
Select seq gb|KT370058.1| Influenza A virus (A/environment/Guangdong/QY208/2014(H5N6)) segment 4 hemagglutinin (HA) gene, complete cds 2744 2744 100% 0.0 96% KT370058.1
Select seq gb|KP285317.1| Influenza A virus (A/goose/Shantou/1763/2014(H5N6)) segment 4 hemagglutinin (HA) gene, complete cds 2744 2744 100% 0.0 96% KP285317.1
Select seq gb|KP285021.1| Influenza A virus (A/duck/Dongguan/3069/2013(H5N6)) segment 4 hemagglutinin (HA) gene, complete cds 2744 2744 100% 0.0 96% KP285021.1
Select seq gb|KP284973.1| Influenza A virus (A/chicken/Shenzhen/1395/2013(H5N6)) segment 4 hemagglutinin (HA) gene, complete cds 2744 2744 100% 0.0 96% KP284973.1
Select seq gb|KU143271.1| Influenza A virus (A/duck/Taizhou/TZYG12/2015(H5N6)) segment 4 hemagglutinin (HA) gene, complete cds 2740 2740 100% 0.0 96% KU143271.1
Select seq gb|KT221074.1| Influenza A virus (A/goose/Shandong/WFSG1/2014(H5N8)) segment 4 hemagglutinin (HA) gene, complete cds 2740 2740 100% 0.0 96% KT221074.1
Select seq gb|KU042758.1| Influenza A virus (A/goose/Zhejiang/925036/2014(H5N6)) segment 4 hemagglutinin (HA) gene, complete cds 2740 2740 100% 0.0 96% KU042758.1
Select seq gb|KU042766.1| Influenza A virus (A/chicken/Zhejiang/727155/2014(H5N6)) segment 4 hemagglutinin (HA) gene, complete cds 2740 2740 100% 0.0 96% KU042766.1
Select seq gb|KT370060.1| Influenza A virus (A/environment/Guangdong/QY197/2014(H5N6)) segment 4 hemagglutinin (HA) gene, complete cds 2740 2740 100% 0.0 96% KT370060.1
Select seq gb|KP286085.1| Influenza A virus (A/chicken/Shenzhen/1061/2013(H5N6)) segment 4 hemagglutinin (HA) gene, complete cds 2740 2740 100% 0.0 96% KP286085.1
Select seq gb|KP285029.1| Influenza A virus (A/chicken/Dongguan/4259/2013(H5N6)) segment 4 hemagglutinin (HA) gene, complete cds 2740 2740 100% 0.0 96% KP285029.1
Select seq gb|KP285013.1| Influenza A virus (A/silkie chicken/Dongguan/2809/2013(H5N6)) segment 4 hemagglutinin (HA) gene, complete cds 2740 2740 100% 0.0 96% KP285013.1
Select seq gb|KP285005.1| Influenza A virus (A/duck/Dongguan/2685/2013(H5N6)) segment 4 hemagglutinin (HA) gene, complete cds 2740 2740 100% 0.0 96% KP285005.1
Select seq gb|KP284965.1| Influenza A virus (A/chicken/Shenzhen/552/2013(H5N6)) segment 4 hemagglutinin (HA) gene, complete cds 2740 2740 100% 0.0 96% KP284965.1
Select seq gb|KM504101.1| Influenza A virus (A/duck/Shandong/Q1/2013(H5N8)) segment 4 hemagglutinin (HA) gene, complete cds 2740 2740 100% 0.0 96% KM504101.1
Select seq gb|KJ754145.1| Influenza A virus (A/duck/Guangdong/GD01/2014(H5N6)) segment 4 hemagglutinin (HA) gene, complete cds 2740 2740 100% 0.0 96% KJ754145.1
Select seq gb|KJ413834.1| Influenza A virus (A/breeder duck/Korea/Gochang1/2014(H5N8)) segment 4 hemagglutinin (HA) gene, complete cds 2740 2740 100% 0.0 96% KJ413834.1
Select seq gb|KU042754.1| Influenza A virus (A/chicken/Zhejiang/727159/2014(H5N2)) segment 4 hemagglutinin (HA) gene, complete cds 2735 2735 100% 0.0 96% KU042754.1
Select seq gb|KU042753.1| Influenza A virus (A/chicken/Zhejiang/727079/2014(H5N2)) segment 4 hemagglutinin (HA) gene, complete cds 2735 2735 100% 0.0 96% KU042753.1
Select seq gb|KU042764.1| Influenza A virus (A/chicken/Zhejiang/727022/2014(H5N6)) segment 4 hemagglutinin (HA) gene, complete cds 2735 2735 100% 0.0 96% KU042764.1
Select seq gb|KU042765.1| Influenza A virus (A/chicken/Zhejiang/727026/2014(H5N6)) segment 4 hemagglutinin (HA) gene, complete cds 2735 2735 100% 0.0 96% KU042765.1
Select seq gb|KP417067.1| Influenza A virus (A/duck/Jiangxi/23970/2013(mixed)) clone a segment 4 hemagglutinin (HA) gene, complete cds 2735 2735 100% 0.0 96% KP417067.1
Select seq gb|KP284989.1| Influenza A virus (A/chicken/Shenzhen/2396/2013(H5N6)) segment 4 hemagglutinin (HA) gene, complete cds 2735 2735 100% 0.0 96% KP284989.1
Select seq gb|KP284957.1| Influenza A virus (A/chicken/Shenzhen/433/2013(H5N6)) segment 4 hemagglutinin (HA) gene, complete cds 2735 2735 100% 0.0 96% KP284957.1
Select seq gb|KT313418.1| Influenza A virus (A/swine/Guangdong/1/2014(H5N6)) segment 4 hemagglutinin (HA) gene, complete cds 2733 2733 99% 0.0 96% KT313418.1
Select seq gb|KT221066.1| Influenza A virus (A/goose/Jiangsu/QD5/2014(H5N8)) segment 4 hemagglutinin (HA) gene, complete cds 2731 2731 100% 0.0 96% KT221066.1
Select seq gb|KU042756.1| Influenza A virus (A/goose/Zhejiang/727092/2014(H5N6)) segment 4 hemagglutinin (HA) gene, complete cds 2731 2731 100% 0.0 96% KU042756.1
Select seq gb|KU042757.1| Influenza A virus (A/goose/Zhejiang/727110/2014(H5N6)) segment 4 hemagglutinin (HA) gene, complete cds 2731 2731 100% 0.0 96% KU042757.1
Select seq gb|KU042769.1| Influenza A virus (A/goose/Zhejiang/925037/2014(H5N8)) segment 4 hemagglutinin (HA) gene, complete cds 2731 2731 100% 0.0 96% KU042769.1
Select seq gb|KU042770.1| Influenza A virus (A/goose/Zhejiang/925104/2014(H5N8)) segment 4 hemagglutinin (HA) gene, complete cds 2731 2731 100% 0.0 96% KU042770.1
Select seq gb|KP286666.1| Influenza A virus (A/chicken/Dongguan/1100/2014(mixed)) clone b segment 4 hemagglutinin (HA) gene, complete cds 2731 2731 100% 0.0 96% KP286666.1
Select seq gb|KP286548.1| Influenza A virus (A/chicken/Shenzhen/2072/2013(mixed)) clone b segment 4 hemagglutinin (HA) gene, complete cds 2731 2731 100% 0.0 96% KP286548.1
Select seq gb|KP286093.1| Influenza A virus (A/chicken/Shenzhen/2269/2013(H5N6)) segment 4 hemagglutinin (HA) gene, complete cds 2731 2731 100% 0.0 96% KP286093.1
Select seq gb|KP090447.1| Influenza A virus (A/chicken/Jiangxi/NCDZT1126/2014(H5N6)) segment 4 hemagglutinin (HA) gene, complete cds 2731 2731 100% 0.0 96% KP090447.1
Select seq gb|KJ508961.1| Influenza A virus (A/Baikal teal/Korea/H52/2014(H5N8)) segment 4 hemagglutinin (HA) gene, complete cds 2731 2731 100% 0.0 96% KJ508961.1
Select seq gb|KJ476669.1| Influenza A virus (A/duck/Zhejiang/W24/2013(H5N8)) segment 4 hemagglutinin (HA) gene,complete cds 2731 2731 100% 0.0 96% KJ476669.1
Select seq gb|KT313410.1| Influenza A virus (A/swine/Guangdong/2/2014(H5N6)) segment 4 hemagglutinin (HA) gene, complete cds 2729 2729 99% 0.0 96% KT313410.1
Select seq gb|KT221082.1| Influenza A virus (A/goose/Yangzhou/0420/2014(H5N8)) segment 4 hemagglutinin (HA) gene, complete cds 2726 2726 100% 0.0 95% KT221082.1
Select seq gb|KU042755.1| Influenza A virus (A/duck/Zhejiang/727158/2014(H5N6)) segment 4 hemagglutinin (HA) gene, complete cds 2726 2726 100% 0.0 95% KU042755.1
Select seq gb|KP090439.1| Influenza A virus (A/chicken/Jiangxi/NCDZT1123/2014(H5N6)) segment 4 hemagglutinin (HA) gene, complete cds 2726 2726 100% 0.0 95% KP090439.1
Select seq gb|KJ476657.1| Influenza A virus (A/mallard/Shanghai/SH-9/2013(H5N8)) segment 4 hemagglutinin (HA) gene, complete cds 2726 2726 100% 0.0 95% KJ476657.1
Select seq gb|KT370061.1| Influenza A virus (A/environment/Guangdong/ZS356/2014(H5N6)) segment 4 hemagglutinin (HA) gene, complete cds 2722 2722 100% 0.0 95% KT370061.1
Select seq gb|KP765788.1| Influenza A virus (A/Guangzhou/39715/2014(H5N6)) segment 4 hemagglutinin (HA) gene, complete cds 2722 2722 100% 0.0 95% KP765788.1
Select seq gb|KP765796.1| Influenza A virus (A/duck/Guangzhou/41227/2014(H5N6)) segment 4 hemagglutinin (HA) gene, complete cds 2722 2722 100% 0.0 95% KP765796.1
Select seq gb|KP414809.1| Influenza A virus (A/duck/Shaoxing/5240/2013(mixed)) clone a segment 4 hemagglutinin (HA) gene, complete cds 2722 2722 100% 0.0 95% KP414809.1
Select seq gb|KP286574.1| Influenza A virus (A/duck/Ningbo/3262/2013(mixed)) segment 4 hemagglutinin (HA) gene, complete cds 2722 2722 100% 0.0 95% KP286574.1
Select seq gb|KU143262.1| Influenza A virus (A/turtledove/Wuhan/WHBJ28/2014(H5N6)) segment 4 hemagglutinin (HA) gene, complete cds 2717 2717 100% 0.0 95% KU143262.1
Select seq gb|KU143263.1| Influenza A virus (A/turtledove/Wuhan/HKBJ27/2015(H5N6)) segment 4 hemagglutinin (HA) gene, complete cds 2717 2717 100% 0.0 95% KU143263.1
Select seq gb|KU143264.1| Influenza A virus (A/turtledove/Wuhan/HKBJ43/2015(H5N6)) segment 4 hemagglutinin (HA) gene, complete cds 2717 2717 100% 0.0 95% KU143264.1
Select seq gb|KU143269.1| Influenza A virus (A/duck/Wenzhou/YHQL22/2014(H5N6)) segment 4 hemagglutinin (HA) gene, complete cds 2717 2717 100% 0.0 95% KU143269.1
Select seq gb|KU143272.1| Influenza A virus (A/turtledove/Wuhan/WHBJ26/2014(H5N6)) segment 4 hemagglutinin (HA) gene, complete cds 2717 2717 100% 0.0 95% KU143272.1
Select seq gb|KU143273.1| Influenza A virus (A/turtledove/Wuhan/HKBJ07/2015(H5N6)) segment 4 hemagglutinin (HA) gene, complete cds 2717 2717 100% 0.0 95% KU143273.1
Select seq gb|KT370062.1| Influenza A virus (A/environment/Guangdong/PY955/2014(H5N6)) segment 4 hemagglutinin (HA) gene, complete cds 2717 2717 100% 0.0 95% KT370062.1
Select seq gb|KJ476670.1| Influenza A virus (A/duck/Zhejiang/6D18/2013(H5N8)) segment 4 hemagglutinin (HA) gene,complete cds 2717 2717 100% 0.0 95% KJ476670.1
Select seq gb|KU143261.1| Influenza A virus (A/turtledove/Wuhan/WHBJ12/2014(H5N6)) segment 4 hemagglutinin (HA) gene, complete cds 2713 2713 100% 0.0 95% KU143261.1
Select seq gb|KU143265.1| Influenza A virus (A/duck/Wuhan/WHYF02/2015(H5N6)) segment 4 hemagglutinin (HA) gene, complete cds 2713 2713 100% 0.0 95% KU143265.1
Select seq gb|KU143266.1| Influenza A virus (A/duck/Wuhan/WHYF03/2015(H5N6)) segment 4 hemagglutinin (HA) gene, complete cds 2713 2713 100% 0.0 95% KU143266.1
Select seq gb|KU143270.1| Influenza A virus (A/duck/Wuhan/JXYFB22/2015(H5N6)) segment 4 hemagglutinin (HA) gene, complete cds 2713 2713 100% 0.0 95% KU143270.1
Select seq gb|KU042749.1| Influenza A virus (A/duck/Zhejiang/727041/2014(H5N2)) segment 4 hemagglutinin (HA) gene, complete cds 2713 2713 100% 0.0 95% KU042749.1
Select seq gb|KU042760.1| Influenza A virus (A/goose/Zhejiang/925106/2014(H5N6)) segment 4 hemagglutinin (HA) gene, complete cds 2713 2713 100% 0.0 95% KU042760.1
Select seq gb|KT370063.1| Influenza A virus (A/environment/Guangdong/HY243/2015(H5N6)) segment 4 hemagglutinin (HA) gene, complete cds 2713 2713 100% 0.0 95% KT370063.1
Select seq gb|KT370059.1| Influenza A virus (A/environment/Guangdong/QY025/2013(H5N6)) segment 4 hemagglutinin (HA) gene, complete cds 2713 2713 100% 0.0 95% KT370059.1
Select seq gb|KM392383.1| Influenza A virus (A/chicken/Tonghai/802/2014(H5N1)) segment 4 hemagglutinin (HA) gene, complete cds 2713 2713 100% 0.0 95% KM392383.1
Select seq gb|KM392382.1| Influenza A virus (A/chicken/Tonghai/5/2014(H5N1)) segment 4 hemagglutinin (HA) gene, complete cds 2713 2713 100% 0.0 95% KM392382.1
Select seq gb|KM392381.1| Influenza A virus (A/chicken/Tonghai/3/2014(H5N1)) segment 4 hemagglutinin (HA) gene, complete cds 2713 2713 100% 0.0 95% KM392381.1
Select seq gb|KM392376.1| Influenza A virus (A/chicken/AnNing/1/2014(H5N1)) segment 4 hemagglutinin (HA) gene, complete cds 2713 2713 100% 0.0 95% KM392376.1
Select seq gb|KP732547.1| Influenza A virus (A/chicken/TongHai/302/2014(H5N1)) segment 4 hemagglutinin (HA) gene, complete cds 2713 2713 100% 0.0 95% KP732547.1
Select seq gb|KM496970.1| Influenza A virus (A/duck/Laos/LPQ002/2014(H5N6)) segment 4 hemagglutinin (HA) gene, complete cds 2713 2713 100% 0.0 95% KM496970.1
Select seq gb|CY091635.1| Influenza A virus (A/duck/Guangdong/wy19/2008(H5N5)) hemagglutinin (HA) gene, complete cds 2713 2713 100% 0.0 95% CY091635.1
Select seq gb|KU042750.1| Influenza A virus (A/goose/Zhejiang/77166/2014(H5N2)) segment 4 hemagglutinin (HA) gene, complete cds 2709 2709 99% 0.0 95% KU042750.1
Select seq gb|KM496965.1| Influenza A virus (A/chicken/Laos/LPQ001/2014(H5N6)) segment 4 hemagglutinin (HA) gene, complete cds 2708 2708 100% 0.0 95% KM496965.1
Select seq dbj|LC028331.1| Influenza A virus (A/duck/Vietnam/LBM758/2014(H5N6)) viral cRNA, segment: 4, complete sequence 2706 2706 100% 0.0 95% LC028331.1
Select seq gb|KU143267.1| Influenza A virus (A/chicken/Wuhan/WHYJ01/2015(H5N6)) segment 4 hemagglutinin (HA) gene, complete cds 2704 2704 100% 0.0 95% KU143267.1
Select seq gb|KU143268.1| Influenza A virus (A/chicken/Wuhan/WHYJ02/2015(H5N6)) segment 4 hemagglutinin (HA) gene, complete cds 2704 2704 100% 0.0 95% KU143268.1
Select seq gb|KM392378.1| Influenza A virus (A/chicken/AnNing/6/2014(H5N1)) segment 4 hemagglutinin (HA) gene, complete cds 2704 2704 100% 0.0 95% KM392378.1
Select seq dbj|LC028307.1| Influenza A virus (A/muscovy duck/Vietnam/LBM755/2014(H5N6)) viral cRNA, segment: 4, complete sequence 2704 2704 100% 0.0 95% LC028307.1
Select seq dbj|LC028200.1| Influenza A virus (A/duck/Vietnam/LBM752/2014(H5N6)) viral cRNA, segment: 4, complete sequence 2704 2704 100% 0.0 95% LC028200.1
Select seq dbj|LC028192.1| Influenza A virus (A/duck/Vietnam/LBM751/2014(H5N6)) viral cRNA, segment: 4, complete sequence 2704 2704 100% 0.0 95% LC028192.1
Select seq gb|KC631941.1| Influenza A virus (A/chicken/China/AH/2012(H5N1)) segment 4 hemagglutinin (HA) gene, complete cds 2704 2704 100% 0.0 95% KC631941.1
Select seq gb|KU042768.1| Influenza A virus (A/duck/Zhejiang/925169/2014(H5N8)) segment 4 hemagglutinin (HA) gene, complete cds 2699 2699 100% 0.0 95% KU042768.1
Select seq dbj|LC028347.1| Influenza A virus (A/duck/Vietnam/LBM760/2014(H5N6)) viral cRNA, segment: 4, complete sequence 2699 2699 100% 0.0 95% LC028347.1

Author:  niman [ Sun Dec 27, 2015 12:02 pm ]
Post subject:  Re: Fujian H5N8 In Klamath Co OR With Wild Bird PB1 & PA

Select seq gb|KU201754.1| Influenza A virus (A/American wigeon/Oregon/AH0012525/2015(H5N8)) segment 6 neuraminidase (NA) gene, complete cds 2536 2536 100% 0.0 100% KU201754.1
Select seq gb|KU201746.1| Influenza A virus (A/Canada goose/Oregon/AH0012452/2015(H5N8)) segment 6 neuraminidase (NA) gene, complete cds 2527 2527 100% 0.0 99% KU201746.1
Select seq gb|KR150903.1| Influenza A virus (A/turkey/California/K1500169-1.2/2015(H5N8)) segment 6 neuraminidase (NA) gene, complete cds 2522 2522 100% 0.0 99% KR150903.1
Select seq gb|KP739415.1| Influenza A virus (A/guinea fowl/Oregon/41613-1/2014(H5N8)) segment 6 neuraminidase (NA) gene, complete cds 2504 2504 100% 0.0 99% KP739415.1
Select seq gb|KU201618.1| Influenza A virus (A/American wigeon/Utah/AH0007824/2015(H5N8)) segment 6 neuraminidase (NA) gene, complete cds 2500 2500 100% 0.0 99% KU201618.1
Select seq gb|KU201770.1| Influenza A virus (A/mallard/Idaho/AH0005954/2014(H5N8)) segment 6 neuraminidase (NA) gene, complete cds 2500 2500 100% 0.0 99% KU201770.1
Select seq gb|KU201778.1| Influenza A virus (A/mallard/Idaho/AH0005955/2014(H5N8)) segment 6 neuraminidase (NA) gene, complete cds 2500 2500 100% 0.0 99% KU201778.1
Select seq gb|KU201890.1| Influenza A virus (A/American wigeon/Washington/195205/2014(H5N8)) segment 6 neuraminidase (NA) gene, complete cds 2500 2500 100% 0.0 99% KU201890.1
Select seq gb|KU201906.1| Influenza A virus (A/peregrine falcon/Washington/196426/2014(H5N8)) segment 6 neuraminidase (NA) gene, complete cds 2500 2500 100% 0.0 99% KU201906.1
Select seq gb|KU201690.1| Influenza A virus (A/mallard/Idaho/AH0008597/2015(H5N8)) segment 6 neuraminidase (NA) gene, complete cds 2495 2495 100% 0.0 99% KU201690.1
Select seq gb|KU201762.1| Influenza A virus (A/mallard/Nevada/AH0006855/2015(H5N8)) segment 6 neuraminidase (NA) gene, complete cds 2495 2495 100% 0.0 99% KU201762.1
Select seq gb|KU201842.1| Influenza A virus (A/Northern pintail/Washington/196271/2014(H5N8)) segment 6 neuraminidase (NA) gene, complete cds 2495 2495 100% 0.0 99% KU201842.1
Select seq gb|KU201874.1| Influenza A virus (A/mallard/Oregon/195536/2014(H5N8)) segment 6 neuraminidase (NA) gene, complete cds 2495 2495 100% 0.0 99% KU201874.1
Select seq gb|KU201882.1| Influenza A virus (A/American American wigeon/Washington/195198/2014(H5N8)) segment 6 neuraminidase (NA) gene, complete cds 2495 2495 100% 0.0 99% KU201882.1
Select seq gb|KP307986.1| Influenza A virus (A/gyrfalcon/Washington/41088-6/2014(H5N8)) segment 6 neuraminidase (NA) gene, complete cds 2495 2495 100% 0.0 99% KP307986.1
Select seq gb|KU201826.1| Influenza A virus (A/American wigeon/Washington/195968/2014(H5N8)) segment 6 neuraminidase (NA) gene, complete cds 2491 2491 100% 0.0 99% KU201826.1
Select seq gb|KU201794.1| Influenza A virus (A/chicken/California/15-004912/2015(H5N8)) segment 6 neuraminidase (NA) gene, complete cds 2486 2486 100% 0.0 99% KU201794.1
Select seq gb|KU201802.1| Influenza A virus (A/bald eagle/Idaho/15-002892-2/2015(H5N8)) segment 6 neuraminidase (NA) gene, complete cds 2486 2486 100% 0.0 99% KU201802.1
Select seq gb|KJ509006.1| Influenza A virus (A/Baikal teal/Korea/H68/2014(H5N8)) segment 6 neuraminidase (NA) gene, complete cds 2486 2486 100% 0.0 99% KJ509006.1
Select seq gb|KJ756658.1| Influenza A virus (A/baikal teal/Korea/1441/2014(H5N8)) segment 6 neuraminidase (NA) gene, complete cds 2482 2482 100% 0.0 99% KJ756658.1
Select seq gb|KJ756657.1| Influenza A virus (A/baikal teal/Korea/1437/2014(H5N8)) segment 6 neuraminidase (NA) gene, complete cds 2482 2482 100% 0.0 99% KJ756657.1
Select seq gb|KJ509142.1| Influenza A virus (A/bean goose/Korea/H328/2014(H5N8)) segment 6 neuraminidase (NA) gene, complete cds 2482 2482 100% 0.0 99% KJ509142.1
Select seq gb|KJ413852.1| Influenza A virus (A/baikal teal/Korea/Donglim3/2014(H5N8)) segment 6 neuraminidase (NA) gene, complete cds 2482 2482 100% 0.0 99% KJ413852.1
Select seq gb|KJ756669.1| Influenza A virus (A/baikal teal/Korea/2399/2014(H5N8)) segment 6 neuraminidase (NA) gene, complete cds 2477 2477 100% 0.0 99% KJ756669.1
Select seq gb|KJ756667.1| Influenza A virus (A/baikal teal/Korea/1457/2014(H5N8)) segment 6 neuraminidase (NA) gene, complete cds 2477 2477 100% 0.0 99% KJ756667.1
Select seq gb|KJ756664.1| Influenza A virus (A/baikal teal/Korea/1452/2014(H5N8)) segment 6 neuraminidase (NA) gene, complete cds 2477 2477 100% 0.0 99% KJ756664.1
Select seq gb|KJ508926.1| Influenza A virus (A/bean goose/Korea/H40/2014(H5N8)) segment 6 neuraminidase (NA) gene, complete cds 2477 2477 100% 0.0 99% KJ508926.1
Select seq gb|KJ508982.1| Influenza A virus (A/Baikal teal/Korea/H62/2014(H5N8)) segment 6 neuraminidase (NA) gene, complete cds 2477 2477 100% 0.0 99% KJ508982.1
Select seq gb|KJ508990.1| Influenza A virus (A/broiler duck/Korea/H65/2014(H5N8)) segment 6 neuraminidase (NA) gene, complete cds 2477 2477 100% 0.0 99% KJ508990.1
Select seq gb|KJ508998.1| Influenza A virus (A/Baikal teal/Korea/H66/2014(H5N8)) segment 6 neuraminidase (NA) gene, complete cds 2477 2477 100% 0.0 99% KJ508998.1
Select seq gb|KJ509022.1| Influenza A virus (A/Coot/Korea/H81/2014(H5N8)) segment 6 neuraminidase (NA) gene, complete cds 2477 2477 100% 0.0 99% KJ509022.1
Select seq gb|KJ509030.1| Influenza A virus (A/Baikal teal/Korea/H84/2014(H5N8)) segment 6 neuraminidase (NA) gene, complete cds 2477 2477 100% 0.0 99% KJ509030.1
Select seq gb|KJ509038.1| Influenza A virus (A/Baikal teal/Korea/H96/2014(H5N8)) segment 6 neuraminidase (NA) gene, complete cds 2477 2477 100% 0.0 99% KJ509038.1
Select seq gb|KJ509062.1| Influenza A virus (A/broiler duck/Korea/H133/2014(H5N8)) segment 6 neuraminidase (NA) gene, complete cds 2477 2477 100% 0.0 99% KJ509062.1
Select seq gb|KJ509070.1| Influenza A virus (A/broiler duck/Korea/H145/2014(H5N8)) segment 6 neuraminidase (NA) gene, complete cds 2477 2477 100% 0.0 99% KJ509070.1
Select seq gb|KJ509134.1| Influenza A virus (A/mallard/Korea/H297/2014(H5N8)) segment 6 neuraminidase (NA) gene, complete cds 2477 2477 100% 0.0 99% KJ509134.1
Select seq gb|KJ509150.1| Influenza A virus (A/tundra swan/Korea/H411/2014(H5N8)) segment 6 neuraminidase (NA) gene, complete cds 2477 2477 100% 0.0 99% KJ509150.1
Select seq gb|KJ509166.1| Influenza A virus (A/spot-billed duck/Korea/H455-42/2014(H5N8)) segment 6 neuraminidase (NA) gene, complete cds 2477 2477 100% 0.0 99% KJ509166.1
Select seq gb|KJ756673.1| Influenza A virus (A/baikal teal/Korea/2414/2014(H5N8)) segment 6 neuraminidase (NA) gene, complete cds 2473 2473 100% 0.0 99% KJ756673.1
Select seq gb|KJ756663.1| Influenza A virus (A/baikal teal/Korea/1449/2014(H5N8)) segment 6 neuraminidase (NA) gene, complete cds 2473 2473 100% 0.0 99% KJ756663.1
Select seq gb|KJ756660.1| Influenza A virus (A/baikal teal/Korea/1446/2014(H5N8)) segment 6 neuraminidase (NA) gene, complete cds 2473 2473 100% 0.0 99% KJ756660.1
Select seq gb|KJ509158.1| Influenza A virus (A/common teal/Korea/H455-30/2014(H5N8)) segment 6 neuraminidase (NA) gene, complete cds 2473 2473 100% 0.0 99% KJ509158.1
Select seq gb|KJ746113.1| Influenza A virus (A/mallard/Korea/W452/2014(H5N8)) segment 6 neuraminidase (NA) gene, complete cds 2473 2473 100% 0.0 99% KJ746113.1
Select seq gb|KJ511814.1| Influenza A virus (A/waterfowl/Korea/S005/2014(H5N8)) segment 6 neuraminidase (NA) gene, complete cds 2473 2473 100% 0.0 99% KJ511814.1
Select seq dbj|AB932558.1| Influenza A virus (A/chicken/kumamoto/1-7/2014(H5N8)) NA gene for neuraminidase, complete cds 2468 2468 100% 0.0 99% AB932558.1
Select seq gb|KT388574.1| Influenza A virus (A/goose/Taiwan/TNO3/2015(H5N8)) segment 6 cRNA sequence 2459 2459 100% 0.0 99% KT388574.1
Select seq gb|KT388710.1| Influenza A virus (A/goose/Taiwan/TNO20/2015(H5N8)) segment 6 cRNA sequence 2455 2455 100% 0.0 99% KT388710.1
Select seq gb|KT388678.1| Influenza A virus (A/goose/Taiwan/TNO16/2015(H5N8)) segment 6 cRNA sequence 2455 2455 100% 0.0 99% KT388678.1
Select seq gb|KT388670.1| Influenza A virus (A/goose/Taiwan/TNO15/2015(H5N8)) segment 6 cRNA sequence 2455 2455 100% 0.0 99% KT388670.1
Select seq gb|KT388622.1| Influenza A virus (A/goose/Taiwan/TNO9/2015(H5N8)) segment 6 cRNA sequence 2455 2455 100% 0.0 99% KT388622.1
Select seq gb|KT388598.1| Influenza A virus (A/goose/Taiwan/TNO6/2015(H5N8)) segment 6 cRNA sequence 2455 2455 100% 0.0 99% KT388598.1
Select seq gb|KT388582.1| Influenza A virus (A/goose/Taiwan/TNO4/2015(H5N8)) segment 6 cRNA sequence 2455 2455 100% 0.0 99% KT388582.1
Select seq gb|KT388566.1| Influenza A virus (A/goose/Taiwan/TNO2/2015(H5N8)) segment 6 cRNA sequence 2455 2455 100% 0.0 99% KT388566.1
Select seq gb|KT388526.1| Influenza A virus (A/goose/Taiwan/TNC11/2015(H5N8)) segment 6 cRNA sequence 2455 2455 100% 0.0 99% KT388526.1
Select seq gb|KT388478.1| Influenza A virus (A/goose/Taiwan/TNC5/2015(H5N8)) segment 6 cRNA sequence 2455 2455 100% 0.0 99% KT388478.1
Select seq gb|KT388470.1| Influenza A virus (A/goose/Taiwan/TNC4/2015(H5N8)) segment 6 cRNA sequence 2455 2455 100% 0.0 99% KT388470.1
Select seq gb|KT388662.1| Influenza A virus (A/goose/Taiwan/TNO14/2015(H5N8)) segment 6 cRNA sequence 2450 2450 100% 0.0 99% KT388662.1
Select seq gb|KT388630.1| Influenza A virus (A/goose/Taiwan/TNO10/2015(H5N8)) segment 6 cRNA sequence 2450 2450 100% 0.0 99% KT388630.1
Select seq gb|KT388606.1| Influenza A virus (A/goose/Taiwan/TNO7/2015(H5N8)) segment 6 cRNA sequence 2450 2450 100% 0.0 99% KT388606.1
Select seq gb|KT388542.1| Influenza A virus (A/goose/Taiwan/TNC13/2015(H5N8)) segment 6 cRNA sequence 2450 2450 100% 0.0 99% KT388542.1
Select seq gb|KT388510.1| Influenza A virus (A/goose/Taiwan/TNC9/2015(H5N8)) segment 6 cRNA sequence 2450 2450 100% 0.0 99% KT388510.1
Select seq gb|KT388462.1| Influenza A virus (A/goose/Taiwan/TNC3/2015(H5N8)) segment 6 cRNA sequence 2450 2450 100% 0.0 99% KT388462.1
Select seq gb|KT388702.1| Influenza A virus (A/goose/Taiwan/TNO19/2015(H5N8)) segment 6 cRNA sequence 2446 2446 100% 0.0 99% KT388702.1
Select seq gb|KT388686.1| Influenza A virus (A/goose/Taiwan/TNO17/2015(H5N8)) segment 6 cRNA sequence 2446 2446 100% 0.0 99% KT388686.1
Select seq gb|KT388654.1| Influenza A virus (A/goose/Taiwan/TNO13/2015(H5N8)) segment 6 cRNA sequence 2446 2446 100% 0.0 99% KT388654.1
Select seq gb|KT388646.1| Influenza A virus (A/goose/Taiwan/TNO12/2015(H5N8)) segment 6 cRNA sequence 2446 2446 100% 0.0 99% KT388646.1
Select seq gb|KT388638.1| Influenza A virus (A/goose/Taiwan/TNO11/2015(H5N8)) segment 6 cRNA sequence 2446 2446 100% 0.0 99% KT388638.1
Select seq gb|KT388614.1| Influenza A virus (A/goose/Taiwan/TNO8/2015(H5N8)) segment 6 cRNA sequence 2446 2446 100% 0.0 99% KT388614.1
Select seq gb|KT388558.1| Influenza A virus (A/goose/Taiwan/TNO1/2015(H5N8)) segment 6 cRNA sequence 2446 2446 100% 0.0 99% KT388558.1
Select seq gb|KT388534.1| Influenza A virus (A/goose/Taiwan/TNC12/2015(H5N8)) segment 6 cRNA sequence 2446 2446 100% 0.0 99% KT388534.1
Select seq gb|KT388518.1| Influenza A virus (A/goose/Taiwan/TNC10/2015(H5N8)) segment 6 cRNA sequence 2446 2446 100% 0.0 99% KT388518.1
Select seq gb|KT388502.1| Influenza A virus (A/goose/Taiwan/TNC8/2015(H5N8)) segment 6 cRNA sequence 2446 2446 100% 0.0 99% KT388502.1
Select seq gb|KT388494.1| Influenza A virus (A/goose/Taiwan/TNC7/2015(H5N8)) segment 6 cRNA sequence 2446 2446 100% 0.0 99% KT388494.1
Select seq gb|KT388486.1| Influenza A virus (A/goose/Taiwan/TNC6/2015(H5N8)) segment 6 cRNA sequence 2446 2446 100% 0.0 99% KT388486.1
Select seq gb|KT388454.1| Influenza A virus (A/goose/Taiwan/TNC2/2015(H5N8)) segment 6 cRNA sequence 2446 2446 100% 0.0 99% KT388454.1
Select seq gb|KT388446.1| Influenza A virus (A/goose/Taiwan/TNC1/2015(H5N8)) segment 6 cRNA sequence 2446 2446 100% 0.0 99% KT388446.1
Select seq gb|KT388694.1| Influenza A virus (A/goose/Taiwan/TNO18/2015(H5N8)) segment 6 cRNA sequence 2441 2441 100% 0.0 99% KT388694.1
Select seq gb|KT388550.1| Influenza A virus (A/goose/Taiwan/TNC14/2015(H5N8)) segment 6 cRNA sequence 2441 2441 100% 0.0 99% KT388550.1
Select seq gb|KR233692.1| Influenza A virus (A/chicken/Netherlands/emc-3/2014(H5N8)) segment 6 neuraminidase (NA) gene, partial cds 2414 2414 98% 0.0 99% KR233692.1
Select seq gb|KR233684.1| Influenza A virus (A/eurasian wigeon/Netherlands/2/2014(H5N8)) segment 6 neuraminidase (NA) gene, partial cds 2412 2412 98% 0.0 99% KR233684.1
Select seq gb|KR233676.1| Influenza A virus (A/eurasian wigeon/Netherlands/1/2014(H5N8)) segment 6 neuraminidase (NA) gene, partial cds 2406 2406 97% 0.0 99% KR233676.1
Select seq gb|KR232366.1| Influenza A virus (A/eurasian wigeon/Netherlands/1/2015(H5N8)) segment 6 neuraminidase (NA) gene, partial cds 2401 2401 97% 0.0 99% KR232366.1
Select seq gb|KP414812.1| Influenza A virus (A/duck/Shaoxing/5240/2013(mixed)) segment 6 neuraminidase (NA) gene, complete cds 2360 2360 100% 0.0 97% KP414812.1
Select seq gb|KJ476674.1| Influenza A virus (A/duck/Zhejiang/6D18/2013(H5N8)) segment 6 neuraminidase (NA) gene, complete cds 2360 2360 100% 0.0 97% KJ476674.1
Select seq gb|KP417072.1| Influenza A virus (A/duck/Jiangxi/23970/2013(mixed)) clone b segment 6 neuraminidase (NA) gene, complete cds 2356 2356 100% 0.0 97% KP417072.1
Select seq gb|KJ476673.1| Influenza A virus (A/duck/Zhejiang/W24/2013(H5N8)) segment 6 neuraminidase (NA) gene, complete cds 2356 2356 100% 0.0 97% KJ476673.1
Select seq gb|KT221068.1| Influenza A virus (A/goose/Jiangsu/QD5/2014(H5N8)) segment 6 neuraminidase (NA) gene, complete cds 2351 2351 100% 0.0 97% KT221068.1
Select seq gb|KJ476659.1| Influenza A virus (A/mallard/Shanghai/SH-9/2013(H5N8)) segment 6 neuraminidase (NA) gene, complete cds 2351 2351 100% 0.0 97% KJ476659.1
Select seq gb|KM504103.1| Influenza A virus (A/duck/Shandong/Q1/2013(H5N8)) segment 6 neuraminidase (NA) gene, complete cds 2351 2351 100% 0.0 97% KM504103.1
Select seq gb|KJ413836.1| Influenza A virus (A/breeder duck/Korea/Gochang1/2014(H5N8)) segment 6 neuraminidase (NA) gene, complete cds 2351 2351 100% 0.0 97% KJ413836.1
Select seq gb|KT221076.1| Influenza A virus (A/goose/Shandong/WFSG1/2014(H5N8)) segment 6 neuraminidase (NA) gene, complete cds 2347 2347 100% 0.0 97% KT221076.1
Select seq gb|JQ973696.1| Influenza A virus (A/duck/Jiangsu/k1203/2010(H5N8)) segment 6 neuraminidase (NA) gene, partial cds 2343 2343 99% 0.0 97% JQ973696.1
Select seq gb|KT221084.1| Influenza A virus (A/goose/Yangzhou/0420/2014(H5N8)) segment 6 neuraminidase (NA) gene, complete cds 2333 2333 100% 0.0 97% KT221084.1
Select seq gb|KU042825.1| Influenza A virus (A/duck/Zhejiang/925019/2014(H5N8)) segment 6 neuraminidase (NA) gene, complete cds 2333 2333 100% 0.0 97% KU042825.1
Select seq gb|KU042827.1| Influenza A virus (A/goose/Zhejiang/925037/2014(H5N8)) segment 6 neuraminidase (NA) gene, complete cds 2333 2333 100% 0.0 97% KU042827.1
Select seq gb|KU042826.1| Influenza A virus (A/duck/Zhejiang/925169/2014(H5N8)) segment 6 neuraminidase (NA) gene, complete cds 2329 2329 100% 0.0 97% KU042826.1
Select seq gb|KU042828.1| Influenza A virus (A/goose/Zhejiang/925104/2014(H5N8)) segment 6 neuraminidase (NA) gene, complete cds 2324 2324 100% 0.0 97% KU042828.1
Select seq gb|KP286576.1| Influenza A virus (A/duck/Ningbo/3262/2013(mixed)) clone a segment 6 neuraminidase (NA) gene, partial cds 2324 2324 98% 0.0 97% KP286576.1
Select seq gb|KT383488.1| Influenza A virus (A/duck/Guangdong/s14044/2014(H5N8)) segment 6 neuraminidase (NA) gene, complete cds 2284 2284 100% 0.0 96% KT383488.1
Select seq gb|KT383480.1| Influenza A virus (A/goose/Guangdong/s13124/2013(H5N8)) segment 6 neuraminidase (NA) gene, complete cds 2278 2278 100% 0.0 96% KT383480.1
Select seq gb|KF667707.1| Influenza A virus (A/common shelduck/Mongolia/2185/2011(H3N8)) segment 6 neuraminidase (NA) gene, complete cds 2131 2131 100% 0.0 94% KF667707.1
Select seq gb|EU429700.1| Influenza A virus (A/duck/Eastern China/90/2004(H3N8)) segment 6 neuraminidase (NA) mRNA, complete cds 2122 2122 100% 0.0 93% EU429700.1
Select seq gb|EU429698.1| Influenza A virus (A/duck/Eastern China/19/2004(H3N8)) segment 6 neuraminidase (NA) mRNA, complete cds 2113 2113 100% 0.0 93% EU429698.1
Select seq gb|JN087314.1| Influenza A virus (A/environment/Korea/SH12-6/2008(H3N8)) segment 6 neuraminidase (NA) gene, complete cds 2104 2104 100% 0.0 93% JN087314.1
Select seq gb|KU161077.1| Influenza A virus (A/goose/Hunan/S2466/2011(H4N8)) segment 6 neuraminidase (NA) gene, complete cds 2076 2076 100% 0.0 93% KU161077.1
Select seq dbj|AB778270.1| Influenza A virus (A/duck/Vietnam/OIE-2577/2011(H3N8)) NA gene for neuraminidase, complete cds 2076 2076 100% 0.0 93% AB778270.1
Select seq dbj|AB807866.1| Influenza A virus (A/duck/Vietnam/G18-1/2011(H3N8)) viral cRNA, segment 6, complete sequence 2062 2062 100% 0.0 93% AB807866.1
Select seq gb|JN029590.1| Influenza A virus (A/ruddy shelduck/Mongolia/1-26/2007(H3N8)) segment 6 neuraminidase (NA) gene, partial cds 2049 2049 96% 0.0 93% JN029590.1
Select seq gb|CY109260.1| Influenza A virus (A/duck/Guangxi/2736/2006(H6N8)) neuraminidase (NA) gene, complete cds 2049 2049 100% 0.0 92% CY109260.1
Select seq gb|JN029644.1| Influenza A virus (A/ruddy shelduck/Mongolia/2-79/2007(H3N8)) segment 6 neuraminidase (NA) gene, partial cds 2031 2031 96% 0.0 93% JN029644.1
Select seq gb|JN029625.1| Influenza A virus (A/pintail/Mongolia/2-65/2007(H3N8)) segment 6 neuraminidase (NA) gene, partial cds 2026 2026 96% 0.0 93% JN029625.1
Select seq gb|JN087322.1| Influenza A virus (A/environment/Korea/SH12-8/2008(H3N8)) segment 6 neuraminidase (NA) gene, partial cds 2026 2026 96% 0.0 93% JN087322.1
Select seq gb|KF667696.1| Influenza A virus (A/ruddy shelduck/Mongolia/1787/2011(H3N8)) segment 6 neuraminidase (NA) gene, partial cds 1968 1968 98% 0.0 92% KF667696.1
Select seq gb|KF667705.1| Influenza A virus (A/common shelduck/Mongolia/2076/2011(H3N8)) segment 6 neuraminidase (NA) gene, partial cds 1882 1882 97% 0.0 90% KF667705.1
Select seq gb|L06576.1|FLANAUKRAI Influenza A/Duck/Ukraine/1/63 (H3N8), neuraminidase (seg 6) gene, complete cds 1801 1801 100% 0.0 88% L06576.1
Select seq gb|CY184634.1| Influenza A virus (A/mallard/Sweden/2823/2003(H10N8)) neuraminidase (NA) gene, complete cds 1797 1797 100% 0.0 88% CY184634.1
Select seq gb|CY060376.2| Influenza A virus (A/mallard/Sweden/7/2003(H10N8)) segment 6 sequence 1793 1793 100% 0.0 88% CY060376.2
Select seq gb|CY130016.1| Influenza A virus (A/duck/Ukraine/1963(H3N8)) neuraminidase (NA) gene, complete cds 1792 1792 100% 0.0 88% CY130016.1
Select seq gb|CY014648.1| Influenza A virus (A/duck/Ukraine/1/1963(H3N8)) segment 6, complete sequence 1792 1792 100% 0.0 88% CY014648.1
Select seq dbj|AB292669.1| Influenza A virus (A/duck/Ukraine/1963(H3N8)) NA gene for neuraminidase, complete cds 1788 1788 100% 0.0 88% AB292669.1
Select seq gb|EU429797.1| Influenza A virus (A/duck/Ukraine/1/1963(H3N8)) segment 6 neuraminidase (NA) mRNA, complete cds 1783 1783 100% 0.0 88% EU429797.1
Select seq gb|CY060208.1| Influenza A virus (A/mallard/Netherlands/10/1999(H1N8)) segment 6 sequence 1755 1755 95% 0.0 89% CY060208.1
Select seq gb|CY185467.1| Influenza A virus (A/common Teal/Republic of Georgia/1/2011(H3N8)) neuraminidase (NA) gene, complete cds 1752 1752 100% 0.0 88% CY185467.1
Select seq gb|CY041340.2| Influenza A virus (A/common eider/Netherlands/1/2006(H3N8)) neuraminidase (NA) gene, complete cds 1743 1743 100% 0.0 87% CY041340.2
Select seq gb|CY060283.1| Influenza A virus (A/mallard/Sweden/45/2002(H11N8)) segment 6 sequence 1737 1737 100% 0.0 87% CY060283.1
Select seq gb|EF041489.2| Influenza A virus (A/duck/South Africa/1108/2004(H3N8)) segment 6 neuraminidase (NA) gene, complete cds 1734 1734 100% 0.0 87% EF041489.2
Select seq gb|JF682616.1| Influenza A virus (A/mallard/Czech Republic/14516/2007(H3N8)) segment 6 neuraminidase (NA) gene, complete cds 1734 1734 100% 0.0 87% JF682616.1
Select seq dbj|AB289332.1| Influenza A virus (A/duck/Hong Kong/438/1977(H4N8)) NA gene for neuraminidase, complete cds 1734 1734 100% 0.0 87% AB289332.1
Select seq gb|L06572.1|FLANABURJA Influenza A/Duck/Burjatia/652/88 (H3N8) neuraminidase (seg 6) gene, complete cds 1734 1734 100% 0.0 87% L06572.1
Select seq gb|CY186261.1| Influenza A virus (A/mallard/Sweden/1636/2002(H3N8)) neuraminidase (NA) gene, complete cds 1728 1728 100% 0.0 87% CY186261.1
Select seq gb|CY098526.1| Influenza A virus (A/teal/Chany/444/2009(H8N8)) neuraminidase (NA) gene, complete cds 1728 1728 100% 0.0 87% CY098526.1
Select seq gb|CY041348.1| Influenza A virus (A/turnstone/Netherlands/1/2007(H3N8)) segment 6, complete sequence 1728 1728 100% 0.0 87% CY041348.1
Select seq gb|AY531032.1| Influenza A virus (A/Mallard/65112/03(H3N8)) neuraminidase (NA) gene, complete cds 1728 1728 100% 0.0 87% AY531032.1
Select seq gb|EF041497.2| Influenza A virus (A/duck/South Africa/1233A/2004(H4N8)) segment 6 neuraminidase (NA) gene, complete cds 1725 1725 100% 0.0 87% EF041497.2
Select seq gb|JF789612.1| Influenza A virus (A/mallard/Czech Republic/13577-24K/2010(H3N8)) segment 6 neuraminidase (NA) gene, complete cds 1725 1725 100% 0.0 87% JF789612.1
Select seq dbj|AB569497.1| Influenza A virus (A/duck/Zambia/04/2008(H3N8)) viral cRNA, segment 6, complete sequence 1725 1725 100% 0.0 87% AB569497.1
Select seq gb|CY076915.1| Influenza A virus (A/common eider/Netherlands2/2006(H4N8)) segment 6, complete sequence 1725 1725 100% 0.0 87% CY076915.1
Select seq emb|HE802733.1| Influenza A virus (A/mallard/Norway/10_779/2009(H3N8)) viral cRNA, segment 6, neuraminidase (NA) gene 1719 1719 100% 0.0 87% HE802733.1
Select seq gb|HM570060.1| Influenza A virus (A/Anas platyrhynchos/Belgium/12827/2007(H3N8)) segment 6 neuraminidase (NA) gene, complete cds 1719 1719 100% 0.0 87% HM570060.1
Select seq gb|HM144724.1| Influenza A virus (A/duck/Hunan/3748/2004(H6N8)) segment 6 neuraminidase (NA) gene, complete cds 1719 1719 100% 0.0 87% HM144724.1
Select seq emb|AM706356.1| Influenza A virus (A/duck/Spain/543/2006(H6N8)) NA gene for neuraminidase, genomic RNA 1719 1719 100% 0.0 87% AM706356.1
Select seq gb|EU559258.1| Influenza A virus (A/duck/Hubei/126/1985(H7N8)) neuraminidase (NA) gene, complete cds 1716 1716 100% 0.0 87% EU559258.1
Select seq gb|CY076970.1| Influenza A virus (A/mallard/Netherlands/20/2005(H12N8)) segment 6, complete sequence 1716 1716 100% 0.0 87% CY076970.1
Select seq gb|HM144725.1| Influenza A virus (A/mallard/Jiangxi/6285/2004(H6N8)) segment 6 neuraminidase (NA) gene, complete cds 1716 1716 99% 0.0 87% HM144725.1
Select seq gb|HM144726.1| Influenza A virus (A/mallard/Jiangxi/4408/2005(H6N8)) segment 6 neuraminidase (NA) gene, complete cds 1716 1716 99% 0.0 87% HM144726.1
Select seq gb|CY041380.1| Influenza A virus (A/black-headed gull/Netherlands/1/2005(H6N8)) segment 6, complete sequence 1716 1716 100% 0.0 87% CY041380.1
Select seq gb|CY041372.1| Influenza A virus (A/common teal/Netherlands/2/2005(H6N8)) segment 6, complete sequence 1716 1716 100% 0.0 87% CY041372.1
Select seq gb|CY164186.1| Influenza A virus (A/mallard/Sweden/80057/2008(mixed)) neuraminidase (NA) gene, partial cds 1710 1710 100% 0.0 87% CY164186.1
Select seq gb|CY130128.1| Influenza A virus (A/duck/Chabarovsk/1610/1972(H3N8)) neuraminidase (NA) gene, complete cds 1710 1710 100% 0.0 87% CY130128.1
Select seq emb|HE802709.1| Influenza A virus (A/common gull/Norway/10_1602/2009(H6N8)) viral cRNA, segment 6, neuraminidase (NA) gene 1710 1710 100% 0.0 87% HE802709.1
Select seq gb|JQ737215.1| Influenza A Virus (A/mallard/Czech Republic/14333-1K/2011(H3N8)) segment 6 neuraminidase (NA) gene, complete cds 1710 1710 100% 0.0 87% JQ737215.1
Select seq dbj|AB275285.2| Influenza A virus (A/Duck/Hokkaido/8/80 (H3N8)) NA gene for neuraminidase, complete cds 1710 1710 100% 0.0 87% AB275285.2
Select seq gb|CY014704.1| Influenza A virus (A/duck/Chabarovsk/1610/1972(H3N8)) segment 6, complete sequence 1710 1710 100% 0.0 87% CY014704.1
Select seq emb|AM706354.1| Influenza A virus (A/duck/Spain/539/2006(H6N8)) NA gene for neuraminidase, genomic RNA 1707 1707 100% 0.0 87% AM706354.1
Select seq gb|L06574.1|FLANAHOKKA Influenza A/Duck/Hokkaido/8/80 (H3N8), neuraminidase (seg 6) gene, complete cds 1707 1707 100% 0.0 87% L06574.1
Select seq gb|CY041412.2| Influenza A virus (A/mallard/Netherlands/33/2006(H7N8)) neuraminidase (NA) gene, partial cds 1705 1705 99% 0.0 87% CY041412.2
Select seq gb|CY185475.1| Influenza A virus (A/mallard/Republic of Georgia/3/2011(H3N8)) neuraminidase (NA) gene, complete cds 1701 1701 100% 0.0 87% CY185475.1
Select seq gb|CY184610.1| Influenza A virus (A/mallard/Sweden/233/2002(H10N8)) neuraminidase (NA) gene, complete cds 1701 1701 100% 0.0 87% CY184610.1
Select seq gb|CY049798.1| Influenza A virus (A/gadwall/Altai/1325/2007(H3N8)) neuraminidase (NA) gene, complete cds 1701 1701 100% 0.0 87% CY049798.1
Select seq gb|EU492518.1| Influenza A virus (A/duck/Beijing/40/04(H3N8)) neuraminidase (NA) gene, complete cds 1701 1701 100% 0.0 87% EU492518.1
Select seq emb|AJ841294.1| Influenza A virus (A/duck/Norway/1/03(H3N8)) mRNA for neuraminidase (NA gene), genomic RNA, isolate 1094 1701 1701 100% 0.0 87% AJ841294.1
Select seq gb|GQ404707.2| Influenza A virus (A/Egyptian goose/South Africa/AI1448/2007(H1N8)) segment 6 neuraminidase (NA) gene, complete cds 1698 1698 100% 0.0 87% GQ404707.2
Select seq gb|HM849016.1| Influenza A virus (A/mallard/PT/29497-11/2006(H3N8)) segment 6 neuraminidase (NA) gene, complete cds 1698 1698 100% 0.0 87% HM849016.1
Select seq gb|CY049790.1| Influenza A virus (A/gadwall/Altai/1324/2007(H3N8)) neuraminidase (NA) gene, complete cds 1698 1698 100% 0.0 87% CY049790.1
Select seq gb|CY043882.1| Influenza A virus (A/mallard/Netherlands/17/2007(H11N8)) segment 6, complete sequence 1698 1698 100% 0.0 87% CY043882.1
Select seq gb|GQ325635.1| Influenza A virus (A/environment/Dongting Lake/Hunan/3-9/2007(H10N8)) mouse adapted-P2 segment 6 neuraminidase (NA) gene, complete cds 1698 1698 100% 0.0 87% GQ325635.1
Select seq gb|GQ240823.1| Influenza A virus (A/mallard/Hungary/19616/2007(H3N8)) segment 6 neuraminidase (NA) gene, complete cds 1698 1698 100% 0.0 87% GQ240823.1
Select seq gb|CY041244.1| Influenza A virus (A/mallard/Netherlands/3/2005(H3N8)) segment 6, complete sequence 1698 1698 100% 0.0 87% CY041244.1
Select seq gb|CY060310.1| Influenza A virus (A/mallard/Sweden/50/2002(H3N8)) segment 6 sequence 1696 1696 97% 0.0 87% CY060310.1
Select seq gb|JF965337.1| Influenza A virus (A/duck/Eastern China/50/2002(H6N8)) segment 6 neuraminidase (NA) gene, complete cds 1692 1692 100% 0.0 87% JF965337.1
Select seq gb|EU492522.1| Influenza A virus (A/duck/Beijing/61/05(H3N8)) neuraminidase (NA) gene, complete cds 1692 1692 100% 0.0 87% EU492522.1
Select seq gb|EU429786.1| Influenza A virus (A/duck/Eastern China/163/2002(H6N8)) segment 6 neuraminidase (NA) mRNA, complete cds 1692 1692 100% 0.0 87% EU429786.1
Select seq gb|DQ822200.1| Influenza A virus (A/Bewick's swan/Netherlands/2/2005(H6N8)) NA gene, complete cds 1692 1692 100% 0.0 87% DQ822200.1
Select seq dbj|AB276114.1| Influenza A virus (A/duck/Hokkaido/10/1985(H3N8)) NA gene for neuraminidase, complete cds 1692 1692 100% 0.0 87% AB276114.1
Select seq gb|L06573.1|FLANACHABA Influenza A/Duck/Chabarovsk/1610.72 (H3N8), neuraminidase (seg 6) gene, complete cds 1692 1692 100% 0.0 87% L06573.1
Select seq gb|CY095206.1| Influenza A virus (A/environment/New York/23857/2005(H6N8)) neuraminidase (NA) gene, partial cds 1691 1691 99% 0.0 87% CY095206.1
Select seq gb|KT777836.1| Influenza A virus (A/shellduck/South Africa/DLH/2012(H7N8)) segment 6 neuraminidase (NA) gene, complete cds 1689 1689 100% 0.0 87% KT777836.1
Select seq gb|GQ404699.2| Influenza A virus (A/ostrich/South Africa/AI1447/2007(H6N8)) segment 6 neuraminidase (NA) gene, complete cds 1689 1689 100% 0.0 87% GQ404699.2
Select seq gb|KP287936.1| Influenza A virus (A/migratory duck/Jiangxi/593/2005(H10N8)) segment 6 neuraminidase (NA) gene, complete cds 1689 1689 100% 0.0 87% KP287936.1
Select seq gb|GQ415322.1| Influenza A virus (A/mallard/Switzerland/WV4060057/2006(H2N8)) segment 6 neuraminidase (NA) gene, complete cds 1689 1689 100% 0.0 87% GQ415322.1
Select seq gb|GQ325643.1| Influenza A virus (A/environment/Dongting Lake/Hunan/3-9/2007(H10N8)) mouse adapted-P4 segment 6 neuraminidase (NA) gene, complete cds 1689 1689 100% 0.0 87% GQ325643.1
Select seq gb|GQ290465.1| Influenza A virus (A/environment/Dongting Lake/Hunan/3-9/2007(H10N8)) segment 6 neuraminidase (NA) gene, complete cds 1689 1689 100% 0.0 87% GQ290465.1
Select seq gb|KP287928.1| Influenza A virus (A/duck/Jiangxi/2039/2005(H10N8)) segment 6 neuraminidase (NA) gene, complete cds 1683 1683 100% 0.0 87% KP287928.1
Select seq dbj|AB916669.1| Influenza A virus (A/muscovy duck/Vietnam/LBM529/2013(H3N8)) viral cRNA, segment 6, complete sequence 1683 1683 100% 0.0 87% AB916669.1
Select seq gb|CY149526.1| Influenza A virus (A/greylag goose/Iceland/0976/2011(H6N8)) neuraminidase (NA) gene, complete cds 1683 1683 100% 0.0 87% CY149526.1
Select seq gb|CY149478.1| Influenza A virus (A/greylag goose/Iceland/0921/2011(H6N8)) neuraminidase (NA) gene, complete cds 1683 1683 100% 0.0 87% CY149478.1
Select seq emb|FN386468.1| Influenza A virus (A/Anas plathyrhynchos/Spain/0454/2006(H3N8)) NA gene for neuraminidase, genomic RNA, isolate IA06CR00454 1683 1683 100% 0.0 87% FN386468.1
Select seq gb|CY149462.1| Influenza A virus (A/greylag goose/Iceland/1482/2011(H6N8)) neuraminidase (NA) gene, complete cds 1680 1680 100% 0.0 86% CY149462.1
Select seq gb|GQ325651.1| Influenza A virus (A/environment/Dongting Lake/Hunan/3-9/2007(H10N8)) mouse adapted-P6 segment 6 neuraminidase (NA) gene, complete cds 1680 1680 100% 0.0 86% GQ325651.1
Select seq dbj|AB450458.1| Influenza A virus (A/duck/Siberia/100/2001(H3N8)) NA gene for neuraminidase, complete cds 1680 1680 100% 0.0 86% AB450458.1
Select seq gb|KF259687.1| Influenza A virus (A/wild duck/Jiangxi/9157/2005(H7N8)) segment 6 neuraminidase (NA) gene, complete cds 1678 1678 100% 0.0 87% KF259687.1
Select seq gb|CY149534.1| Influenza A virus (A/greylag goose/Iceland/0980/2011(H6N8)) neuraminidase (NA) gene, complete cds 1674 1674 100% 0.0 86% CY149534.1
Select seq gb|CY149454.1| Influenza A virus (A/greylag goose/Iceland/1474/2011(H6N8)) neuraminidase (NA) gene, complete cds 1674 1674 100% 0.0 86% CY149454.1
Select seq gb|KC541695.1| Influenza A virus (A/common teal/Georgia/1/2011(H3N8)) segment 6 neuraminidase (NA) gene, partial cds 1674 1674 96% 0.0 87% KC541695.1
Select seq dbj|AB569505.1| Influenza A virus (A/goose/Zambia/05/2008(H3N8)) viral cRNA, segment 6, complete sequence 1674 1674 100% 0.0 86% AB569505.1
Select seq gb|CY015091.1| Influenza A virus (A/turkey/Ireland/1378/1983(H5N8)) segment 6, complete sequence 1674 1674 100% 0.0 86% CY015091.1
Select seq gb|DQ885994.1| Influenza A virus (A/wild bird feces/Korea/ES1-9/03(H10N8)) neuraminidase (NA) gene, partial cds 1674 1674 98% 0.0 87% DQ885994.1
Select seq gb|DQ885992.1| Influenza A virus (A/wild bird feces/Korea/ES1-17/03(H10N8)) neuraminidase (NA) gene, partial cds 1674 1674 98% 0.0 87% DQ885992.1
Select seq gb|CY146606.1| Influenza A virus (A/duck/Hunan/S1256/2012(H3N8)) neuraminidase (NA) gene, complete cds 1671 1671 100% 0.0 86% CY146606.1
Select seq gb|EU429788.1| Influenza A virus (A/duck/Eastern China/119/2005(H3N8)) segment 6 neuraminidase (NA) mRNA, complete cds 1671 1671 100% 0.0 86% EU429788.1
Select seq emb|FN773071.1| Influenza A virus (A/Teal/Norway/10_1575/2007(H3N8)) partial viral cRNA for neuraminidase (NA gene) 1669 1669 98% 0.0 87% FN773071.1
Select seq gb|EU492517.1| Influenza A virus (A/duck/Beijing/33/04(H3N8)) neuraminidase (NA) gene, partial cds 1667 1667 98% 0.0 87% EU492517.1
Select seq gb|KP862029.1| Influenza A virus (A/duck/Hunan/S3137/2009(H10N8)) segment 6 neuraminidase (NA) gene, complete cds 1665 1665 100% 0.0 86% KP862029.1
Select seq gb|KP287960.1| Influenza A virus (A/migratory duck/Jiangxi/21248/2009(H10N8)) segment 6 neuraminidase (NA) gene, complete cds 1665 1665 100% 0.0 86% KP287960.1
Select seq gb|KP287944.1| Influenza A virus (A/duck/Jiangxi/22960/2008(H10N8)) segment 6 neuraminidase (NA) gene, complete cds 1665 1665 100% 0.0 86% KP287944.1
Select seq gb|KP287798.1| Influenza A virus (A/duck/Jiangxi/24570/2009(mixed)) clone b segment 6 neuraminidase (NA) gene, complete cds 1665 1665 100% 0.0 86% KP287798.1
Select seq gb|KP287733.1| Influenza A virus (A/duck/Jiangxi/3008/2009(mixed)) clone c segment 6 neuraminidase (NA) gene, complete cds 1665 1665 100% 0.0 86% KP287733.1
Select seq gb|KC899750.1| Influenza A virus (A/wild duck/SH38-26/2010(H2N8)) segment 6 neuraminidase (NA) gene, complete cds 1665 1665 100% 0.0 86% KC899750.1
Select seq gb|KF667714.1| Influenza A virus (A/ruddy shelduck/Mongolia/881V/2009(H3N8)) segment 6 neuraminidase (NA) gene, complete cds 1665 1665 100% 0.0 86% KF667714.1
Select seq gb|KF259685.1| Influenza A virus (A/wild duck/Jiangxi/19615/2009(H7N8)) segment 6 neuraminidase (NA) gene, complete cds 1665 1665 100% 0.0 86% KF259685.1
Select seq gb|KC876693.1| Influenza A virus (A/wild goose/Dongting/C1037/2011(H12N8)) segment 6 neuraminidase (NA) gene, complete cds 1665 1665 100% 0.0 86% KC876693.1
Select seq dbj|AB780474.1| Influenza A virus (A/duck/Mongolia/OIE-241/2012(H4N8)) viral cRNA, segment 6, complete sequence 1665 1665 100% 0.0 86% AB780474.1
Select seq gb|CY035892.1| Influenza A virus (A/red-necked stint/Western Australia/4094/1984(H4N8)) segment 6, complete sequence 1665 1665 100% 0.0 86% CY035892.1
Select seq gb|EU429787.1| Influenza A virus (A/duck/Eastern China/18/2005(H3N8)) segment 6 neuraminidase (NA) mRNA, complete cds 1665 1665 100% 0.0 86% EU429787.1
Select seq gb|CY014631.1| Influenza A virus (A/red-necked stint/Australia/4189/1980(H4N8)) segment 6, complete sequence 1665 1665 100% 0.0 86% CY014631.1
Select seq gb|EU493449.1| Influenza A virus (A/mallard/Finland/12072/06(H3N8)) neuraminidase (NA) gene, complete cds 1663 1663 100% 0.0 86% EU493449.1
Select seq gb|KP287952.1| Influenza A virus (A/duck/Jiangxi/4759/2009(H10N8)) segment 6 neuraminidase (NA) gene, complete cds 1662 1662 100% 0.0 86% KP287952.1
Select seq gb|KC899751.1| Influenza A virus (A/wild duck/SH38-28/2010(H2N8)) segment 6 neuraminidase (NA) gene, complete cds 1662 1662 100% 0.0 86% KC899751.1
Select seq gb|KC899755.1| Influenza A virus (A/wild duck/SH38-64/2010(H2N8)) segment 6 neuraminidase (NA) gene, complete cds 1662 1662 100% 0.0 86% KC899755.1
Select seq gb|EU492521.1| Influenza A virus (A/duck/Beijing/59/05(H3N8)) neuraminidase (NA) gene, partial cds 1662 1662 98% 0.0 87% EU492521.1
Select seq gb|CY028285.1| Influenza A virus (A/red-necked stint/Western Australia/4923/1983(H3N8)) segment 6, complete sequence 1662 1662 100% 0.0 86% CY028285.1
Select seq gb|CY028277.1| Influenza A virus (A/red-necked stint/Bunbury/4500/1980(H3N8)) segment 6, complete sequence 1662 1662 100% 0.0 86% CY028277.1
Select seq gb|CY014634.1| Influenza A virus (A/red-necked stint/Australia/4500/1980(H3N8)) segment 6, complete sequence 1662 1662 100% 0.0 86% CY014634.1
Select seq gb|KJ439879.1| Influenza A virus (A/duck/Zhejiang/D1-6/2013(H3N8)) segment 6 neuraminidase (NA) gene, complete cds 1660 1660 100% 0.0 86% KJ439879.1
Select seq gb|KU160853.1| Influenza A virus (A/duck/Chongqing/S2086/2012(H4N8)) segment 6 neuraminidase (NA) gene, complete cds 1656 1656 100% 0.0 86% KU160853.1
Select seq gb|EU492519.1| Influenza A virus (A/duck/Beijing/44/04(H3N8)) neuraminidase (NA) gene, partial cds 1656 1656 98% 0.0 87% EU492519.1
Select seq gb|CY033155.1| Influenza A virus (A/red-necked stint/Western Australia/4126/1980(H4N8)) segment 6, complete sequence 1656 1656 99% 0.0 86% CY033155.1
Select seq gb|CY029899.1| Influenza A virus (A/red-necked stint/Western Australia/4915/1984(H3N8)) segment 6, complete sequence 1656 1656 100% 0.0 86% CY029899.1
Select seq gb|KT777932.1| Influenza A virus (A/cape shoveller/South Africa/STR0982/2013(H4N8)) segment 6 neuraminidase (NA) gene, complete cds 1653 1653 100% 0.0 86% KT777932.1
Select seq gb|KT777920.1| Influenza A virus (A/yellow-billed duck/South Africa/STR0963/2013(H4N8)) segment 6 neuraminidase (NA) gene, complete cds 1653 1653 100% 0.0 86% KT777920.1
Select seq gb|KP862037.1| Influenza A virus (A/duck/Hunan/S4280/2009(H10N8)) segment 6 neuraminidase (NA) gene, complete cds 1653 1653 100% 0.0 86% KP862037.1
Select seq gb|KC899754.1| Influenza A virus (A/wild duck/SH38-60/2010(H2N8)) segment 6 neuraminidase (NA) gene, complete cds 1653 1653 100% 0.0 86% KC899754.1
Select seq gb|JN087130.1| Influenza A virus (A/duck/Korea/U2-5/2007(H3N8)) segment 6 neuraminidase (NA) gene, partial cds 1653 1653 98% 0.0 86% JN087130.1
Select seq gb|CY087762.1| Influenza A virus (A/shearwater/Australia/2/1972(H10N8)) neuraminidase (NA) gene, complete cds 1653 1653 100% 0.0 86% CY087762.1
Select seq gb|CY028261.1| Influenza A virus (A/red-necked stint/Australia/2/2004(H4N8)) segment 6, complete sequence 1653 1653 99% 0.0 86% CY028261.1
Select seq gb|CY005796.1| Influenza A virus (A/quail/Italy/1117/1965(H10N8)) segment 6, complete sequence 1653 1653 100% 0.0 86% CY005796.1
Select seq gb|CY187392.1| Influenza A virus (A/red-necked stint/Australia/1/2004(H4N8)) neuraminidase (NA) gene, complete cds 1649 1649 99% 0.0 86% CY187392.1
Select seq gb|JX307232.1| Influenza A virus (A/duck/Thailand/CU-7519C/2010(H3N8)) segment 6 neuraminidase (NA) gene, complete cds 1649 1649 99% 0.0 86% JX307232.1
Select seq gb|CY039257.1| Influenza A virus (A/red-necked stint/Australia/4/2004(H4N8)) segment 6, complete sequence 1649 1649 99% 0.0 86% CY039257.1
Select seq gb|CY034744.1| Influenza A virus (A/red-necked stint/Australia/3/2004(H4N8)) segment 6, complete sequence 1649 1649 99% 0.0 86% CY034744.1
Select seq gb|KP862021.1| Influenza A virus (A/duck/Hunan/S1496/2011(H10N8)) segment 6 neuraminidase (NA) gene, complete cds 1647 1647 100% 0.0 86% KP862021.1
Select seq gb|KC899753.1| Influenza A virus (A/wild duck/SH38-56/2010(H2N8)) segment 6 neuraminidase (NA) gene, complete cds 1647 1647 100% 0.0 86% KC899753.1
Select seq gb|CY087834.1| Influenza A virus (A/quail/Italy/1117/1965(H10N8)) neuraminidase (NA) gene, complete cds 1647 1647 100% 0.0 86% CY087834.1
Select seq gb|HM144722.1| Influenza A virus (A/duck/Hunan/1469/2002(H6N8)) segment 6 neuraminidase (NA) gene, complete cds 1647 1647 100% 0.0 86% HM144722.1
Select seq gb|JX307136.1| Influenza A virus (A/duck/Thailand/CU-7518C/2010(H3N8)) segment 6 neuraminidase (NA) gene, complete cds 1645 1645 99% 0.0 86% JX307136.1
Select seq gb|JN087154.1| Influenza A virus (A/duck/Korea/U8-1/2007(H3N8)) segment 6 neuraminidase (NA) gene, partial cds 1644 1644 98% 0.0 86% JN087154.1
Select seq gb|L06587.1|FLANAITALY Influenza A/Quail/Italy/1117/65 (H10N8), neuraminidase (seg 6) gene, complete cds 1644 1644 100% 0.0 86% L06587.1
Select seq gb|CY109636.1| Influenza A virus (A/duck/Guizhou/1073/2007(H6N8)) neuraminidase (NA) gene, complete cds 1638 1638 100% 0.0 86% CY109636.1
Select seq gb|CY109324.1| Influenza A virus (A/duck/Hunan/4056/2006(H6N8)) neuraminidase (NA) gene, complete cds 1638 1638 100% 0.0 86% CY109324.1
Select seq gb|CY029891.1| Influenza A virus (A/red-necked stint/Australia/5/2004(H4N8)) segment 6, complete sequence 1638 1638 99% 0.0 86% CY029891.1

Author:  niman [ Sun Dec 27, 2015 12:03 pm ]
Post subject:  Re: Fujian H5N8 In Klamath Co OR With Wild Bird PB1 & PA

Influenza A virus (A/mallard/Oregon/AH0003952/2015(H5N2)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1772 1772 100% 0.0 100% KU201627.1
Select seq gb|KU201643.1| Influenza A virus (A/wood duck/Oregon/AH0007244/2015(H5N2)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1772 1772 100% 0.0 100% KU201643.1
Select seq gb|KU201651.1| Influenza A virus (A/wood duck/Oregon/AH0007257/2015(H5N2)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1772 1772 100% 0.0 100% KU201651.1
Select seq gb|KU201707.1| Influenza A virus (A/Northern pintail/Oregon/AH0003871/2015(H5N2)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1772 1772 100% 0.0 100% KU201707.1
Select seq gb|KU201755.1| Influenza A virus (A/American wigeon/Oregon/AH0012525/2015(H5N8)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1772 1772 100% 0.0 100% KU201755.1
Select seq gb|KU201811.1| Influenza A virus (A/Northern pintail/Washington/195365/2014(H5N2)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1772 1772 100% 0.0 100% KU201811.1
Select seq gb|KU201819.1| Influenza A virus (A/mallard/Oregon/195547/2014(H5N2)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1772 1772 100% 0.0 100% KU201819.1
Select seq gb|KU201899.1| Influenza A virus (A/mallard/Washington/195246/2014(H5N2)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1772 1772 100% 0.0 100% KU201899.1
Select seq gb|KU201923.1| Influenza A virus (A/Canada goose/Washington/197619/2014(H5N2)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1772 1772 100% 0.0 100% KU201923.1
Select seq gb|KJ756684.2| Influenza A virus (A/baikal teal/Korea/1454/2014(H5N8)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1772 1772 100% 0.0 100% KJ756684.2
Select seq gb|KJ756676.1| Influenza A virus (A/baikal teal/Korea/1437/2014(H5N8)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1772 1772 100% 0.0 100% KJ756676.1
Select seq gb|KP307979.1| Influenza A virus (A/Northern pintail/Washington/40964/2014(H5N2)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1772 1772 100% 0.0 100% KP307979.1
Select seq gb|KP307960.1| Influenza A virus (A/turkey/BC/FAV10/2014(H5N2)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1772 1772 100% 0.0 100% KP307960.1
Select seq gb|KJ746114.1| Influenza A virus (A/mallard/Korea/W452/2014(H5N8)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1772 1772 100% 0.0 100% KJ746114.1
Select seq gb|KJ511815.1| Influenza A virus (A/waterfowl/Korea/S005/2014(H5N8)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1772 1772 100% 0.0 100% KJ511815.1
Select seq gb|KJ413853.1| Influenza A virus (A/baikal teal/Korea/Donglim3/2014(H5N8)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1772 1772 100% 0.0 100% KJ413853.1
Select seq gb|KU201619.1| Influenza A virus (A/American wigeon/Utah/AH0007824/2015(H5N8)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1766 1766 100% 0.0 99% KU201619.1
Select seq gb|KU201635.1| Influenza A virus (A/Northern pintail/Oregon/AH0003967/2015(H5N2)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1766 1766 100% 0.0 99% KU201635.1
Select seq gb|KU201659.1| Influenza A virus (A/wood duck/Oregon/AH0007263/2015(H5N2)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1766 1766 100% 0.0 99% KU201659.1
Select seq gb|KU201667.1| Influenza A virus (A/Northern shoveler/Oregon/AH0007332/2015(H5N2)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1766 1766 100% 0.0 99% KU201667.1
Select seq gb|KU201675.1| Influenza A virus (A/Northern shoveler/Oregon/AH0007337/2015(H5N2)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1766 1766 100% 0.0 99% KU201675.1
Select seq gb|KU201683.1| Influenza A virus (A/Northern shoveler/Oregon/AH0007339/2015(H5N2)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1766 1766 100% 0.0 99% KU201683.1
Select seq gb|KU201699.1| Influenza A virus (A/mallard/Oregon/AH0008887/2015(H5N2)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1766 1766 100% 0.0 99% KU201699.1
Select seq gb|KU201731.1| Influenza A virus (A/American green-winged teal/Idaho/AH0011899/2015(H5N2)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1766 1766 100% 0.0 99% KU201731.1
Select seq gb|KU201747.1| Influenza A virus (A/Canada goose/Oregon/AH0012452/2015(H5N8)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1766 1766 100% 0.0 99% KU201747.1
Select seq gb|KU201763.1| Influenza A virus (A/mallard/Nevada/AH0006855/2015(H5N8)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1766 1766 100% 0.0 99% KU201763.1
Select seq gb|KU201787.1| Influenza A virus (A/mallard/Oregon/AH0003821/2014(H5N2)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1766 1766 100% 0.0 99% KU201787.1
Select seq gb|KU201795.1| Influenza A virus (A/chicken/California/15-004912/2015(H5N8)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1766 1766 100% 0.0 99% KU201795.1
Select seq gb|KU201851.1| Influenza A virus (A/mallard/Washington/196865/2015(H5N2)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1766 1766 100% 0.0 99% KU201851.1
Select seq gb|KU201859.1| Influenza A virus (A/American wigeon/Washington/196336/2015(H5N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1766 1766 100% 0.0 99% KU201859.1
Select seq gb|KU201867.1| Influenza A virus (A/American wigeon/Washington/196340/2015(H5N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1766 1766 100% 0.0 99% KU201867.1
Select seq gb|KU201883.1| Influenza A virus (A/American wigeon/Washington/195198/2014(H5N8)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1766 1766 100% 0.0 99% KU201883.1
Select seq gb|KU201891.1| Influenza A virus (A/American wigeon/Washington/195205/2014(H5N8)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1766 1766 100% 0.0 99% KU201891.1
Select seq gb|KU201907.1| Influenza A virus (A/peregrine falcon/Washington/196426/2014(H5N8)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1766 1766 100% 0.0 99% KU201907.1
Select seq gb|KU201915.1| Influenza A virus (A/mallard/Washington/195810/2014(H5N2)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1766 1766 100% 0.0 99% KU201915.1
Select seq gb|KT388711.1| Influenza A virus (A/goose/Taiwan/TNO20/2015(H5N8)) segment 7 cRNA sequence 1766 1766 100% 0.0 99% KT388711.1
Select seq gb|KT388679.1| Influenza A virus (A/goose/Taiwan/TNO16/2015(H5N8)) segment 7 cRNA sequence 1766 1766 100% 0.0 99% KT388679.1
Select seq gb|KT388671.1| Influenza A virus (A/goose/Taiwan/TNO15/2015(H5N8)) segment 7 cRNA sequence 1766 1766 100% 0.0 99% KT388671.1
Select seq gb|KT388623.1| Influenza A virus (A/goose/Taiwan/TNO9/2015(H5N8)) segment 7 cRNA sequence 1766 1766 100% 0.0 99% KT388623.1
Select seq gb|KT388599.1| Influenza A virus (A/goose/Taiwan/TNO6/2015(H5N8)) segment 7 cRNA sequence 1766 1766 100% 0.0 99% KT388599.1
Select seq gb|KT388583.1| Influenza A virus (A/goose/Taiwan/TNO4/2015(H5N8)) segment 7 cRNA sequence 1766 1766 100% 0.0 99% KT388583.1
Select seq gb|KT388575.1| Influenza A virus (A/goose/Taiwan/TNO3/2015(H5N8)) segment 7 cRNA sequence 1766 1766 100% 0.0 99% KT388575.1
Select seq gb|KT388567.1| Influenza A virus (A/goose/Taiwan/TNO2/2015(H5N8)) segment 7 cRNA sequence 1766 1766 100% 0.0 99% KT388567.1
Select seq gb|KT388527.1| Influenza A virus (A/goose/Taiwan/TNC11/2015(H5N8)) segment 7 cRNA sequence 1766 1766 100% 0.0 99% KT388527.1
Select seq gb|KT388479.1| Influenza A virus (A/goose/Taiwan/TNC5/2015(H5N8)) segment 7 cRNA sequence 1766 1766 100% 0.0 99% KT388479.1
Select seq gb|KT388471.1| Influenza A virus (A/goose/Taiwan/TNC4/2015(H5N8)) segment 7 cRNA sequence 1766 1766 100% 0.0 99% KT388471.1
Select seq gb|KT762895.1| Influenza A virus (A/turkey/North Dakota/15-011420-13/2015(H5N2)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1766 1766 100% 0.0 99% KT762895.1
Select seq gb|KT762911.1| Influenza A virus (A/turkey/Wisconsin/15-012012-2/2015(H5N2)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1766 1766 100% 0.0 99% KT762911.1
Select seq gb|KT762919.1| Influenza A virus (A/turkey/North Dakota/15-013049-1/2015(H5N2)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1766 1766 100% 0.0 99% KT762919.1
Select seq gb|KT762927.1| Influenza A virus (A/chicken/Minnesota/15-013533-1/2015(H5N2)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1766 1766 100% 0.0 99% KT762927.1
Select seq gb|KT762935.1| Influenza A virus (A/turkey/South Dakota/15-010371/2015(H5N2)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1766 1766 100% 0.0 99% KT762935.1
Select seq gb|KT762951.1| Influenza A virus (A/chicken/Wisconsin/15-011595-1/2015(H5N2)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1766 1766 100% 0.0 99% KT762951.1
Select seq gb|KT002476.1| Influenza A virus (A/turkey/Iowa/11762-1/2015(H5N2)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1766 1766 100% 0.0 99% KT002476.1
Select seq gb|KR234033.1| Influenza A virus (A/chicken/Kansas/8395-3/2015(H5N2)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1766 1766 100% 0.0 99% KR234033.1
Select seq gb|KR234025.1| Influenza A virus (A/turkey/Arkansas/7791-1/2015(H5N2)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1766 1766 100% 0.0 99% KR234025.1
Select seq gb|KR234017.1| Influenza A virus (A/turkey/Missouri/7458-1/2015(H5N2)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1766 1766 100% 0.0 99% KR234017.1
Select seq gb|KR233993.1| Influenza A virus (A/chicken/Washington/3490-18/2015(H5N2)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1766 1766 100% 0.0 99% KR233993.1
Select seq gb|KR234001.1| Influenza A virus (A/chicken/Oregon/A01819044/2015(H5N2)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1766 1766 100% 0.0 99% KR234001.1
Select seq gb|KR233985.1| Influenza A virus (A/turkey/Minnesota/9892-2/2015(H5N2)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1766 1766 100% 0.0 99% KR233985.1
Select seq gb|KJ756694.1| Influenza A virus (A/baikal teal/Korea/2417/2014(H5N8)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1766 1766 100% 0.0 99% KJ756694.1
Select seq gb|KJ756682.1| Influenza A virus (A/baikal teal/Korea/1449/2014(H5N8)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1766 1766 100% 0.0 99% KJ756682.1
Select seq gb|KJ756678.1| Influenza A virus (A/baikal teal/Korea/1445/2014(H5N8)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1766 1766 100% 0.0 99% KJ756678.1
Select seq gb|KR150912.1| Influenza A virus (A/pheasant/Washington/3147-2/2015(H5N2)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1766 1766 100% 0.0 99% KR150912.1
Select seq gb|KP739400.1| Influenza A virus (A/turkey/Washington/61-22/2014(H5N2)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1766 1766 100% 0.0 99% KP739400.1
Select seq gb|KP739424.1| Influenza A virus (A/American green-winged teal/Washington/195750/2014(H5N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1766 1766 100% 0.0 99% KP739424.1
Select seq gb|KP307987.1| Influenza A virus (A/gyrfalcon/Washington/41088-6/2014(H5N8)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1766 1766 100% 0.0 99% KP307987.1
Select seq gb|KJ508927.1| Influenza A virus (A/bean goose/Korea/H40/2014(H5N8)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1766 1766 100% 0.0 99% KJ508927.1
Select seq gb|KJ508959.1| Influenza A virus (A/broiler duck/Korea/H49/2014(H5N8)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1766 1766 100% 0.0 99% KJ508959.1
Select seq gb|KJ508983.1| Influenza A virus (A/Baikal teal/Korea/H62/2014(H5N8)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1766 1766 100% 0.0 99% KJ508983.1
Select seq gb|KJ509007.1| Influenza A virus (A/Baikal teal/Korea/H68/2014(H5N8)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1766 1766 100% 0.0 99% KJ509007.1
Select seq gb|KJ509071.1| Influenza A virus (A/broiler duck/Korea/H145/2014(H5N8)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1766 1766 100% 0.0 99% KJ509071.1
Select seq gb|KJ509079.1| Influenza A virus (A/breeder duck/Korea/H158/2014(H5N8)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1766 1766 100% 0.0 99% KJ509079.1
Select seq gb|KJ509127.1| Influenza A virus (A/Korean native chicken/Korea/H257/2014(H5N8)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1766 1766 100% 0.0 99% KJ509127.1
Select seq gb|KU201611.1| Influenza A virus (A/snow goose/Missouri/15-011246-1/2015(H5N2)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1763 1763 100% 0.0 99% KU201611.1
Select seq gb|KU201691.1| Influenza A virus (A/mallard/Idaho/AH0008597/2015(H5N8)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1763 1763 100% 0.0 99% KU201691.1
Select seq gb|KU201715.1| Influenza A virus (A/mallard/Idaho/AH0007412/2015(H5N2)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1763 1763 100% 0.0 99% KU201715.1
Select seq gb|KU201723.1| Influenza A virus (A/mallard/Idaho/AH0007413/2015(H5N2)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1763 1763 100% 0.0 99% KU201723.1
Select seq gb|KU201771.1| Influenza A virus (A/mallard/Idaho/AH0005954/2014(H5N8)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1763 1763 100% 0.0 99% KU201771.1
Select seq gb|KU201779.1| Influenza A virus (A/mallard/Idaho/AH0005955/2014(H5N8)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1763 1763 100% 0.0 99% KU201779.1
Select seq gb|KU201803.1| Influenza A virus (A/bald eagle/Idaho/15-002892-2/2015(H5N8)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1763 1763 100% 0.0 99% KU201803.1
Select seq gb|KU201835.1| Influenza A virus (A/mallard/Washington/196262/2015(H5N2)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1763 1763 100% 0.0 99% KU201835.1
Select seq gb|KU201843.1| Influenza A virus (A/Northern pintail/Washington/196271/2014(H5N8)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1763 1763 100% 0.0 99% KU201843.1
Select seq gb|KU201875.1| Influenza A virus (A/mallard/Oregon/195536/2014(H5N8)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1763 1763 100% 0.0 99% KU201875.1
Select seq gb|KU201931.1| Influenza A virus (A/Cooper's hawk/Minnesota/198225/2015(H5N2)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1763 1763 100% 0.0 99% KU201931.1
Select seq gb|KU201939.1| Influenza A virus (A/snowy owl/Wisconsin/198399/2015(H5N2)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1763 1763 100% 0.0 99% KU201939.1
Select seq gb|KT388663.1| Influenza A virus (A/goose/Taiwan/TNO14/2015(H5N8)) segment 7 cRNA sequence 1763 1763 100% 0.0 99% KT388663.1
Select seq gb|KT388631.1| Influenza A virus (A/goose/Taiwan/TNO10/2015(H5N8)) segment 7 cRNA sequence 1763 1763 100% 0.0 99% KT388631.1
Select seq gb|KT388607.1| Influenza A virus (A/goose/Taiwan/TNO7/2015(H5N8)) segment 7 cRNA sequence 1763 1763 100% 0.0 99% KT388607.1
Select seq gb|KT388543.1| Influenza A virus (A/goose/Taiwan/TNC13/2015(H5N8)) segment 7 cRNA sequence 1763 1763 100% 0.0 99% KT388543.1
Select seq gb|KT388511.1| Influenza A virus (A/goose/Taiwan/TNC9/2015(H5N8)) segment 7 cRNA sequence 1763 1763 100% 0.0 99% KT388511.1
Select seq gb|KT388463.1| Influenza A virus (A/goose/Taiwan/TNC3/2015(H5N8)) segment 7 cRNA sequence 1763 1763 100% 0.0 99% KT388463.1
Select seq gb|KT762903.1| Influenza A virus (A/chicken/Nebraska/15-017897-1/2015(H5N2)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1763 1763 100% 0.0 99% KT762903.1
Select seq gb|KT762943.1| Influenza A virus (A/chicken/Nebraska/15-017990-5/2015(H5N2)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1763 1763 100% 0.0 99% KT762943.1
Select seq gb|KT762959.1| Influenza A virus (A/chicken/Wisconsin/15-012160-1/2015(H5N2)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1763 1763 100% 0.0 99% KT762959.1
Select seq gb|KT280935.1| Influenza A virus (A/chicken/Iowa/21981/2015(H5N2)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1763 1763 100% 0.0 99% KT280935.1
Select seq gb|KT002484.1| Influenza A virus (A/turkey/Iowa/13541-1/2015(H5N2)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1763 1763 100% 0.0 99% KT002484.1
Select seq gb|KT002492.1| Influenza A virus (A/chicken/Iowa/13542-2/2015(H5N2)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1763 1763 100% 0.0 99% KT002492.1
Select seq gb|KT002500.1| Influenza A virus (A/turkey/Iowa/14318-1/2015(H5N2)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1763 1763 100% 0.0 99% KT002500.1
Select seq gb|KT002508.1| Influenza A virus (A/turkey/Iowa/14319-1/2015(H5N2)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1763 1763 100% 0.0 99% KT002508.1
Select seq gb|KT002516.1| Influenza A virus (A/chicken/Iowa/14322-6/2015(H5N2)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1763 1763 100% 0.0 99% KT002516.1
Select seq gb|KT002524.1| Influenza A virus (A/chicken/Iowa/14399-4/2015(H5N2)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1763 1763 100% 0.0 99% KT002524.1
Select seq gb|KT002531.1| Influenza A virus (A/chicken/Iowa/14589-1/2015(H5N2)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1763 1763 100% 0.0 99% KT002531.1
Select seq gb|KR234009.1| Influenza A virus (A/turkey/Minnesota/7172-1/2015(H5N2)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1763 1763 100% 0.0 99% KR234009.1
Select seq gb|KR492977.1| Influenza A virus (A/chicken/Iowa/04-20/2015(H5N2)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1763 1763 100% 0.0 99% KR492977.1
Select seq gb|KU201739.1| Influenza A virus (A/American green-winged teal/Oregon/AH0012403/2015(H5N2)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1757 1757 100% 0.0 99% KU201739.1
Select seq gb|KU201827.1| Influenza A virus (A/American wigeon/Washington/195968/2014(H5N8)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1757 1757 100% 0.0 99% KU201827.1
Select seq gb|KU201946.1| Influenza A virus (A/Canada goose/Kansas/197850/2015(H5N2)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1757 1757 100% 0.0 99% KU201946.1
Select seq gb|KT388703.1| Influenza A virus (A/goose/Taiwan/TNO19/2015(H5N8)) segment 7 cRNA sequence 1757 1757 100% 0.0 99% KT388703.1
Select seq gb|KT388695.1| Influenza A virus (A/goose/Taiwan/TNO18/2015(H5N8)) segment 7 cRNA sequence 1757 1757 100% 0.0 99% KT388695.1
Select seq gb|KT388687.1| Influenza A virus (A/goose/Taiwan/TNO17/2015(H5N8)) segment 7 cRNA sequence 1757 1757 100% 0.0 99% KT388687.1
Select seq gb|KT388655.1| Influenza A virus (A/goose/Taiwan/TNO13/2015(H5N8)) segment 7 cRNA sequence 1757 1757 100% 0.0 99% KT388655.1
Select seq gb|KT388647.1| Influenza A virus (A/goose/Taiwan/TNO12/2015(H5N8)) segment 7 cRNA sequence 1757 1757 100% 0.0 99% KT388647.1
Select seq gb|KT388639.1| Influenza A virus (A/goose/Taiwan/TNO11/2015(H5N8)) segment 7 cRNA sequence 1757 1757 100% 0.0 99% KT388639.1
Select seq gb|KT388615.1| Influenza A virus (A/goose/Taiwan/TNO8/2015(H5N8)) segment 7 cRNA sequence 1757 1757 100% 0.0 99% KT388615.1
Select seq gb|KT388559.1| Influenza A virus (A/goose/Taiwan/TNO1/2015(H5N8)) segment 7 cRNA sequence 1757 1757 100% 0.0 99% KT388559.1
Select seq gb|KT388551.1| Influenza A virus (A/goose/Taiwan/TNC14/2015(H5N8)) segment 7 cRNA sequence 1757 1757 100% 0.0 99% KT388551.1
Select seq gb|KT388535.1| Influenza A virus (A/goose/Taiwan/TNC12/2015(H5N8)) segment 7 cRNA sequence 1757 1757 100% 0.0 99% KT388535.1
Select seq gb|KT388519.1| Influenza A virus (A/goose/Taiwan/TNC10/2015(H5N8)) segment 7 cRNA sequence 1757 1757 100% 0.0 99% KT388519.1
Select seq gb|KT388503.1| Influenza A virus (A/goose/Taiwan/TNC8/2015(H5N8)) segment 7 cRNA sequence 1757 1757 100% 0.0 99% KT388503.1
Select seq gb|KT388495.1| Influenza A virus (A/goose/Taiwan/TNC7/2015(H5N8)) segment 7 cRNA sequence 1757 1757 100% 0.0 99% KT388495.1
Select seq gb|KT388487.1| Influenza A virus (A/goose/Taiwan/TNC6/2015(H5N8)) segment 7 cRNA sequence 1757 1757 100% 0.0 99% KT388487.1
Select seq gb|KT388455.1| Influenza A virus (A/goose/Taiwan/TNC2/2015(H5N8)) segment 7 cRNA sequence 1757 1757 100% 0.0 99% KT388455.1
Select seq gb|KT388447.1| Influenza A virus (A/goose/Taiwan/TNC1/2015(H5N8)) segment 7 cRNA sequence 1757 1757 100% 0.0 99% KT388447.1
Select seq gb|KT762887.1| Influenza A virus (A/chicken/Montana/15-010559-1/2015(H5N2)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1757 1757 100% 0.0 99% KT762887.1
Select seq gb|KC282882.1| Influenza A virus (A/duck/Jiangsu/1-15/2011(H4N2)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1730 1730 100% 0.0 99% KC282882.1
Select seq gb|JQ041413.1| Influenza A virus (A/duck/Eastern China/1111/2011(H5N2)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1730 1730 100% 0.0 99% JQ041413.1
Select seq gb|JX534568.1| Influenza A virus (A/wild duck/Shandong/628/2011(H5N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1694 1694 100% 0.0 98% JX534568.1
Select seq gb|JX507358.1| Influenza A virus (A/duck/Jiangsu/m234/2012(H5N2)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1691 1691 100% 0.0 98% JX507358.1
Select seq gb|GU727656.1| Influenza A virus (A/duck/Eastern China/008/2008(H5N5)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1691 1691 100% 0.0 98% GU727656.1
Select seq gb|GU727680.1| Influenza A virus (A/duck/Eastern China/909/2009(H5N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1691 1691 100% 0.0 98% GU727680.1
Select seq gb|KR233677.1| Influenza A virus (A/eurasian wigeon/Netherlands/1/2014(H5N8)) segment 7 matrix protein 1 (M1) and matrix protein 2 (M2) genes, partial cds 1689 1689 97% 0.0 99% KR233677.1
Select seq gb|GU727672.1| Influenza A virus (A/duck/Eastern China/108/2008(H5N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1685 1685 100% 0.0 98% GU727672.1
Select seq gb|JQ973681.1| Influenza A virus (A/quail/Jiangsu/k0104/2010(H5N5)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1682 1682 100% 0.0 98% JQ973681.1
Select seq gb|JQ041414.1| Influenza A virus (A/goose/Eastern China/1112/2011(H5N2)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1682 1682 100% 0.0 98% JQ041414.1
Select seq gb|JQ973673.1| Influenza A virus (A/goose/Shandong/k1204/2009(H5N5)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1673 1673 100% 0.0 98% JQ973673.1
Select seq gb|KR232367.1| Influenza A virus (A/eurasian wigeon/Netherlands/1/2015(H5N8)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, partial cds 1667 1667 95% 0.0 99% KR232367.1
Select seq gb|JQ973697.1| Influenza A virus (A/duck/Jiangsu/k1203/2010(H5N8)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1663 1663 100% 0.0 98% JQ973697.1
Select seq gb|KP233707.1| Influenza A virus (A/duck/Hunan/316/2005(H5N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1658 1658 100% 0.0 97% KP233707.1
Select seq gb|CY091646.1| Influenza A virus (A/duck/Guangdong/wy24/2008(H5N5)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1658 1658 100% 0.0 97% CY091646.1
Select seq gb|CY091630.1| Influenza A virus (A/duck/Guangdong/wy11/2008(H5N5)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1658 1658 100% 0.0 97% CY091630.1
Select seq gb|EU195403.1| Influenza A virus (A/mallard/Huadong/lk/2005(H5N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1658 1658 100% 0.0 97% EU195403.1
Select seq gb|DQ835316.1| Influenza A virus (A/China/GD01/2006(H5N1)) segment 7, complete sequence 1658 1658 100% 0.0 97% DQ835316.1
Select seq gb|EF124162.1| Influenza A virus (A/chicken/Guiyang/3923/2005(H5N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1658 1658 100% 0.0 97% EF124162.1
Select seq gb|CY091638.1| Influenza A virus (A/duck/Guangdong/wy19/2008(H5N5)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1654 1654 100% 0.0 97% CY091638.1
Select seq gb|JQ973689.1| Influenza A virus (A/goose/Guangdong/k0103/2010(H5N5)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1654 1654 100% 0.0 97% JQ973689.1
Select seq gb|JX878686.1| Influenza A virus (A/duck/HuBei/03/2010(H5N5)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1654 1654 100% 0.0 97% JX878686.1
Select seq gb|HM172131.1| Influenza A virus (A/shrike/Tibet/13/2006(H5N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1654 1654 100% 0.0 97% HM172131.1
Select seq gb|HM172119.1| Influenza A virus (A/duck/Hubei/49/2005(H5N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1654 1654 100% 0.0 97% HM172119.1
Select seq dbj|AB462298.1| Influenza A virus (A/Shanghai/1/2006(H5N1)) genomic RNA, segment 7, complete sequence 1654 1654 100% 0.0 97% AB462298.1
Select seq gb|EU329180.1| Influenza A virus (A/wild duck/Hunan/021/2005(H5N1)) segment 7, complete sequence 1654 1654 100% 0.0 97% EU329180.1
Select seq gb|EF124087.1| Influenza A virus (A/chicken/Guiyang/4059/2005(H5N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1654 1654 100% 0.0 97% EF124087.1
Select seq gb|EF124069.1| Influenza A virus (A/duck/Guangxi/4428/2005(H5N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1654 1654 100% 0.0 97% EF124069.1
Select seq gb|KJ028475.1| Influenza A virus (A/duck/Laos/3295/2006(H5N1)) segment 7 matrix protein 2 (M2) gene, partial cds; and matrix protein 1 (M1) gene, complete cds 1649 1649 99% 0.0 97% KJ028475.1
Select seq gb|CY098848.1| Influenza A virus (A/water/Hunan/3/2009(H5N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1649 1649 100% 0.0 97% CY098848.1
Select seq gb|CY098841.1| Influenza A virus (A/environment/Xinjiang/6/2009(H5N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1649 1649 100% 0.0 97% CY098841.1
Select seq gb|HM172150.1| Influenza A virus (A/chicken/Hunan/1/2009(H5N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1649 1649 100% 0.0 97% HM172150.1
Select seq gb|HM172133.1| Influenza A virus (A/duck/Anhui/1/06(H5N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1649 1649 100% 0.0 97% HM172133.1
Select seq gb|HM172118.1| Influenza A virus (A/chicken/Sichuan/81/2005(H5N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1649 1649 100% 0.0 97% HM172118.1
Select seq gb|CY036144.1| Influenza A virus (A/chestnut munia/Hong Kong/2442/2007(H5N1)) segment 7 sequence 1649 1649 100% 0.0 97% CY036144.1
Select seq gb|CY036136.1| Influenza A virus (A/scaly-breasted munia/Hong Kong/2433/2007(H5N1)) segment 7 sequence 1649 1649 100% 0.0 97% CY036136.1
Select seq gb|CY030932.1| Influenza A virus (A/goose/Yunnan/4985/2006(H5N1)) segment 7 sequence 1649 1649 100% 0.0 97% CY030932.1
Select seq gb|CY030908.1| Influenza A virus (A/goose/Yunnan/3798/2006(H5N1)) segment 7 sequence 1649 1649 100% 0.0 97% CY030908.1
Select seq gb|CY030884.1| Influenza A virus (A/duck/Yunnan/4873/2006(H5N1)) segment 7 sequence 1649 1649 100% 0.0 97% CY030884.1
Select seq gb|EU124189.1| Influenza A virus (A/Chicken/Laos/Xaythiani 32/2006(H5N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1649 1649 100% 0.0 97% EU124189.1
Select seq gb|EF124171.1| Influenza A virus (A/duck/Hunan/1204/2006(H5N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1649 1649 100% 0.0 97% EF124171.1
Select seq gb|EF124169.1| Influenza A virus (A/duck/Guiyang/1722/2006(H5N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1649 1649 100% 0.0 97% EF124169.1
Select seq gb|EF124090.1| Influenza A virus (A/duck/Guiyang/497/2006(H5N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1649 1649 100% 0.0 97% EF124090.1
Select seq gb|EF124072.1| Influenza A virus (A/chicken/Guangxi/4989/2005(H5N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1649 1649 100% 0.0 97% EF124072.1
Select seq gb|DQ997409.1| Influenza A virus (A/duck/Zhejiang/bj/2002(H5N1)) segment 7, complete sequence 1649 1649 100% 0.0 97% DQ997409.1
Select seq gb|CY029317.1| Influenza A virus (A/duck/Hunan/533/2004(H5N1)) segment 7 sequence 1647 1647 99% 0.0 97% CY029317.1
Select seq gb|EF124052.1| Influenza A virus (A/common magpie/Hong Kong/645/2006(H5N1)) matrix protein 2 (M2) gene, partial cds; and matrix protein 1 (M1) gene, complete cds 1647 1647 99% 0.0 97% EF124052.1
Select seq gb|KJ476675.1| Influenza A virus (A/duck/Zhejiang/W24/2013(H5N8)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1645 1645 100% 0.0 97% KJ476675.1
Select seq dbj|AB478036.1| Influenza A virus (A/chicken/Hmawbi/517/2007(H5N1)) M2, M1 genes for matrix protein 2, matrix protein 1, complete cds 1645 1645 100% 0.0 97% AB478036.1
Select seq gb|JX420129.1| Influenza A virus (A/duck/Soc Trang/31/2007(H5N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1645 1645 100% 0.0 97% JX420129.1
Select seq gb|JX420145.1| Influenza A virus (A/chicken/Hanoi/45/2007(H5N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1645 1645 100% 0.0 97% JX420145.1
Select seq gb|JX420193.1| Influenza A virus (A/Muscovy duck/Ca Mau/22/2007(H5N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1645 1645 100% 0.0 97% JX420193.1
Select seq gb|HM006754.1| Influenza A virus (A/Chicken/Laos/Xaythiani 26/2006(H5N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1645 1645 100% 0.0 97% HM006754.1
Select seq gb|EU930981.3| Influenza A virus (A/Muscovy duck/Vietnam/213/2005(H5N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1645 1645 100% 0.0 97% EU930981.3
Select seq gb|HM172155.1| Influenza A virus (A/duck/Hunan/69/2004(H5N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1645 1645 100% 0.0 97% HM172155.1
Select seq gb|GU186733.1| Influenza A virus (A/chicken/Ninh Binh/209/2005(H5N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1645 1645 100% 0.0 97% GU186733.1
Select seq gb|CY041041.1| Influenza A virus (A/duck/Laos/25/2006(H5N1)) segment 7 sequence 1645 1645 100% 0.0 97% CY041041.1
Select seq gb|FJ784887.1| Influenza A virus (A/duck/Hunan/3315/2006(H5N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1645 1645 100% 0.0 97% FJ784887.1
Select seq gb|FJ784879.1| Influenza A virus (A/chicken/Hunan/1793/2007(H5N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1645 1645 100% 0.0 97% FJ784879.1
Select seq gb|FJ784877.1| Influenza A virus (A/duck/Henan/1650/2006(H5N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1645 1645 100% 0.0 97% FJ784877.1
Select seq gb|EU930949.1| Influenza A virus (A/chicken/Vietnam/209/2005(H5N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1645 1645 100% 0.0 97% EU930949.1
Select seq gb|EU930957.1| Influenza A virus (A/duck/Vietnam/210/2005(H5N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1645 1645 100% 0.0 97% EU930957.1
Select seq gb|EU930965.1| Influenza A virus (A/Muscovy duck/Vietnam/211/2005(H5N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1645 1645 100% 0.0 97% EU930965.1
Select seq gb|EU930973.1| Influenza A virus (A/chicken/Vietnam/212/2005(H5N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1645 1645 100% 0.0 97% EU930973.1
Select seq gb|EU930997.1| Influenza A virus (A/chicken/Vietnam/216/2005(H5N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1645 1645 100% 0.0 97% EU930997.1
Select seq gb|EU931021.1| Influenza A virus (A/duck/Vietnam/219/2005(H5N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1645 1645 100% 0.0 97% EU931021.1
Select seq gb|CY030988.1| Influenza A virus (A/goose/Yunnan/6384/2006(H5N1)) segment 7 sequence 1645 1645 100% 0.0 97% CY030988.1
Select seq gb|CY030948.1| Influenza A virus (A/goose/Yunnan/5540/2006(H5N1)) segment 7 sequence 1645 1645 100% 0.0 97% CY030948.1
Select seq gb|CY030924.1| Influenza A virus (A/goose/Yunnan/4389/2006(H5N1)) segment 7 sequence 1645 1645 100% 0.0 97% CY030924.1
Select seq gb|CY030916.1| Influenza A virus (A/goose/Yunnan/4371/2006(H5N1)) segment 7 sequence 1645 1645 100% 0.0 97% CY030916.1
Select seq gb|EU263984.1| Influenza A virus (A/human/China/GD02/2006(H5N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1645 1645 100% 0.0 97% EU263984.1
Select seq gb|EF137707.1| Influenza A virus (A/Shenzhen/406H/2006(H5N1)) matrix protein (M) gene, complete cds 1645 1645 100% 0.0 97% EF137707.1
Select seq gb|EU124191.1| Influenza A virus (A/Chicken/Laos/Xaythiani 37/2006(H5N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1645 1645 100% 0.0 97% EU124191.1
Select seq gb|EU124190.1| Influenza A virus (A/Chicken/Laos/Xaythiani 36/2006(H5N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1645 1645 100% 0.0 97% EU124190.1
Select seq gb|EF124186.1| Influenza A virus (A/goose/Guangxi/1898/2006(H5N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1645 1645 100% 0.0 97% EF124186.1
Select seq gb|EF124183.1| Influenza A virus (A/duck/Guangxi/1550/2006(H5N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1645 1645 100% 0.0 97% EF124183.1
Select seq gb|EF124182.1| Influenza A virus (A/goose/Guangxi/1458/2006(H5N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1645 1645 100% 0.0 97% EF124182.1
Select seq gb|EF124117.1| Influenza A virus (A/chicken/Fujian/584/2006(H5N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1645 1645 100% 0.0 97% EF124117.1
Select seq gb|EF124106.1| Influenza A virus (A/duck/Fujian/9651/2005(H5N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1645 1645 100% 0.0 97% EF124106.1
Select seq gb|EF124099.1| Influenza A virus (A/duck/Hunan/5106/2005(H5N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1645 1645 100% 0.0 97% EF124099.1
Select seq gb|EF124092.1| Influenza A virus (A/duck/Shantou/13323/2005(H5N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1645 1645 100% 0.0 97% EF124092.1
Select seq gb|EF124088.1| Influenza A virus (A/chicken/Guiyang/29/2006(H5N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1645 1645 100% 0.0 97% EF124088.1
Select seq gb|EF124081.1| Influenza A virus (A/duck/Guangxi/392/2006(H5N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1645 1645 100% 0.0 97% EF124081.1
Select seq gb|EF124078.1| Influenza A virus (A/duck/Guangxi/150/2006(H5N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1645 1645 100% 0.0 97% EF124078.1
Select seq gb|EF124068.1| Influenza A virus (A/goose/Guangxi/4289/2005(H5N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1645 1645 100% 0.0 97% EF124068.1
Select seq gb|EF124053.1| Influenza A virus (A/little egret/Hong Kong/718/2006(H5N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1645 1645 100% 0.0 97% EF124053.1
Select seq gb|EF124048.1| Influenza A virus (A/magpie robin/Hong Kong/75/2006(H5N1)) matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1645 1645 100% 0.0 97% EF124048.1
Select seq gb|DQ256136.1| Influenza A virus (A/crested eagle/Belgium/01/2004(H5N1)) M2 protein (M2) and matrix protein 1 (M1) genes, complete cds 1645 1645 100% 0.0 97% DQ256136.1
Select seq gb|KR233693.1| Influenza A virus (A/chicken/Netherlands/emc-3/2014(H5N8)) segment 7 matrix protein 1 (M1) and matrix protein 2 (M2) genes, partial cds 1644 1644 93% 0.0 99% KR233693.1
Select seq gb|CY029324.1| Influenza A virus (A/duck/Hunan/733/2004(H5N1)) segment 7 sequence 1644 1644 99% 0.0 97% CY029324.1
Select seq gb|EF124115.1| Influenza A virus (A/chicken/Fujian/11933/2005(H5N1)) matrix protein 2 (M2) gene, partial cds; and matrix protein 1 (M1) gene, complete cds 1642 1642 99% 0.0 97% EF124115.1
Select seq gb|EF124089.1| Influenza A virus (A/duck/Guiyang/293/2006(H5N1)) matrix protein 2 (M2) gene, partial cds; and matrix protein 1 (M1) gene, complete cds 1642 1642 99% 0.0 97% EF124089.1
Select seq gb|KT221069.1| Influenza A virus (A/goose/Jiangsu/QD5/2014(H5N8)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1640 1640 100% 0.0 97% KT221069.1
Select seq gb|KP414814.1| Influenza A virus (A/duck/Shaoxing/5240/2013(mixed)) clone b segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1640 1640 100% 0.0 97% KP414814.1
Select seq gb|KJ200694.1| Influenza A virus (A/chicken/Hunan/S3003/2009(H6N6)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1640 1640 100% 0.0 97% KJ200694.1
Select seq gb|KJ476676.1| Influenza A virus (A/duck/Zhejiang/6D18/2013(H5N8)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1640 1640 100% 0.0 97% KJ476676.1
Select seq dbj|AB478037.1| Influenza A virus (A/quail/Thanatpin/2283/2007(H5N1)) M2, M1 genes for matrix protein 2, matrix protein 1, complete cds 1640 1640 100% 0.0 97% AB478037.1
Select seq gb|EU930917.2| Influenza A virus (A/duck/Vietnam/205/2005(H5N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1640 1640 100% 0.0 97% EU930917.2
Select seq gb|HM627916.1| Influenza A virus (A/openbill stork/Thailand/VSMU-4-NSN/2004(H5N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1640 1640 100% 0.0 97% HM627916.1
Select seq gb|HM627924.1| Influenza A virus (A/openbill stork/Thailand/VSMU-5-NSN/2004(H5N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1640 1640 100% 0.0 97% HM627924.1
Select seq gb|HM627948.1| Influenza A virus (A/openbill stork/Thailand/VSMU-12-BKK/2003(H5N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1640 1640 100% 0.0 97% HM627948.1
Select seq gb|HM172141.1| Influenza A virus (A/chicken/Hunan/21/2005(H5N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1640 1640 100% 0.0 97% HM172141.1
Select seq gb|HM114540.1| Influenza A virus (A/Vietnam/UT30850/2005(H5N1)) segment 7 matrix protein 2 (M2) gene, partial cds; and matrix protein 1 (M1) gene, complete cds 1640 1640 99% 0.0 97% HM114540.1
Select seq gb|GU186649.1| Influenza A virus (A/duck/Ang Thong/71(2)/2004(H5N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1640 1640 100% 0.0 97% GU186649.1
Select seq gb|GU182185.1| Influenza A virus (A/environment/Hunan/6-69/2008(H5N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1640 1640 100% 0.0 97% GU182185.1
Select seq gb|GU182217.1| Influenza A virus (A/environment/Hunan/1-8/2007(H5N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1640 1640 100% 0.0 97% GU182217.1
Select seq gb|CY040993.1| Influenza A virus (A/chicken/Laos/13/2008(H5N1)) segment 7 sequence 1640 1640 100% 0.0 97% CY040993.1
Select seq gb|CY040906.1| Influenza A virus (A/chicken/Laos/P0072/2007(H5N1)) segment 7 sequence 1640 1640 100% 0.0 97% CY040906.1
Select seq gb|CY040895.1| Influenza A virus (A/chicken/Laos/P0001/2007(H5N1)) segment 7 sequence 1640 1640 100% 0.0 97% CY040895.1
Select seq gb|FJ784888.1| Influenza A virus (A/duck/Hunan/3340/2006(H5N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1640 1640 100% 0.0 97% FJ784888.1
Select seq gb|FJ784881.1| Influenza A virus (A/duck/Hunan/1964/2007(H5N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1640 1640 100% 0.0 97% FJ784881.1
Select seq gb|FJ784880.1| Influenza A virus (A/duck/Hunan/1930/2007(H5N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1640 1640 100% 0.0 97% FJ784880.1
Select seq gb|FJ784875.1| Influenza A virus (A/chicken/Henan/1362/2006(H5N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1640 1640 100% 0.0 97% FJ784875.1
Select seq gb|FJ784874.1| Influenza A virus (A/chicken/Anhui/1089/2007(H5N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1640 1640 100% 0.0 97% FJ784874.1
Select seq gb|FJ784873.1| Influenza A virus (A/duck/Hunan/689/2006(H5N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1640 1640 100% 0.0 97% FJ784873.1
Select seq gb|EU930933.1| Influenza A virus (A/duck/Vietnam/207/2005(H5N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1640 1640 100% 0.0 97% EU930933.1
Select seq gb|EU930941.1| Influenza A virus (A/duck/Vietnam/208/2005(H5N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1640 1640 100% 0.0 97% EU930941.1
Select seq gb|EU930989.1| Influenza A virus (A/duck/Vietnam/215/2005(H5N1)) segment 7 matrix protein 2 (M2) and matrix protein 1 (M1) genes, complete cds 1640 1640 100% 0.0 97% EU930989.1
Select seq gb|CY036208.1| Influenza A virus (A/little egret/Hong Kong/8863/2007(H5N1)) segment 7 sequence 1640 1640 100% 0.0 97% CY036208.1
Select seq gb|CY036056.1| Influenza A virus (A/scaly-breasted munia/Hong Kong/45/2007(H5N1)) segment 7 sequence 1640 1640 100% 0.0 97% CY036056.1
Select seq dbj|AB450632.1| Influenza A virus (A/chicken/Suphanburi/NIAH108192/2005(H5N1)) M2, M1 genes for matrix protein 2, matrix protein 1, complete cds 1640 1640 100% 0.0 97% AB450632.1
Select seq gb|CY030980.1| Influenza A virus (A/goose/Yunnan/6193/2006(H5N1)) segment 7 sequence 1640 1640 100% 0.0 97% CY030980.1
Select seq gb|CY030972.1| Influenza A virus (A/goose/Yunnan/5979/2006(H5N1)) segment 7 sequence 1640 1640 100% 0.0 97% CY030972.1
Select seq gb|CY030964.1| Influenza A virus (A/goose/Yunnan/5769/2006(H5N1)) segment 7 sequence 1640 1640 100% 0.0 97% CY030964.1
Select seq gb|CY030940.1| Influenza A virus (A/goose/Yunnan/5141/2006(H5N1)) segment 7 sequence 1640 1640 100% 0.0 97% CY030940.1
Select seq gb|CY030892.1| Influenza A virus (A/duck/Yunnan/5310/2006(H5N1)) segment 7 sequence 1640 1640 100% 0.0 97% CY030892.1

Author:  niman [ Sun Dec 27, 2015 12:04 pm ]
Post subject:  Re: Fujian H5N8 In Klamath Co OR With Wild Bird PB1 & PA

Select seq gb|KU201749.1| Influenza A virus (A/American wigeon/Oregon/AH0012525/2015(H5N8)) segment 1 polymerase PB2 (PB2) gene, complete cds 4112 4112 100% 0.0 100% KU201749.1
Select seq gb|KP307981.1| Influenza A virus (A/gyrfalcon/Washington/41088-6/2014(H5N8)) segment 1 polymerase PB2 (PB2) gene, complete cds 4112 4112 100% 0.0 100% KP307981.1
Select seq gb|KU201621.1| Influenza A virus (A/mallard/Oregon/AH0003952/2015(H5N2)) segment 1 polymerase PB2 (PB2) gene, complete cds 4107 4107 100% 0.0 99% KU201621.1
Select seq gb|KU201741.1| Influenza A virus (A/Canada goose/Oregon/AH0012452/2015(H5N8)) segment 1 polymerase PB2 (PB2) gene, complete cds 4107 4107 100% 0.0 99% KU201741.1
Select seq gb|KU201805.1| Influenza A virus (A/Northern pintail/Washington/195365/2014(H5N2)) segment 1 polymerase PB2 (PB2) gene, complete cds 4107 4107 100% 0.0 99% KU201805.1
Select seq gb|KU201821.1| Influenza A virus (A/American wigeon/Washington/195968/2014(H5N8)) segment 1 polymerase PB2 (PB2) gene, complete cds 4107 4107 100% 0.0 99% KU201821.1
Select seq gb|KU201837.1| Influenza A virus (A/Northern pintail/Washington/196271/2014(H5N8)) segment 1 polymerase PB2 (PB2) gene, complete cds 4107 4107 100% 0.0 99% KU201837.1
Select seq gb|KU201877.1| Influenza A virus (A/American wigeon/Washington/195198/2014(H5N8)) segment 1 polymerase PB2 (PB2) gene, complete cds 4107 4107 100% 0.0 99% KU201877.1
Select seq gb|KU201885.1| Influenza A virus (A/American wigeon/Washington/195205/2014(H5N8)) segment 1 polymerase PB2 (PB2) gene, complete cds 4107 4107 100% 0.0 99% KU201885.1
Select seq gb|KU201893.1| Influenza A virus (A/mallard/Washington/195246/2014(H5N2)) segment 1 polymerase PB2 (PB2) gene, complete cds 4107 4107 100% 0.0 99% KU201893.1
Select seq gb|KU201901.1| Influenza A virus (A/peregrine falcon/Washington/196426/2014(H5N8)) segment 1 polymerase PB2 (PB2) gene, complete cds 4107 4107 100% 0.0 99% KU201901.1
Select seq gb|KR150898.1| Influenza A virus (A/turkey/California/K1500169-1.2/2015(H5N8)) segment 1 polymerase PB2 (PB2) gene, complete cds 4107 4107 100% 0.0 99% KR150898.1
Select seq gb|KP739410.1| Influenza A virus (A/guinea fowl/Oregon/41613-1/2014(H5N8)) segment 1 polymerase PB2 (PB2) gene, complete cds 4107 4107 100% 0.0 99% KP739410.1
Select seq gb|KP307954.1| Influenza A virus (A/turkey/BC/FAV10/2014(H5N2)) segment 1 polymerase PB2 (PB2) gene, complete cds 4107 4107 100% 0.0 99% KP307954.1
Select seq gb|KU201645.1| Influenza A virus (A/wood duck/Oregon/AH0007257/2015(H5N2)) segment 1 polymerase PB2 (PB2) gene, complete cds 4103 4103 100% 0.0 99% KU201645.1
Select seq gb|KU201653.1| Influenza A virus (A/wood duck/Oregon/AH0007263/2015(H5N2)) segment 1 polymerase PB2 (PB2) gene, complete cds 4103 4103 100% 0.0 99% KU201653.1
Select seq gb|KU201661.1| Influenza A virus (A/Northern shoveler/Oregon/AH0007332/2015(H5N2)) segment 1 polymerase PB2 (PB2) gene, complete cds 4103 4103 100% 0.0 99% KU201661.1
Select seq gb|KU201709.1| Influenza A virus (A/mallard/Idaho/AH0007412/2015(H5N2)) segment 1 polymerase PB2 (PB2) gene, complete cds 4103 4103 100% 0.0 99% KU201709.1
Select seq gb|KU201717.1| Influenza A virus (A/mallard/Idaho/AH0007413/2015(H5N2)) segment 1 polymerase PB2 (PB2) gene, complete cds 4103 4103 100% 0.0 99% KU201717.1
Select seq gb|KU201765.1| Influenza A virus (A/mallard/Idaho/AH0005954/2014(H5N8)) segment 1 polymerase PB2 (PB2) gene, complete cds 4103 4103 100% 0.0 99% KU201765.1
Select seq gb|KU201781.1| Influenza A virus (A/mallard/Oregon/AH0003821/2014(H5N2)) segment 1 polymerase PB2 (PB2) gene, complete cds 4103 4103 100% 0.0 99% KU201781.1
Select seq gb|KU201829.1| Influenza A virus (A/mallard/Washington/196262/2015(H5N2)) segment 1 polymerase PB2 (PB2) gene, complete cds 4103 4103 100% 0.0 99% KU201829.1
Select seq gb|KU201869.1| Influenza A virus (A/mallard/Oregon/195536/2014(H5N8)) segment 1 polymerase PB2 (PB2) gene, complete cds 4103 4103 100% 0.0 99% KU201869.1
Select seq gb|KP795726.1| Influenza A virus (A/chicken/BC/FAV8/2014(H5N2)) segment 1 polymerase PB2 (PB2) gene, complete cds 4103 4103 100% 0.0 99% KP795726.1
Select seq gb|KP795734.1| Influenza A virus (A/chicken/BC/FAV9/2014(H5N2)) segment 1 polymerase PB2 (PB2) gene, complete cds 4103 4103 100% 0.0 99% KP795734.1
Select seq gb|KP307973.1| Influenza A virus (A/Northern pintail/Washington/40964/2014(H5N2)) segment 1 polymerase PB2 (PB2) gene, complete cds 4103 4103 100% 0.0 99% KP307973.1
Select seq gb|KU201637.1| Influenza A virus (A/wood duck/Oregon/AH0007244/2015(H5N2)) segment 1 polymerase PB2 (PB2) gene, complete cds 4098 4098 100% 0.0 99% KU201637.1
Select seq gb|KU201669.1| Influenza A virus (A/Northern shoveler/Oregon/AH0007337/2015(H5N2)) segment 1 polymerase PB2 (PB2) gene, complete cds 4098 4098 100% 0.0 99% KU201669.1
Select seq gb|KU201677.1| Influenza A virus (A/Northern shoveler/Oregon/AH0007339/2015(H5N2)) segment 1 polymerase PB2 (PB2) gene, complete cds 4098 4098 100% 0.0 99% KU201677.1
Select seq gb|KU201693.1| Influenza A virus (A/mallard/Oregon/AH0008887/2015(H5N2)) segment 1 polymerase PB2 (PB2) gene, complete cds 4098 4098 100% 0.0 99% KU201693.1
Select seq gb|KU201701.1| Influenza A virus (A/Northern pintail/Oregon/AH0003871/2015(H5N2)) segment 1 polymerase PB2 (PB2) gene, complete cds 4098 4098 100% 0.0 99% KU201701.1
Select seq gb|KU201733.1| Influenza A virus (A/American green-winged teal/Oregon/AH0012403/2015(H5N2)) segment 1 polymerase PB2 (PB2) gene, complete cds 4098 4098 100% 0.0 99% KU201733.1
Select seq gb|KU201789.1| Influenza A virus (A/chicken/California/15-004912/2015(H5N8)) segment 1 polymerase PB2 (PB2) gene, complete cds 4098 4098 100% 0.0 99% KU201789.1
Select seq gb|KU201813.1| Influenza A virus (A/mallard/Oregon/195547/2014(H5N2)) segment 1 polymerase PB2 (PB2) gene, complete cds 4098 4098 100% 0.0 99% KU201813.1
Select seq gb|KU201845.1| Influenza A virus (A/mallard/Washington/196865/2015(H5N2)) segment 1 polymerase PB2 (PB2) gene, complete cds 4098 4098 100% 0.0 99% KU201845.1
Select seq gb|KU201853.1| Influenza A virus (A/American wigeon/Washington/196336/2015(H5N1)) segment 1 polymerase PB2 (PB2) gene, complete cds 4098 4098 100% 0.0 99% KU201853.1
Select seq gb|KU201909.1| Influenza A virus (A/mallard/Washington/195810/2014(H5N2)) segment 1 polymerase PB2 (PB2) gene, complete cds 4098 4098 100% 0.0 99% KU201909.1
Select seq gb|KT762881.1| Influenza A virus (A/chicken/Montana/15-010559-1/2015(H5N2)) segment 1 polymerase PB2 (PB2) gene, complete cds 4098 4098 100% 0.0 99% KT762881.1
Select seq gb|KT762905.1| Influenza A virus (A/turkey/Wisconsin/15-012012-2/2015(H5N2)) segment 1 polymerase PB2 (PB2) gene, complete cds 4098 4098 100% 0.0 99% KT762905.1
Select seq gb|KT762929.1| Influenza A virus (A/turkey/South Dakota/15-010371/2015(H5N2)) segment 1 polymerase PB2 (PB2) gene, complete cds 4098 4098 100% 0.0 99% KT762929.1
Select seq gb|KR234035.1| Influenza A virus (A/turkey/Minnesota/9845-4/2015(H5N2)) segment 1 polymerase PB2 (PB2) gene, complete cds 4098 4098 100% 0.0 99% KR234035.1
Select seq gb|KP739394.1| Influenza A virus (A/turkey/Washington/61-22/2014(H5N2)) segment 1 polymerase PB2 (PB2) gene, complete cds 4098 4098 100% 0.0 99% KP739394.1
Select seq gb|KP739418.1| Influenza A virus (A/American green-winged teal/Washington/195750/2014(H5N1)) segment 1 polymerase PB2 (PB2) gene, complete cds 4098 4098 100% 0.0 99% KP739418.1
Select seq gb|KU201613.1| Influenza A virus (A/American wigeon/Utah/AH0007824/2015(H5N8)) segment 1 polymerase PB2 (PB2) gene, complete cds 4094 4094 100% 0.0 99% KU201613.1
Select seq gb|KU201757.1| Influenza A virus (A/mallard/Nevada/AH0006855/2015(H5N8)) segment 1 polymerase PB2 (PB2) gene, complete cds 4094 4094 100% 0.0 99% KU201757.1
Select seq gb|KU201773.1| Influenza A virus (A/mallard/Idaho/AH0005955/2014(H5N8)) segment 1 polymerase PB2 (PB2) gene, complete cds 4094 4094 100% 0.0 99% KU201773.1
Select seq gb|KU201797.1| Influenza A virus (A/bald eagle/Idaho/15-002892-2/2015(H5N8)) segment 1 polymerase PB2 (PB2) gene, complete cds 4094 4094 100% 0.0 99% KU201797.1
Select seq gb|KU201925.1| Influenza A virus (A/Cooper's hawk/Minnesota/198225/2015(H5N2)) segment 1 polymerase PB2 (PB2) gene, complete cds 4094 4094 100% 0.0 99% KU201925.1
Select seq gb|KT762889.1| Influenza A virus (A/turkey/North Dakota/15-011420-13/2015(H5N2)) segment 1 polymerase PB2 (PB2) gene, complete cds 4094 4094 100% 0.0 99% KT762889.1
Select seq gb|KT762897.1| Influenza A virus (A/chicken/Nebraska/15-017897-1/2015(H5N2)) segment 1 polymerase PB2 (PB2) gene, complete cds 4094 4094 100% 0.0 99% KT762897.1
Select seq gb|KT762921.1| Influenza A virus (A/chicken/Minnesota/15-013533-1/2015(H5N2)) segment 1 polymerase PB2 (PB2) gene, complete cds 4094 4094 100% 0.0 99% KT762921.1
Select seq gb|KT280929.1| Influenza A virus (A/chicken/Iowa/21981/2015(H5N2)) segment 1 polymerase PB2 (PB2) gene, complete cds 4094 4094 100% 0.0 99% KT280929.1
Select seq gb|KT002478.1| Influenza A virus (A/turkey/Iowa/13541-1/2015(H5N2)) segment 1 polymerase PB2 (PB2) gene, complete cds 4094 4094 100% 0.0 99% KT002478.1
Select seq gb|KT002486.1| Influenza A virus (A/chicken/Iowa/13542-2/2015(H5N2)) segment 1 polymerase PB2 (PB2) gene, complete cds 4094 4094 100% 0.0 99% KT002486.1
Select seq gb|KT002494.1| Influenza A virus (A/turkey/Iowa/14318-1/2015(H5N2)) segment 1 polymerase PB2 (PB2) gene, complete cds 4094 4094 100% 0.0 99% KT002494.1
Select seq gb|KT002526.1| Influenza A virus (A/chicken/Iowa/14589-1/2015(H5N2)) segment 1 polymerase PB2 (PB2) gene, complete cds 4094 4094 100% 0.0 99% KT002526.1
Select seq gb|KR233987.1| Influenza A virus (A/chicken/Washington/3490-18/2015(H5N2)) segment 1 polymerase PB2 (PB2) gene, complete cds 4094 4094 100% 0.0 99% KR233987.1
Select seq gb|KR492971.1| Influenza A virus (A/chicken/Iowa/04-20/2015(H5N2)) segment 1 polymerase PB2 (PB2) gene, complete cds 4094 4094 100% 0.0 99% KR492971.1
Select seq gb|KR150906.1| Influenza A virus (A/pheasant/Washington/3147-2/2015(H5N2)) segment 1 polymerase PB2 (PB2) gene, complete cds 4094 4094 100% 0.0 99% KR150906.1
Select seq gb|KP739378.1| Influenza A virus (A/chicken/Washington/61-9/2014(H5N2)) segment 1 polymerase PB2 (PB2) gene, complete cds 4094 4094 100% 0.0 99% KP739378.1
Select seq gb|KU201605.1| Influenza A virus (A/snow goose/Missouri/15-011246-1/2015(H5N2)) segment 1 polymerase PB2 (PB2) gene, complete cds 4089 4089 100% 0.0 99% KU201605.1
Select seq gb|KU201629.1| Influenza A virus (A/Northern pintail/Oregon/AH0003967/2015(H5N2)) segment 1 polymerase PB2 (PB2) gene, complete cds 4089 4089 100% 0.0 99% KU201629.1
Select seq gb|KU201725.1| Influenza A virus (A/American green-winged teal/Idaho/AH0011899/2015(H5N2)) segment 1 polymerase PB2 (PB2) gene, complete cds 4089 4089 100% 0.0 99% KU201725.1
Select seq gb|KU201861.1| Influenza A virus (A/American wigeon/Washington/196340/2015(H5N1)) segment 1 polymerase PB2 (PB2) gene, complete cds 4089 4089 100% 0.0 99% KU201861.1
Select seq gb|KU201933.1| Influenza A virus (A/snowy owl/Wisconsin/198399/2015(H5N2)) segment 1 polymerase PB2 (PB2) gene, complete cds 4089 4089 100% 0.0 99% KU201933.1
Select seq gb|KU201941.1| Influenza A virus (A/Canada goose/Kansas/197850/2015(H5N2)) segment 1 polymerase PB2 (PB2) gene, complete cds 4089 4089 100% 0.0 99% KU201941.1
Select seq gb|KT762913.1| Influenza A virus (A/turkey/North Dakota/15-013049-1/2015(H5N2)) segment 1 polymerase PB2 (PB2) gene, complete cds 4089 4089 100% 0.0 99% KT762913.1
Select seq gb|KT762937.1| Influenza A virus (A/chicken/Nebraska/15-017990-5/2015(H5N2)) segment 1 polymerase PB2 (PB2) gene, complete cds 4089 4089 100% 0.0 99% KT762937.1
Select seq gb|KT762945.1| Influenza A virus (A/chicken/Wisconsin/15-011595-1/2015(H5N2)) segment 1 polymerase PB2 (PB2) gene, complete cds 4089 4089 100% 0.0 99% KT762945.1
Select seq gb|KT762953.1| Influenza A virus (A/chicken/Wisconsin/15-012160-1/2015(H5N2)) segment 1 polymerase PB2 (PB2) gene, complete cds 4089 4089 100% 0.0 99% KT762953.1
Select seq gb|KT002470.1| Influenza A virus (A/turkey/Iowa/11762-1/2015(H5N2)) segment 1 polymerase PB2 (PB2) gene, complete cds 4089 4089 100% 0.0 99% KT002470.1
Select seq gb|KT002502.1| Influenza A virus (A/turkey/Iowa/14319-1/2015(H5N2)) segment 1 polymerase PB2 (PB2) gene, complete cds 4089 4089 100% 0.0 99% KT002502.1
Select seq gb|KT002510.1| Influenza A virus (A/chicken/Iowa/14322-6/2015(H5N2)) segment 1 polymerase PB2 (PB2) gene, complete cds 4089 4089 100% 0.0 99% KT002510.1
Select seq gb|KT002518.1| Influenza A virus (A/chicken/Iowa/14399-4/2015(H5N2)) segment 1 polymerase PB2 (PB2) gene, complete cds 4089 4089 100% 0.0 99% KT002518.1
Select seq gb|KR234019.1| Influenza A virus (A/turkey/Arkansas/7791-1/2015(H5N2)) segment 1 polymerase PB2 (PB2) gene, complete cds 4089 4089 100% 0.0 99% KR234019.1
Select seq gb|KR233995.1| Influenza A virus (A/chicken/Oregon/A01819044/2015(H5N2)) segment 1 polymerase PB2 (PB2) gene, complete cds 4089 4089 100% 0.0 99% KR233995.1
Select seq gb|KR233979.1| Influenza A virus (A/turkey/Minnesota/9892-2/2015(H5N2)) segment 1 polymerase PB2 (PB2) gene, complete cds 4089 4089 100% 0.0 99% KR233979.1
Select seq gb|KU201917.1| Influenza A virus (A/Canada goose/Washington/197619/2014(H5N2)) segment 1 polymerase PB2 (PB2) gene, complete cds 4085 4085 100% 0.0 99% KU201917.1
Select seq gb|KR234027.1| Influenza A virus (A/chicken/Kansas/8395-3/2015(H5N2)) segment 1 polymerase PB2 (PB2) gene, complete cds 4085 4085 100% 0.0 99% KR234027.1
Select seq gb|KR234011.1| Influenza A virus (A/turkey/Missouri/7458-1/2015(H5N2)) segment 1 polymerase PB2 (PB2) gene, complete cds 4085 4085 100% 0.0 99% KR234011.1
Select seq gb|KU201685.1| Influenza A virus (A/mallard/Idaho/AH0008597/2015(H5N8)) segment 1 polymerase PB2 (PB2) gene, complete cds 4080 4080 100% 0.0 99% KU201685.1
Select seq gb|KR234003.1| Influenza A virus (A/turkey/Minnesota/7172-1/2015(H5N2)) segment 1 polymerase PB2 (PB2) gene, complete cds 4080 4080 100% 0.0 99% KR234003.1
Select seq gb|KT388705.1| Influenza A virus (A/goose/Taiwan/TNO20/2015(H5N8)) segment 1 cRNA sequence 4076 4076 100% 0.0 99% KT388705.1
Select seq gb|KT388673.1| Influenza A virus (A/goose/Taiwan/TNO16/2015(H5N8)) segment 1 cRNA sequence 4076 4076 100% 0.0 99% KT388673.1
Select seq gb|KT388665.1| Influenza A virus (A/goose/Taiwan/TNO15/2015(H5N8)) segment 1 cRNA sequence 4076 4076 100% 0.0 99% KT388665.1
Select seq gb|KT388617.1| Influenza A virus (A/goose/Taiwan/TNO9/2015(H5N8)) segment 1 cRNA sequence 4076 4076 100% 0.0 99% KT388617.1
Select seq gb|KT388593.1| Influenza A virus (A/goose/Taiwan/TNO6/2015(H5N8)) segment 1 cRNA sequence 4076 4076 100% 0.0 99% KT388593.1
Select seq gb|KT388577.1| Influenza A virus (A/goose/Taiwan/TNO4/2015(H5N8)) segment 1 cRNA sequence 4076 4076 100% 0.0 99% KT388577.1
Select seq gb|KT388569.1| Influenza A virus (A/goose/Taiwan/TNO3/2015(H5N8)) segment 1 cRNA sequence 4076 4076 100% 0.0 99% KT388569.1
Select seq gb|KT388561.1| Influenza A virus (A/goose/Taiwan/TNO2/2015(H5N8)) segment 1 cRNA sequence 4076 4076 100% 0.0 99% KT388561.1
Select seq gb|KT388521.1| Influenza A virus (A/goose/Taiwan/TNC11/2015(H5N8)) segment 1 cRNA sequence 4076 4076 100% 0.0 99% KT388521.1
Select seq gb|KT388473.1| Influenza A virus (A/goose/Taiwan/TNC5/2015(H5N8)) segment 1 cRNA sequence 4076 4076 100% 0.0 99% KT388473.1
Select seq gb|KT388465.1| Influenza A virus (A/goose/Taiwan/TNC4/2015(H5N8)) segment 1 cRNA sequence 4076 4076 100% 0.0 99% KT388465.1
Select seq gb|KT388657.1| Influenza A virus (A/goose/Taiwan/TNO14/2015(H5N8)) segment 1 cRNA sequence 4071 4071 100% 0.0 99% KT388657.1
Select seq gb|KT388625.1| Influenza A virus (A/goose/Taiwan/TNO10/2015(H5N8)) segment 1 cRNA sequence 4071 4071 100% 0.0 99% KT388625.1
Select seq gb|KT388601.1| Influenza A virus (A/goose/Taiwan/TNO7/2015(H5N8)) segment 1 cRNA sequence 4071 4071 100% 0.0 99% KT388601.1
Select seq gb|KT388505.1| Influenza A virus (A/goose/Taiwan/TNC9/2015(H5N8)) segment 1 cRNA sequence 4071 4071 100% 0.0 99% KT388505.1
Select seq gb|KJ756564.1| Influenza A virus (A/baikal teal/Korea/1445/2014(H5N8)) segment 1 polymerase PB2 (PB2) gene, complete cds 4071 4071 100% 0.0 99% KJ756564.1
Select seq gb|KJ509137.1| Influenza A virus (A/bean goose/Korea/H328/2014(H5N8)) segment 1 polymerase PB2 (PB2) gene, complete cds 4071 4071 100% 0.0 99% KJ509137.1
Select seq gb|KT388697.1| Influenza A virus (A/goose/Taiwan/TNO19/2015(H5N8)) segment 1 cRNA sequence 4067 4067 100% 0.0 99% KT388697.1
Select seq gb|KT388689.1| Influenza A virus (A/goose/Taiwan/TNO18/2015(H5N8)) segment 1 cRNA sequence 4067 4067 100% 0.0 99% KT388689.1
Select seq gb|KT388681.1| Influenza A virus (A/goose/Taiwan/TNO17/2015(H5N8)) segment 1 cRNA sequence 4067 4067 100% 0.0 99% KT388681.1
Select seq gb|KT388649.1| Influenza A virus (A/goose/Taiwan/TNO13/2015(H5N8)) segment 1 cRNA sequence 4067 4067 100% 0.0 99% KT388649.1
Select seq gb|KT388641.1| Influenza A virus (A/goose/Taiwan/TNO12/2015(H5N8)) segment 1 cRNA sequence 4067 4067 100% 0.0 99% KT388641.1
Select seq gb|KT388633.1| Influenza A virus (A/goose/Taiwan/TNO11/2015(H5N8)) segment 1 cRNA sequence 4067 4067 100% 0.0 99% KT388633.1
Select seq gb|KT388609.1| Influenza A virus (A/goose/Taiwan/TNO8/2015(H5N8)) segment 1 cRNA sequence 4067 4067 100% 0.0 99% KT388609.1
Select seq gb|KT388553.1| Influenza A virus (A/goose/Taiwan/TNO1/2015(H5N8)) segment 1 cRNA sequence 4067 4067 100% 0.0 99% KT388553.1
Select seq gb|KT388545.1| Influenza A virus (A/goose/Taiwan/TNC14/2015(H5N8)) segment 1 cRNA sequence 4067 4067 100% 0.0 99% KT388545.1
Select seq gb|KT388537.1| Influenza A virus (A/goose/Taiwan/TNC13/2015(H5N8)) segment 1 cRNA sequence 4067 4067 100% 0.0 99% KT388537.1
Select seq gb|KT388529.1| Influenza A virus (A/goose/Taiwan/TNC12/2015(H5N8)) segment 1 cRNA sequence 4067 4067 100% 0.0 99% KT388529.1
Select seq gb|KT388513.1| Influenza A virus (A/goose/Taiwan/TNC10/2015(H5N8)) segment 1 cRNA sequence 4067 4067 100% 0.0 99% KT388513.1
Select seq gb|KT388497.1| Influenza A virus (A/goose/Taiwan/TNC8/2015(H5N8)) segment 1 cRNA sequence 4067 4067 100% 0.0 99% KT388497.1
Select seq gb|KT388489.1| Influenza A virus (A/goose/Taiwan/TNC7/2015(H5N8)) segment 1 cRNA sequence 4067 4067 100% 0.0 99% KT388489.1
Select seq gb|KT388481.1| Influenza A virus (A/goose/Taiwan/TNC6/2015(H5N8)) segment 1 cRNA sequence 4067 4067 100% 0.0 99% KT388481.1
Select seq gb|KT388457.1| Influenza A virus (A/goose/Taiwan/TNC3/2015(H5N8)) segment 1 cRNA sequence 4067 4067 100% 0.0 99% KT388457.1
Select seq gb|KT388449.1| Influenza A virus (A/goose/Taiwan/TNC2/2015(H5N8)) segment 1 cRNA sequence 4067 4067 100% 0.0 99% KT388449.1
Select seq gb|KT388441.1| Influenza A virus (A/goose/Taiwan/TNC1/2015(H5N8)) segment 1 cRNA sequence 4067 4067 100% 0.0 99% KT388441.1
Select seq gb|KJ756568.1| Influenza A virus (A/baikal teal/Korea/1449/2014(H5N8)) segment 1 polymerase PB2 (PB2) gene, complete cds 4067 4067 100% 0.0 99% KJ756568.1
Select seq gb|KJ756567.1| Influenza A virus (A/baikal teal/Korea/1448/2014(H5N8)) segment 1 polymerase PB2 (PB2) gene, complete cds 4067 4067 100% 0.0 99% KJ756567.1
Select seq gb|KJ756562.1| Influenza A virus (A/baikal teal/Korea/1437/2014(H5N8)) segment 1 polymerase PB2 (PB2) gene, complete cds 4067 4067 100% 0.0 99% KJ756562.1
Select seq gb|KJ508929.1| Influenza A virus (A/Baikal teal/Korea/H41/2014(H5N8)) segment 1 polymerase PB2 (PB2) gene, complete cds 4067 4067 100% 0.0 99% KJ508929.1
Select seq gb|KJ508945.1| Influenza A virus (A/broiler duck/Korea/H48/2014(H5N8)) segment 1 polymerase PB2 (PB2) gene, complete cds 4067 4067 100% 0.0 99% KJ508945.1
Select seq gb|KJ508977.1| Influenza A virus (A/Baikal teal/Korea/H62/2014(H5N8)) segment 1 polymerase PB2 (PB2) gene, complete cds 4067 4067 100% 0.0 99% KJ508977.1
Select seq gb|KJ509073.1| Influenza A virus (A/breeder duck/Korea/H158/2014(H5N8)) segment 1 polymerase PB2 (PB2) gene, complete cds 4067 4067 100% 0.0 99% KJ509073.1
Select seq gb|KJ756572.1| Influenza A virus (A/baikal teal/Korea/1457/2014(H5N8)) segment 1 polymerase PB2 (PB2) gene, complete cds 4062 4062 100% 0.0 99% KJ756572.1
Select seq gb|KJ756563.1| Influenza A virus (A/baikal teal/Korea/1441/2014(H5N8)) segment 1 polymerase PB2 (PB2) gene, complete cds 4062 4062 100% 0.0 99% KJ756563.1
Select seq gb|KJ508985.1| Influenza A virus (A/broiler duck/Korea/H65/2014(H5N8)) segment 1 polymerase PB2 (PB2) gene, complete cds 4062 4062 100% 0.0 99% KJ508985.1
Select seq gb|KJ509049.1| Influenza A virus (A/breeder duck/Korea/H128/2014(H5N8)) segment 1 polymerase PB2 (PB2) gene, complete cds 4062 4062 100% 0.0 99% KJ509049.1
Select seq gb|KJ509105.1| Influenza A virus (A/breeder duck/Korea/H249/2014(H5N8)) segment 1 polymerase PB2 (PB2) gene, complete cds 4062 4062 100% 0.0 99% KJ509105.1
Select seq gb|KJ509113.1| Influenza A virus (A/breeder chicken/Korea/H250/2014(H5N8)) segment 1 polymerase PB2 (PB2) gene, complete cds 4062 4062 100% 0.0 99% KJ509113.1
Select seq gb|KJ509129.1| Influenza A virus (A/mallard/Korea/H297/2014(H5N8)) segment 1 polymerase PB2 (PB2) gene, complete cds 4062 4062 100% 0.0 99% KJ509129.1
Select seq gb|KJ509145.1| Influenza A virus (A/tundra swan/Korea/H411/2014(H5N8)) segment 1 polymerase PB2 (PB2) gene, complete cds 4062 4062 100% 0.0 99% KJ509145.1
Select seq gb|KJ746108.1| Influenza A virus (A/mallard/Korea/W452/2014(H5N8)) segment 1 polymerase PB2 (PB2) gene, complete cds 4062 4062 100% 0.0 99% KJ746108.1
Select seq gb|KJ511809.1| Influenza A virus (A/waterfowl/Korea/S005/2014(H5N8)) segment 1 polymerase PB2 (PB2) gene, complete cds 4062 4062 100% 0.0 99% KJ511809.1
Select seq gb|KJ413839.1| Influenza A virus (A/broiler duck/Korea/Buan2/2014(H5N8)) segment 1 polymerase PB2 (PB2) gene, complete cds 4062 4062 100% 0.0 99% KJ413839.1
Select seq gb|KJ413847.1| Influenza A virus (A/baikal teal/Korea/Donglim3/2014(H5N8)) segment 1 polymerase PB2 (PB2) gene, complete cds 4062 4062 100% 0.0 99% KJ413847.1
Select seq gb|KJ756570.1| Influenza A virus (A/baikal teal/Korea/1454/2014(H5N8)) segment 1 polymerase PB2 (PB2) gene, complete cds 4058 4058 100% 0.0 99% KJ756570.1
Select seq gb|KJ509081.1| Influenza A virus (A/breeder duck/Korea/H200/2014(H5N8)) segment 1 polymerase PB2 (PB2) gene, complete cds 4058 4058 100% 0.0 99% KJ509081.1
Select seq gb|KJ509121.1| Influenza A virus (A/Korean native chicken/Korea/H257/2014(H5N8)) segment 1 polymerase PB2 (PB2) gene, complete cds 4058 4058 100% 0.0 99% KJ509121.1
Select seq gb|KJ509161.1| Influenza A virus (A/spot-billed duck/Korea/H455-42/2014(H5N8)) segment 1 polymerase PB2 (PB2) gene, complete cds 4058 4058 100% 0.0 99% KJ509161.1
Select seq dbj|AB932553.1| Influenza A virus (A/chicken/kumamoto/1-7/2014(H5N8)) PB2 gene for polymerase PB2, complete cds 4058 4058 100% 0.0 99% AB932553.1
Select seq gb|KJ509153.1| Influenza A virus (A/common teal/Korea/H455-30/2014(H5N8)) segment 1 polymerase PB2 (PB2) gene, complete cds 4053 4053 100% 0.0 99% KJ509153.1
Select seq gb|KJ756575.1| Influenza A virus (A/baikal teal/Korea/2402/2014(H5N8)) segment 1 polymerase PB2 (PB2) gene, complete cds 4017 4017 100% 0.0 99% KJ756575.1
Select seq gb|KR233687.2| Influenza A virus (A/chicken/Netherlands/emc-3/2014(H5N8)) segment 1 polymerase PB2 (PB2) gene, partial cds 3979 3979 98% 0.0 99% KR233687.2
Select seq gb|JX534562.1| Influenza A virus (A/wild duck/Shandong/628/2011(H5N1)) segment 1 polymerase PB2 (PB2) gene, complete cds 3945 3945 100% 0.0 98% JX534562.1
Select seq gb|KR232361.1| Influenza A virus (A/eurasian wigeon/Netherlands/1/2015(H5N8)) segment 1 polymerase PB2 (PB2) gene, partial cds 3934 3934 98% 0.0 99% KR232361.1
Select seq gb|KR233679.1| Influenza A virus (A/eurasian wigeon/Netherlands/2/2014(H5N8)) segment 1 polymerase PB2 (PB2) gene, partial cds 3930 3930 97% 0.0 99% KR233679.1
Select seq gb|JQ973691.1| Influenza A virus (A/duck/Jiangsu/k1203/2010(H5N8)) segment 1 polymerase PB2 (PB2) gene, partial cds 3927 3927 99% 0.0 98% JQ973691.1
Select seq gb|KR233671.1| Influenza A virus (A/eurasian wigeon/Netherlands/1/2014(H5N8)) segment 1 polymerase PB2 (PB2) gene, partial cds 3923 3923 97% 0.0 99% KR233671.1
Select seq gb|JX507352.1| Influenza A virus (A/duck/Jiangsu/m234/2012(H5N2)) segment 1 polymerase PB2 (PB2) gene, complete cds 3918 3918 100% 0.0 98% JX507352.1
Select seq gb|KM504098.1| Influenza A virus (A/duck/Shandong/Q1/2013(H5N8)) segment 1 polymerase PB2 (PB2) gene, complete cds 3907 3907 99% 0.0 98% KM504098.1
Select seq gb|CY091624.1| Influenza A virus (A/duck/Guangdong/wy11/2008(H5N5)) polymerase PB2 (PB2) gene, complete cds 3851 3851 100% 0.0 97% CY091624.1
Select seq gb|CY091632.1| Influenza A virus (A/duck/Guangdong/wy19/2008(H5N5)) polymerase PB2 (PB2) gene, complete cds 3842 3842 100% 0.0 97% CY091632.1
Select seq gb|KT383483.1| Influenza A virus (A/duck/Guangdong/s14044/2014(H5N8)) segment 1 polymerase PB2 (PB2) gene, complete cds 3828 3828 100% 0.0 97% KT383483.1
Select seq gb|CY091640.1| Influenza A virus (A/duck/Guangdong/wy24/2008(H5N5)) polymerase PB2 (PB2) gene, complete cds 3782 3782 100% 0.0 97% CY091640.1
Select seq gb|GU727674.1| Influenza A virus (A/duck/Eastern China/909/2009(H5N1)) segment 1 polymerase PB2 (PB2) gene, complete cds 3737 3737 100% 0.0 96% GU727674.1
Select seq gb|GU727650.1| Influenza A virus (A/duck/Eastern China/008/2008(H5N5)) segment 1 polymerase PB2 (PB2) gene, complete cds 3734 3734 100% 0.0 96% GU727650.1
Select seq gb|GU727658.1| Influenza A virus (A/duck/Eastern China/031/2009(H5N5)) segment 1 polymerase PB2 (PB2) gene, complete cds 3734 3734 100% 0.0 96% GU727658.1
Select seq gb|GU727666.1| Influenza A virus (A/duck/Eastern China/108/2008(H5N1)) segment 1 polymerase PB2 (PB2) gene, complete cds 3734 3734 100% 0.0 96% GU727666.1
Select seq gb|JQ973667.1| Influenza A virus (A/goose/Shandong/k1204/2009(H5N5)) segment 1 polymerase PB2 (PB2) gene, complete cds 3707 3707 100% 0.0 96% JQ973667.1
Select seq gb|JQ973683.1| Influenza A virus (A/goose/Guangdong/k0103/2010(H5N5)) segment 1 polymerase PB2 (PB2) gene, complete cds 3701 3701 100% 0.0 96% JQ973683.1
Select seq gb|JQ041390.1| Influenza A virus (A/goose/Eastern China/1112/2011(H5N2)) segment 1 polymerase PB2 (PB2) gene, complete cds 3671 3671 100% 0.0 96% JQ041390.1
Select seq gb|KC282876.1| Influenza A virus (A/duck/Jiangsu/1-15/2011(H4N2)) segment 1 polymerase PB2 (PB2) gene, complete cds 3656 3656 100% 0.0 96% KC282876.1
Select seq gb|JQ041389.1| Influenza A virus (A/duck/Eastern China/1111/2011(H5N2)) segment 1 polymerase PB2 (PB2) gene, complete cds 3629 3629 100% 0.0 95% JQ041389.1
Select seq gb|JN087009.1| Influenza A virus (A/environment/Korea/CSM3/2002(H3N6)) segment 1 polymerase PB2 (PB2) gene, partial cds 3627 3627 99% 0.0 95% JN087009.1
Select seq gb|KU160976.1| Influenza A virus (A/duck/Hunan/S1012/2009(H4N6)) segment 1 polymerase PB2 (PB2) gene, complete cds 3617 3617 100% 0.0 95% KU160976.1
Select seq gb|JN029633.1| Influenza A virus (A/canvasback/Mongolia/2-69/2007(H10N6)) segment 1 polymerase PB2 (PB2) gene, partial cds 3617 3617 99% 0.0 95% JN029633.1
Select seq gb|JN029547.1| Influenza A virus (A/whooper swan/Mongolia/1-14/2007(H3N8)) segment 1 polymerase PB2 (PB2) gene, partial cds 3617 3617 99% 0.0 95% JN029547.1
Select seq gb|JN029613.1| Influenza A virus (A/ruddy shelduck/Mongolia/2-29/2007(H3N2)) segment 1 polymerase PB2 (PB2) gene, partial cds 3613 3613 99% 0.0 95% JN029613.1
Select seq gb|JN029607.1| Influenza A virus (A/pintail/Mongolia/2-11/2007(H4N2)) segment 1 polymerase PB2 (PB2) gene, partial cds 3606 3606 99% 0.0 95% JN029607.1
Select seq gb|JN029647.1| Influenza A virus (A/pintail/Mongolia/2-80/2007(H4N6)) segment 1 polymerase PB2 (PB2) gene, partial cds 3604 3604 99% 0.0 95% JN029647.1
Select seq gb|KC986337.1| Influenza A virus (A/ruddy shelduck/Mongolia/961V/2009(H3N8)) segment 1 polymerase PB2 (PB2) gene, complete cds 3599 3599 100% 0.0 95% KC986337.1
Select seq gb|GU086274.1| Influenza A virus (A/duck/Korea/A14/2008(H5N2)) segment 1 polymerase PB2 (PB2) gene, complete cds 3599 3599 100% 0.0 95% GU086274.1
Select seq gb|JN029578.1| Influenza A virus (A/whooper swan/Mongolia/1-25/2007(H3N8)) segment 1 polymerase PB2 (PB2) gene, partial cds 3593 3593 99% 0.0 95% JN029578.1
Select seq gb|KC986301.1| Influenza A virus (A/ruddy shelduck/Mongolia/590C2/2009(H11N2)) segment 1 polymerase PB2 (PB2) gene, complete cds 3584 3584 100% 0.0 95% KC986301.1
Select seq gb|GQ414795.1| Influenza A virus (A/spot-billed duck/Korea/527/2008(H6N1)) segment 1 polymerase PB2 (PB2) gene, complete cds 3584 3584 100% 0.0 95% GQ414795.1
Select seq gb|KF260766.1| Influenza A virus (A/duck/Guangdong/4323/2007(H11N9)) segment 1 polymerase PB2 (PB2) gene, complete cds 3582 3582 100% 0.0 95% KF260766.1
Select seq gb|KJ764739.1| Influenza A virus (A/duck/Korea/372/2009(H1N1)) segment 1 polymerase PB2 (PB2) gene, complete cds 3580 3580 100% 0.0 95% KJ764739.1
Select seq gb|JX454760.1| Influenza A virus (A/wild duck/Korea/SH5-60/2008(H4N6)) segment 1 polymerase PB2 (PB2) gene, complete cds 3580 3580 100% 0.0 95% JX454760.1
Select seq gb|GQ414796.1| Influenza A virus (A/spot-billed duck/Korea/528/2008(H6N8)) segment 1 polymerase PB2 (PB2) gene, partial cds 3580 3580 99% 0.0 95% GQ414796.1
Select seq gb|KC609823.1| Influenza A virus (A/wild duck/Korea/SH20-27/2008(H7N9)) segment 1 polymerase PB2 (PB2) gene, complete cds 3575 3575 100% 0.0 95% KC609823.1
Select seq gb|GQ414794.1| Influenza A virus (A/spot-billed duck/Korea/540/2008(H6N1)) segment 1 polymerase PB2 (PB2) gene, partial cds 3573 3573 99% 0.0 95% GQ414794.1
Select seq gb|KC609824.1| Influenza A virus (A/wild duck/Korea/CSM27-12/2009(H7N6)) segment 1 polymerase PB2 (PB2) gene, complete cds 3571 3571 100% 0.0 95% KC609824.1
Select seq gb|KC899708.1| Influenza A virus (A/wild duck/SH17-1/2008(H2N3)) segment 1 polymerase PB2 (PB2) gene, complete cds 3571 3571 100% 0.0 95% KC899708.1
Select seq gb|GU086275.1| Influenza A virus (A/duck/Korea/A93/2008(H5N2)) segment 1 polymerase PB2 (PB2) gene, complete cds 3571 3571 100% 0.0 95% GU086275.1
Select seq gb|GQ414790.1| Influenza A virus (A/spot-billed duck/Korea/619/2008(H6N2)) segment 1 polymerase PB2 (PB2) gene, complete cds 3571 3571 100% 0.0 95% GQ414790.1
Select seq gb|AY585523.1| Influenza A virus (A/duck/Zhejiang/11/2000(H5N1)) polymerase basic protein 2 (PB2) mRNA, complete cds 3571 3571 100% 0.0 95% AY585523.1
Select seq gb|KR052701.1| Influenza A virus (A/muskrat/Russia/63/2014(H2N2)) segment 1 polymerase PB2 (PB2) gene, partial cds 3570 3570 99% 0.0 95% KR052701.1
Select seq gb|GQ414798.1| Influenza A virus (A/spot-billed duck/Korea/537/2008(H6N1)) segment 1 polymerase PB2 (PB2) gene, partial cds 3570 3570 99% 0.0 95% GQ414798.1
Select seq gb|GQ414793.1| Influenza A virus (A/spot-billed duck/Korea/545/2008(H6N1)) segment 1 polymerase PB2 (PB2) gene, partial cds 3570 3570 99% 0.0 95% GQ414793.1
Select seq gb|JN029570.1| Influenza A virus (A/whooper swan/Mongolia/1-23/2007(H3N8)) segment 1 polymerase PB2 (PB2) gene, partial cds 3568 3568 99% 0.0 95% JN029570.1
Select seq gb|EU492492.1| Influenza A virus (A/duck/Beijing/61/05(H3N8)) polymerase PB2 (PB2) gene, complete cds 3566 3566 100% 0.0 95% EU492492.1
Select seq gb|JN029585.1| Influenza A virus (A/ruddy shelduck/Mongolia/1-26/2007(H3N8)) segment 1 polymerase PB2 (PB2) gene, partial cds 3564 3564 98% 0.0 95% JN029585.1
Select seq gb|KT318495.1| Influenza A virus (A/duck/Thailand/CU-11655T/2011(H4N6)) segment 1 polymerase PB2 (PB2) gene, complete cds 3562 3562 100% 0.0 95% KT318495.1
Select seq gb|KC986302.1| Influenza A virus (A/northern shoveler/ Mongolia/973/2009(H3N8)) segment 1 polymerase PB2 (PB2) gene, complete cds 3562 3562 100% 0.0 95% KC986302.1
Select seq gb|KF260713.1| Influenza A virus (A/duck/Jiangxi/3096/2009(H7N9)) segment 1 polymerase PB2 (PB2) gene, complete cds 3562 3562 100% 0.0 95% KF260713.1
Select seq gb|JN852810.1| Influenza A virus (A/chicken/Korea/KNUWSJ09/2009(H9N2)) segment 1 polymerase PB2 (PB2) gene, complete cds 3562 3562 100% 0.0 95% JN852810.1
Select seq gb|GU086272.1| Influenza A virus (A/chicken/Korea/A170/2009(H9N2)) segment 1 polymerase PB2 (PB2) gene, complete cds 3562 3562 100% 0.0 95% GU086272.1
Select seq gb|EU492488.1| Influenza A virus (A/duck/Beijing/40/04(H3N8)) polymerase PB2 (PB2) gene, complete cds 3562 3562 100% 0.0 95% EU492488.1
Select seq gb|KC986327.1| Influenza A virus (A/mallard /Mongolia/1551/2010(H3N1)) segment 1 polymerase PB2 (PB2) gene, complete cds 3557 3557 100% 0.0 95% KC986327.1
Select seq gb|JN817613.1| Influenza A virus (A/wild bird/Korea/A323/2009(H10N1)) segment 1 polymerase PB2 (PB2) gene, complete cds 3557 3557 100% 0.0 95% JN817613.1
Select seq gb|HM145697.1| Influenza A virus (A/duck/Hunan/491/2005(H6N2)) segment 1 polymerase PB2 (PB2) gene, complete cds 3557 3557 100% 0.0 95% HM145697.1
Select seq gb|GQ414792.1| Influenza A virus (A/spot-billed duck/Korea/534/2008(H6N1)) segment 1 polymerase PB2 (PB2) gene, complete cds 3557 3557 100% 0.0 95% GQ414792.1
Select seq gb|CY109647.1| Influenza A virus (A/duck/Guizhou/1560/2007(H6N8)) polymerase PB2 (PB2) gene, complete cds 3553 3553 100% 0.0 95% CY109647.1
Select seq gb|JF965038.1| Influenza A virus (A/duck/Eastern China/50/2002(H6N8)) segment 1 polymerase PB2 (PB2) gene, complete cds 3553 3553 100% 0.0 95% JF965038.1
Select seq gb|JN852786.1| Influenza A virus (A/duck/Korea/KNUDPJ09/2009(H9N2)) segment 1 polymerase PB2 (PB2) gene, complete cds 3553 3553 100% 0.0 95% JN852786.1
Select seq gb|HQ336728.1| Influenza A virus (A/duck/Nanjing/20/2010(H1N3)) segment 1 polymerase PB2 (PB2) gene, complete cds 3553 3553 100% 0.0 95% HQ336728.1
Select seq gb|GQ414791.1| Influenza A virus (A/mallard/Korea/L08-8/2008(H6N1)) segment 1 polymerase PB2 (PB2) gene, complete cds 3553 3553 100% 0.0 95% GQ414791.1
Select seq gb|HQ897972.1| Influenza A virus (A/mallard/Korea/KNU YP09/2009(H1N1)) segment 1 polymerase PB2 (PB2) gene, partial cds 3552 3552 99% 0.0 95% HQ897972.1
Select seq gb|KC986319.1| Influenza A virus (A/ruddy shelduck/Mongolia/963V/2009(H3N8)) segment 1 polymerase PB2 (PB2) gene, complete cds 3548 3548 100% 0.0 95% KC986319.1
Select seq gb|JN852802.1| Influenza A virus (A/chicken/Korea/KNUSWR09/2009(H9N2)) segment 1 polymerase PB2 (PB2) gene, complete cds 3548 3548 100% 0.0 95% JN852802.1
Select seq gb|HQ285883.1| Influenza A virus (A/duck/Hunan/8-19/2009(H4N2)) segment 1 polymerase PB2 (PB2) gene, complete cds 3548 3548 100% 0.0 95% HQ285883.1
Select seq gb|GU086271.1| Influenza A virus (A/chicken/Korea/A146/2009(H9N2)) segment 1 polymerase PB2 (PB2) gene, complete cds 3548 3548 100% 0.0 95% GU086271.1
Select seq gb|GQ414797.1| Influenza A virus (A/spot-billed duck/Korea/536/2008(H6N1)) segment 1 polymerase PB2 (PB2) gene, partial cds 3548 3548 98% 0.0 95% GQ414797.1
Select seq gb|CY049809.1| Influenza A virus (A/gadwall/Altai/1328/2007(H3N8)) polymerase PB2 (PB2) gene, complete cds 3548 3548 100% 0.0 95% CY049809.1
Select seq gb|CY049761.1| Influenza A virus (A/mallard/Altai/1208/2007(H3N6)) segment 1 sequence 3548 3548 100% 0.0 95% CY049761.1
Select seq gb|KC986341.1| Influenza A virus (A/red-crested pochard/Mongolia/463V/2009(H3N1)) segment 1 polymerase PB2 (PB2) gene, complete cds 3544 3544 100% 0.0 94% KC986341.1
Select seq gb|KC986339.1| Influenza A virus (A/velvet scoter/Mongolia/969V/2009(H3N8)) segment 1 polymerase PB2 (PB2) gene, complete cds 3544 3544 100% 0.0 94% KC986339.1
Select seq gb|KF260777.1| Influenza A virus (A/duck/Jiangxi/3292/2009(H7N9)) segment 1 polymerase PB2 (PB2) gene, partial cds 3544 3544 99% 0.0 95% KF260777.1
Select seq gb|KF260749.1| Influenza A virus (A/duck/Jiangxi/22041/2008(H4N9)) segment 1 polymerase PB2 (PB2) gene, complete cds 3544 3544 100% 0.0 94% KF260749.1
Select seq gb|CY146745.1| Influenza A virus (A/environment/Hunan/S4304/2011(H3N2)) polymerase PB2 (PB2) gene, complete cds 3544 3544 100% 0.0 94% CY146745.1
Select seq gb|HQ336720.1| Influenza A virus (A/duck/Nanjing/19/2010(H1N3)) segment 1 polymerase PB2 (PB2) gene, complete cds 3544 3544 100% 0.0 94% HQ336720.1
Select seq gb|CY049785.1| Influenza A virus (A/gadwall/Altai/1324/2007(H3N8)) polymerase PB2 (PB2) gene, complete cds 3544 3544 100% 0.0 94% CY049785.1
Select seq gb|CY049777.1| Influenza A virus (A/garganey/Altai/1216/2007(H3N6)) segment 1 sequence 3544 3544 100% 0.0 94% CY049777.1
Select seq dbj|AB259709.1| Influenza A virus (A/duck/Hokkaido/Vac-1/04(H5N1)) genomic RNA, segment 1, complete sequence 3544 3544 100% 0.0 94% AB259709.1
Select seq gb|AY585515.1| Influenza A virus (A/duck/Guangxi/35/2001(H5N1)) polymerase basic protein 2 (PB2) mRNA, complete cds 3544 3544 100% 0.0 94% AY585515.1
Select seq gb|JX454705.1| Influenza A virus (A/wild duck/Korea/CSM20-5/2009(H4N6)) segment 1 polymerase PB2 (PB2) gene, complete cds 3539 3539 100% 0.0 94% JX454705.1
Select seq gb|CY109327.1| Influenza A virus (A/duck/Jiangxi/5748/2006(H6N2)) polymerase PB2 (PB2) gene, complete cds 3539 3539 100% 0.0 94% CY109327.1
Select seq gb|HQ221625.1| Influenza A virus (A/chicken/Korea/SH0902/2009(H9N2)) segment 1 polymerase PB2 (PB2) gene, complete cds 3539 3539 100% 0.0 94% HQ221625.1
Select seq gb|HM145608.1| Influenza A virus (A/duck/Shantou/4534/2001(H6N2)) segment 1 polymerase PB2 (PB2) gene, complete cds 3539 3539 100% 0.0 94% HM145608.1
Select seq dbj|AB530989.1| Influenza A virus (A/mallard/Hokkaido/24/2009(H5N1)) PB2 gene for polymerase basic protein 2, complete cds 3539 3539 100% 0.0 94% AB530989.1
Select seq dbj|AB301913.1| Influenza A virus (A/duck/Mongolia/54/2001(H5N2)) PB2 gene for polymerase basic protein 2, complete cds 3539 3539 100% 0.0 94% AB301913.1
Select seq dbj|AB253760.2| Influenza A virus (A/R(duck/Mongolia/54/01-duck/Mongolia/47/01) (H5N1)) genomic RNA, segment 1, complete sequence 3539 3539 100% 0.0 94% AB253760.2
Select seq gb|AY585519.1| Influenza A virus (A/duck/Shanghai/13/2001(H5N1)) polymerase basic protein 2 (PB2) mRNA, complete cds 3539 3539 100% 0.0 94% AY585519.1
Select seq gb|HQ221636.1| Influenza A virus (A/chicken/Korea/SH0913/2009(H9N2)) segment 1 polymerase PB2 (PB2) gene, complete cds 3537 3537 99% 0.0 94% HQ221636.1
Select seq gb|EF597476.1| Influenza A virus (A/migratory duck/Hong Kong/MP206/2004(H5N2)) polymerase basic subunit 2 (PB2) gene, partial cds 3537 3537 97% 0.0 95% EF597476.1
Select seq gb|KC986320.1| Influenza A virus (A/mallard/Mongolia/651/2010(H2N3)) segment 1 polymerase PB2 (PB2) gene, complete cds 3535 3535 100% 0.0 94% KC986320.1
Select seq gb|KC986318.1| Influenza A virus (A/mallard/Mongolia/1581/2010(H3N8)) segment 1 polymerase PB2 (PB2) gene, complete cds 3535 3535 100% 0.0 94% KC986318.1
Select seq gb|KC162238.1| Influenza A virus (A/baikal teal/Xianghai/421/2011(H9N2)) segment 1 polymerase PB2 (PB2) gene, complete cds 3535 3535 100% 0.0 94% KC162238.1
Select seq gb|HQ221637.1| Influenza A virus (A/chicken/Korea/SH0914/2009(H9N2)) segment 1 polymerase PB2 (PB2) gene, complete cds 3535 3535 100% 0.0 94% HQ221637.1
Select seq gb|GU052472.1| Influenza A virus (A/goose/Hong Kong/668.1/2001(H5N1)) segment 1 polymerase PB2 (PB2) gene, complete cds 3535 3535 100% 0.0 94% GU052472.1
Select seq gb|DQ997519.1| Influenza A virus (A/duck/Guangxi/xa/2001(H5N1)) segment 1, complete sequence 3535 3535 100% 0.0 94% DQ997519.1
Select seq gb|CY005537.1| Influenza A virus (A/duck/Nanchang/1749/1992(H11N2)) segment 1, complete sequence 3535 3535 100% 0.0 94% CY005537.1
Select seq gb|GU086273.1| Influenza A virus (A/duck/Korea/A174/2009(H9N2)) segment 1 polymerase PB2 (PB2) gene, partial cds 3534 3534 99% 0.0 95% GU086273.1
Select seq gb|AY221591.1| Influenza A virus (A/Chicken/HongKong/YU822.2/01(H5N1)) polymerase basic protein 2 (PB2) gene, partial cds 3534 3534 99% 0.0 94% AY221591.1
Select seq dbj|AB807869.1| Influenza A virus (A/duck/Vietnam/LBM300/2012(H10N2)) viral cRNA, segment 1, complete sequence 3530 3530 100% 0.0 94% AB807869.1
Select seq gb|JX497773.1| Influenza A virus (A/wild duck/Korea/SNU50-5/2009(H5N1)) segment 1 polymerase PB2 (PB2) gene, complete cds 3530 3530 100% 0.0 94% JX497773.1
Select seq gb|GU052072.1| Influenza A virus (A/duck/Hong Kong/2986.1-2/2000(H5N1)) segment 1 polymerase PB2 (PB2) gene, complete cds 3530 3530 100% 0.0 94% GU052072.1
Select seq gb|GU186691.1| Influenza A virus (A/Duck/Hong Kong/380.5/2001(H5N1)) segment 1 polymerase PB2 (PB2) gene, complete cds 3530 3530 100% 0.0 94% GU186691.1
Select seq gb|GU186699.1| Influenza A virus (A/waterfowl/Hong Kong/378.5/2001(H5N1)) segment 1 polymerase PB2 (PB2) gene, complete cds 3530 3530 100% 0.0 94% GU186699.1

Author:  niman [ Sun Dec 27, 2015 12:06 pm ]
Post subject:  Re: Fujian H5N8 In Klamath Co OR With Wild Bird PB1 & PA

Select seq gb|KU201750.1| Influenza A virus (A/American wigeon/Oregon/AH0012525/2015(H5N8)) segment 2 polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 4102 4102 100% 0.0 100% KU201750.1
Select seq gb|KU201742.1| Influenza A virus (A/Canada goose/Oregon/AH0012452/2015(H5N8)) segment 2 polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 4093 4093 100% 0.0 99% KU201742.1
Select seq gb|CY166547.1| Influenza A virus (A/northern shoveler/Wisconsin/11OS3008/2011(H3N8)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 4020 4020 100% 0.0 99% CY166547.1
Select seq gb|CY132663.1| Influenza A virus (A/blue-winged teal/Illinois/10OS1546/2010(H3N6)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 4015 4015 100% 0.0 99% CY132663.1
Select seq gb|KJ527628.1| Influenza A virus (A/blue-winged teal/Ohio/13OS1759/2013(H4N8)) segment 2 polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 4002 4002 100% 0.0 99% KJ527628.1
Select seq gb|CY140941.1| Influenza A virus (A/northern pintail/Minnesota/AI09-4322/2009(H3N8)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3975 3975 100% 0.0 99% CY140941.1
Select seq gb|CY140850.1| Influenza A virus (A/blue-winged Teal/Minnesota/AI09-3575/2009(H4N8)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3975 3975 100% 0.0 99% CY140850.1
Select seq gb|CY079314.1| Influenza A virus (A/American green-winged teal/Mississippi/09OS046/2009(H7N7)) segment 2, complete sequence 3975 3975 100% 0.0 99% CY079314.1
Select seq gb|CY140933.1| Influenza A virus (A/blue-winged teal/Louisiana/AI09-4180/2009(H4N6)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3970 3970 100% 0.0 99% CY140933.1
Select seq gb|CY096654.1| Influenza A virus (A/blue-winged teal/Guatemala/CIP049-05/2010(H3N8)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3970 3970 100% 0.0 99% CY096654.1
Select seq gb|CY141039.1| Influenza A virus (A/mallard/Arkansas/AI09-5944/2009(H4N8)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3961 3961 100% 0.0 99% CY141039.1
Select seq gb|CY186443.1| Influenza A virus (A/blue-winged teal/Illinois/12OS2986/2012(H3N8)) polymerase PB1 (PB1) gene, partial cds; and PB1-F2 protein (PB1-F2) gene, complete cds 3959 3959 98% 0.0 99% CY186443.1
Select seq gb|CY185811.1| Influenza A virus (A/mallard/Alberta/590/2010(H7N8)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3957 3957 100% 0.0 99% CY185811.1
Select seq gb|CY141130.1| Influenza A virus (A/red-necked grebe/Minnesota/AI10-2530/2010(mixed)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3957 3957 100% 0.0 99% CY141130.1
Select seq gb|CY133346.1| Influenza A virus (A/mallard/Wisconsin/10OS3866/2010(H3N6)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3957 3957 100% 0.0 99% CY133346.1
Select seq gb|CY186828.1| Influenza A virus (A/mallard/Ohio/12OS4697/2012(H11N9)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3952 3952 100% 0.0 99% CY186828.1
Select seq gb|CY141071.1| Influenza A virus (A/blue-winged teal/Texas/AI09-6182/2009(H6N2)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3952 3952 100% 0.0 99% CY141071.1
Select seq gb|CY132995.1| Influenza A virus (A/American green-winged teal/Illinois/10OS3343/2010(H2N3)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3952 3952 100% 0.0 99% CY132995.1
Select seq gb|CY096670.1| Influenza A virus (A/blue-winged teal/Guatemala/CIP049-12/2010(H5N4)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3952 3952 100% 0.0 99% CY096670.1
Select seq gb|KR077978.1| Influenza A virus (A/redhead/Ohio/13OS0373/2013(H3N6)) segment 2 polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3948 3948 100% 0.0 99% KR077978.1
Select seq gb|KR077986.1| Influenza A virus (A/redhead/Ohio/13OS363/2013(H3N8)) segment 2 polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3948 3948 100% 0.0 99% KR077986.1
Select seq gb|CY141047.1| Influenza A virus (A/northern shoveler/Arkansas/AI09-6012/2009(H10N3)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3948 3948 100% 0.0 99% CY141047.1
Select seq gb|CY140866.1| Influenza A virus (A/blue-winged Teal/North Dakota/AI09-3642/2009(H3N1)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3948 3948 100% 0.0 99% CY140866.1
Select seq gb|CY096678.1| Influenza A virus (A/blue-winged teal/Guatemala/CIP049-13/2010(H5N4)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3948 3948 100% 0.0 99% CY096678.1
Select seq gb|CY185967.1| Influenza A virus (A/ruddy turnstone/New Jersey/AI11-2098/2011(H7N3)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3943 3943 100% 0.0 98% CY185967.1
Select seq gb|CY138169.1| Influenza A virus (A/blue-winged teal/Nova Scotia/00067/2010(mixed)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3943 3943 100% 0.0 98% CY138169.1
Select seq gb|CY132931.1| Influenza A virus (A/mallard/Wisconsin/10OS2524/2010(H11N2)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3943 3943 100% 0.0 98% CY132931.1
Select seq gb|CY187019.1| Influenza A virus (A/gadwall/Ohio/12OS2222/2012(H3N8)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3939 3939 100% 0.0 98% CY187019.1
Select seq gb|CY132766.1| Influenza A virus (A/northern pintail/Mississippi/10OS4521/2010(mixed)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3939 3939 100% 0.0 98% CY132766.1
Select seq gb|CY120697.1| Influenza A virus (A/mallard/California/1335/2010(H10N7)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3939 3939 100% 0.0 98% CY120697.1
Select seq gb|CY140751.1| Influenza A virus (A/mallard/Minnesota/AI09-2749/2009(mixed)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3934 3934 100% 0.0 98% CY140751.1
Select seq gb|CY133791.1| Influenza A virus (A/mallard/Missouri/10MO084/2010(H5N9)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3934 3934 100% 0.0 98% CY133791.1
Select seq gb|CY133551.1| Influenza A virus (A/long-tailed duck/Wisconsin/10OS3915/2010(H3N6)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3934 3934 100% 0.0 98% CY133551.1
Select seq gb|CY133167.1| Influenza A virus (A/mallard/Wisconsin/10OS3144/2010(H6N1)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3934 3934 100% 0.0 98% CY133167.1
Select seq gb|CY133035.1| Influenza A virus (A/northern shoveler/Illinois/10OS3619/2010(H11N9)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3934 3934 100% 0.0 98% CY133035.1
Select seq gb|CY094771.1| Influenza A virus (A/mallard/California/1305/2010(H10N7)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3934 3934 100% 0.0 98% CY094771.1
Select seq gb|CY191225.1| Influenza A virus (A/environment/Maryland/12OS1505/2012(H3N6)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3930 3930 100% 0.0 98% CY191225.1
Select seq gb|CY191217.1| Influenza A virus (A/environment/Maryland/12OS1502/2012(H3N6)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3930 3930 100% 0.0 98% CY191217.1
Select seq gb|CY191209.1| Influenza A virus (A/environment/Maryland/12OS1501/2012(H3N6)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3930 3930 100% 0.0 98% CY191209.1
Select seq gb|CY191201.1| Influenza A virus (A/environment/Maryland/12OS1500/2012(H3N6)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3930 3930 100% 0.0 98% CY191201.1
Select seq gb|CY191193.1| Influenza A virus (A/environment/Maryland/12OS1499/2012(H3N6)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3930 3930 100% 0.0 98% CY191193.1
Select seq gb|CY191185.1| Influenza A virus (A/environment/Maryland/12OS1496/2012(H3N6)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3930 3930 100% 0.0 98% CY191185.1
Select seq gb|CY191177.1| Influenza A virus (A/environment/Maryland/12OS1495/2012(H3N6)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3930 3930 100% 0.0 98% CY191177.1
Select seq gb|CY191153.1| Influenza A virus (A/environment/Maryland/12OS1484/2012(H3N6)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3930 3930 100% 0.0 98% CY191153.1
Select seq gb|CY191137.1| Influenza A virus (A/environment/Maryland/12OS1479/2012(H3N6)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3930 3930 100% 0.0 98% CY191137.1
Select seq gb|CY191129.1| Influenza A virus (A/environment/Maryland/12OS1478/2012(H3N6)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3930 3930 100% 0.0 98% CY191129.1
Select seq gb|CY191113.1| Influenza A virus (A/environment/Maryland/12OS1476/2012(H3N6)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3930 3930 100% 0.0 98% CY191113.1
Select seq gb|CY191105.1| Influenza A virus (A/environment/Maryland/12OS1475/2012(H3N6)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3930 3930 100% 0.0 98% CY191105.1
Select seq gb|CY191089.1| Influenza A virus (A/environment/Maryland/12OS1473/2012(H3N6)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3930 3930 100% 0.0 98% CY191089.1
Select seq gb|CY191081.1| Influenza A virus (A/environment/Maryland/12OS1472/2012(H3N6)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3930 3930 100% 0.0 98% CY191081.1
Select seq gb|CY191073.1| Influenza A virus (A/environment/Maryland/12OS1469/2012(H3N6)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3930 3930 100% 0.0 98% CY191073.1
Select seq gb|CY191065.1| Influenza A virus (A/environment/Maryland/12OS1467/2012(H3N6)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3930 3930 100% 0.0 98% CY191065.1
Select seq gb|KJ568127.1| Influenza A virus (A/blue-winged teal/Iowa/13OS2359/2013(H4N6)) segment 2 polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3930 3930 100% 0.0 98% KJ568127.1
Select seq gb|CY166376.1| Influenza A virus (A/blue-winged teal/Illinois/11OS4176/2011(H11N9)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3930 3930 100% 0.0 98% CY166376.1
Select seq gb|CY133899.1| Influenza A virus (A/mallard/California/2420/2010(H10N7)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3930 3930 100% 0.0 98% CY133899.1
Select seq gb|CY133591.1| Influenza A virus (A/mallard/Iowa/10OS2426/2010(H3N8)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3930 3930 100% 0.0 98% CY133591.1
Select seq gb|CY133583.1| Influenza A virus (A/mallard/Iowa/10OS2420/2010(H4N6)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3930 3930 100% 0.0 98% CY133583.1
Select seq gb|CY133067.1| Influenza A virus (A/mallard/Wisconsin/10OS2667/2010(H11N9)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3930 3930 100% 0.0 98% CY133067.1
Select seq gb|CY120641.1| Influenza A virus (A/northern shoveler/California/3183/2010(H11N2)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3930 3930 100% 0.0 98% CY120641.1
Select seq gb|CY120633.1| Influenza A virus (A/American wigeon/California/3180/2010(H5N2)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3930 3930 100% 0.0 98% CY120633.1
Select seq gb|CY191241.1| Influenza A virus (A/environment/Maryland/12OS1509/2012(H3N6)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3925 3925 100% 0.0 98% CY191241.1
Select seq gb|CY191145.1| Influenza A virus (A/environment/Maryland/12OS1482/2012(H3N6)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3925 3925 100% 0.0 98% CY191145.1
Select seq gb|KJ567863.1| Influenza A virus (A/blue-winged teal/Wisconsin/13OS3463/2013(H3N2)) segment 2 polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3925 3925 100% 0.0 98% KJ567863.1
Select seq gb|CY167060.1| Influenza A virus (A/long-tailed duck/Wisconsin/11OS4248/2011(H3N8)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3925 3925 100% 0.0 98% CY167060.1
Select seq gb|CY133710.1| Influenza A virus (A/American green-winged teal/Mississippi/11OS259/2011(mixed)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3925 3925 100% 0.0 98% CY133710.1
Select seq gb|CY133699.1| Influenza A virus (A/American green-winged teal/Mississippi/11OS257/2011(H11N9)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3925 3925 100% 0.0 98% CY133699.1
Select seq gb|CY133623.1| Influenza A virus (A/blue-winged teal/Iowa/10OS2649/2010(H3N6)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3925 3925 100% 0.0 98% CY133623.1
Select seq gb|CY133304.1| Influenza A virus (A/mallard/Mississippi/10OS4494/2010(H1N1)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3925 3925 100% 0.0 98% CY133304.1
Select seq gb|CY120553.1| Influenza A virus (A/mallard/California/1356/2010(H10N7)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3925 3925 100% 0.0 98% CY120553.1
Select seq gb|CY191169.1| Influenza A virus (A/environment/Maryland/12OS1487/2012(H3N6)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3921 3921 100% 0.0 98% CY191169.1
Select seq gb|CY186893.1| Influenza A virus (A/blue-winged teal/Ohio/12OS2241/2012(H11N3)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3921 3921 100% 0.0 98% CY186893.1
Select seq gb|CY133831.1| Influenza A virus (A/mallard/Missouri/10MO0333/2010(H11N9)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3921 3921 100% 0.0 98% CY133831.1
Select seq gb|CY133599.1| Influenza A virus (A/mallard/Iowa/10OS2492/2010(H3N6)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3921 3921 100% 0.0 98% CY133599.1
Select seq gb|CY132865.1| Influenza A virus (A/mallard/Illinois/10OS3249/2010(H11N2)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3921 3921 100% 0.0 98% CY132865.1
Select seq gb|CY191161.1| Influenza A virus (A/environment/Maryland/12OS1486/2012(H3N6)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3916 3916 100% 0.0 98% CY191161.1
Select seq gb|CY187059.1| Influenza A virus (A/redhead/Ohio/13OS0428/2013(H6N2)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3916 3916 100% 0.0 98% CY187059.1
Select seq gb|CY186917.1| Influenza A virus (A/blue-winged teal/Ohio/12OS2154/2012(H3N2)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3916 3916 100% 0.0 98% CY186917.1
Select seq gb|CY140991.1| Influenza A virus (A/lesser scaup/Louisiana/AI09-5204/2009(H6N8)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3916 3916 100% 0.0 98% CY140991.1
Select seq gb|CY186478.1| Influenza A virus (A/northern shoveler/Mississippi/12OS5438/2012(mixed)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3912 3912 100% 0.0 98% CY186478.1
Select seq gb|CY166392.1| Influenza A virus (A/American green-winged teal/Illinois/11OS4814/2011(H3N8)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3912 3912 100% 0.0 98% CY166392.1
Select seq gb|CY186555.1| Influenza A virus (A/blue-winged teal/Ohio/12OS2123/2012(H3N2)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3907 3907 100% 0.0 98% CY186555.1
Select seq gb|CY186714.1| Influenza A virus (A/mallard/Illinois/12OS4468/2012(H11N9)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3907 3907 100% 0.0 98% CY186714.1
Select seq gb|CY166993.1| Influenza A virus (A/northern shoveler/Illinois/11OS5680/2011(H11N9)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3907 3907 100% 0.0 98% CY166993.1
Select seq gb|CY166903.1| Influenza A virus (A/American black duck/Wisconsin/11OS3191/2011(H6N1)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3907 3907 100% 0.0 98% CY166903.1
Select seq gb|CY166669.1| Influenza A virus (A/mallard/Wisconsin/11OS3467/2011(mixed)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3907 3907 100% 0.0 98% CY166669.1
Select seq gb|CY166611.1| Influenza A virus (A/gadwall/Wisconsin/11OS3415/2011(H4N6)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3907 3907 100% 0.0 98% CY166611.1
Select seq gb|KF298407.1| Influenza A virus (A/mallard/Minnesota/AI09-2749/2009(H6N8)) segment 2 polymerase PB1 (PB1) gene, complete cds 3907 3907 100% 0.0 98% KF298407.1
Select seq gb|CY134333.1| Influenza A virus (A/mallard/California/2961/2011(H2N3)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3907 3907 100% 0.0 98% CY134333.1
Select seq gb|CY132243.1| Influenza A virus (A/mallard/Ohio/11OS2232/2011(H1N1)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3907 3907 100% 0.0 98% CY132243.1
Select seq gb|CY186978.1| Influenza A virus (A/northern pintail/Ohio/12OS3183/2012(mixed)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3903 3903 100% 0.0 98% CY186978.1
Select seq gb|CY167001.1| Influenza A virus (A/northern shoveler/Illinois/11OS4404/2011(H7N3)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3903 3903 100% 0.0 98% CY167001.1
Select seq gb|CY166288.1| Influenza A virus (A/mallard/Illinois/11OS5564/2011(H1N8)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3903 3903 100% 0.0 98% CY166288.1
Select seq gb|CY157524.1| Influenza A virus (A/northern pintail/California/2789/2011(H9N2)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3903 3903 100% 0.0 98% CY157524.1
Select seq gb|CY157228.1| Influenza A virus (A/mallard/California/2951/2012(H10N7)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3903 3903 100% 0.0 98% CY157228.1
Select seq gb|KF298399.1| Influenza A virus (A/mallard/Minnesota/AI09-1714/2009(H7N1)) segment 2 polymerase PB1 (PB1) gene, complete cds 3901 3901 100% 0.0 98% KF298399.1
Select seq gb|CY187133.1| Influenza A virus (A/American green-winged teal/Wisconsin/12OS3031/2012(H11N9)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3898 3898 100% 0.0 98% CY187133.1
Select seq gb|CY186563.1| Influenza A virus (A/American green-winged teal/Ohio/12OS2256/2012(H6N5)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3898 3898 100% 0.0 98% CY186563.1
Select seq gb|CY186533.1| Influenza A virus (A/mallard/Ohio/12OS1867/2012(H11)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3898 3898 100% 0.0 98% CY186533.1
Select seq gb|CY166921.1| Influenza A virus (A/mallard/Wisconsin/11OS3256/2011(mixed)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3898 3898 100% 0.0 98% CY166921.1
Select seq gb|CY166758.1| Influenza A virus (A/gadwall/Mississippi/11OS5840/2011(H5N3)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3898 3898 100% 0.0 98% CY166758.1
Select seq gb|CY166742.1| Influenza A virus (A/northern shoveler/Mississippi/11OS5805/2011(H5N1)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3898 3898 100% 0.0 98% CY166742.1
Select seq gb|CY166368.1| Influenza A virus (A/mallard/Illinois/11OS4121/2011(H6N2)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3898 3898 100% 0.0 98% CY166368.1
Select seq gb|KM373936.1| Influenza A virus (A/Northern shoveler/Alaska/ND0006934/2013(H10N7)) segment 2 polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3894 3894 100% 0.0 98% KM373936.1
Select seq gb|CY186581.1| Influenza A virus (A/mallard/Ohio/12OS5582/2012(mixed)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3894 3894 100% 0.0 98% CY186581.1
Select seq gb|CY186526.1| Influenza A virus (A/mallard/Ohio/12OS1866/2012(H11)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3894 3894 100% 0.0 98% CY186526.1
Select seq gb|CY166878.1| Influenza A virus (A/mallard/Wisconsin/11OS3170/2011(H6N1)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3894 3894 100% 0.0 98% CY166878.1
Select seq gb|CY157236.1| Influenza A virus (A/mallard/California/2954/2012(H10N7)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3894 3894 100% 0.0 98% CY157236.1
Select seq gb|CY134349.1| Influenza A virus (A/green-winged teal/California/96/2012(H1N1)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3894 3894 100% 0.0 98% CY134349.1
Select seq gb|CY133907.1| Influenza A virus (A/northern shoveler/California/2810/2011(H11N2)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3894 3894 100% 0.0 98% CY133907.1
Select seq gb|CY186547.1| Influenza A virus (A/blue-winged teal/Ohio/12OS2099/2012(H11)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3889 3889 100% 0.0 98% CY186547.1
Select seq gb|CY186519.1| Influenza A virus (A/mallard/Ohio/12OS1879/2012(H11)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3889 3889 100% 0.0 98% CY186519.1
Select seq gb|CY186494.1| Influenza A virus (A/mallard/Ohio/12OS1385/2012(mixed)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3889 3889 100% 0.0 98% CY186494.1
Select seq gb|CY166686.1| Influenza A virus (A/American green-winged teal/Wisconsin/11OS3592/2011(H4N6)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3889 3889 100% 0.0 98% CY166686.1
Select seq gb|CY149610.1| Influenza A virus (A/bufflehead/Maine/340/2011(H6N8)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3889 3889 100% 0.0 98% CY149610.1
Select seq gb|CY133875.1| Influenza A virus (A/mallard/Missouri/10MO0550/2010(H11N3)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3889 3889 100% 0.0 98% CY133875.1
Select seq gb|CY132187.1| Influenza A virus (A/mallard/Ohio/11OS2213/2011(H11N2)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3889 3889 100% 0.0 98% CY132187.1
Select seq gb|CY042227.1| Influenza A virus (A/northern pintail/Minnesota/Sg-00227/2006(H1N1)) segment 2 sequence 3889 3889 100% 0.0 98% CY042227.1
Select seq gb|KJ568183.1| Influenza A virus (A/blue-winged teal/Ohio/13OS2104/2013(H2N3)) segment 2 polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3885 3885 100% 0.0 98% KJ568183.1
Select seq gb|CY167068.1| Influenza A virus (A/black scoter/Wisconsin/11OS4260/2011(H3N2)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3885 3885 100% 0.0 98% CY167068.1
Select seq gb|CY157404.1| Influenza A virus (A/mallard/California/3200/2012(H2N7)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3885 3885 100% 0.0 98% CY157404.1
Select seq gb|CY042232.2| Influenza A virus (A/green-winged teal/Minnesota/Sg-00228/2006(H6N8)) segment 2 sequence 3885 3885 100% 0.0 98% CY042232.2
Select seq gb|CY166790.1| Influenza A virus (A/northern shoveler/Mississippi/11OS5900/2011(H8N1)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3880 3880 100% 0.0 98% CY166790.1
Select seq gb|CY149674.1| Influenza A virus (A/blue-winged teal/Canada/3237/2011(H4N6)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3880 3880 100% 0.0 98% CY149674.1
Select seq gb|CY120617.1| Influenza A virus (A/mallard/California/3134/2010(H1N1)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3880 3880 100% 0.0 98% CY120617.1
Select seq gb|CY191001.1| Influenza A virus (A/mallard/Maryland/11OS3701/2011(H6N1)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3876 3876 100% 0.0 98% CY191001.1
Select seq gb|CY186901.1| Influenza A virus (A/blue-winged teal/Ohio/12OS2244/2012(H4N6)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3876 3876 100% 0.0 98% CY186901.1
Select seq gb|CY186869.1| Influenza A virus (A/blue-winged teal/Ohio/12OS2138/2012(H10N9)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3876 3876 100% 0.0 98% CY186869.1
Select seq gb|CY157444.1| Influenza A virus (A/mallard/California/3332/2012(H4N6)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3876 3876 100% 0.0 98% CY157444.1
Select seq gb|CY149682.1| Influenza A virus (A/blue-winged teal/Canada/3239/2011(H4N6)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3876 3876 100% 0.0 98% CY149682.1
Select seq gb|CY134301.1| Influenza A virus (A/northern shoveler/California/3676/2010(H8N2)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3876 3876 100% 0.0 98% CY134301.1
Select seq gb|CY190969.1| Influenza A virus (A/mallard/Maryland/09OS2237/2009(H10N6)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3871 3871 100% 0.0 98% CY190969.1
Select seq gb|KP636476.1| Influenza A virus (A/American black duck/Maine/44411/532/2008(H3N8)) segment 2 polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3871 3871 100% 0.0 98% KP636476.1
Select seq gb|CY186802.1| Influenza A virus (A/blue-winged teal/Ohio/12OS2321/2012(H4N6)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3871 3871 100% 0.0 98% CY186802.1
Select seq gb|CY167149.1| Influenza A virus (A/northern shoveler/Arkansas/12OS158/2012(H7N1)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3871 3871 100% 0.0 98% CY167149.1
Select seq gb|CY157332.1| Influenza A virus (A/mallard/California/3135/2012(H2N7)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3871 3871 100% 0.0 98% CY157332.1
Select seq gb|KF424120.1| Influenza A virus (A/mallard/Missouri/466554-14/2007(H1N1)) segment 2 polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3871 3871 100% 0.0 98% KF424120.1
Select seq gb|CY134365.1| Influenza A virus (A/northern shoveler/California/138/2012(H1N1)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3871 3871 100% 0.0 98% CY134365.1
Select seq gb|CY186570.1| Influenza A virus (A/mallard/Ohio/12OS3170/2012(N6)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3867 3867 100% 0.0 98% CY186570.1
Select seq gb|CY133841.1| Influenza A virus (A/mallard/Missouri/10MO0334/2010(mixed)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3867 3867 100% 0.0 98% CY133841.1
Select seq gb|CY132451.1| Influenza A virus (A/mallard/Ohio/11OS2216/2011(H5N1)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3867 3867 100% 0.0 98% CY132451.1
Select seq gb|CY191281.1| Influenza A virus (A/American black duck/Maryland/13OS2956/2013(H11N9)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3862 3862 100% 0.0 98% CY191281.1
Select seq gb|CY186621.1| Influenza A virus (A/mallard/Wisconsin/12OS2425/2012(H6N1)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3862 3862 100% 0.0 98% CY186621.1
Select seq gb|CY186505.1| Influenza A virus (A/mallard/Ohio/12OS1418/2012(mixed)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3862 3862 100% 0.0 98% CY186505.1
Select seq gb|KJ568311.1| Influenza A virus (A/mallard/Ohio/13OS3856/2013(H9N2)) segment 2 polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3862 3862 100% 0.0 98% KJ568311.1
Select seq gb|CY166929.1| Influenza A virus (A/mallard/Missouri/11OS4987/2011(H5N2)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3862 3862 100% 0.0 98% CY166929.1
Select seq gb|CY166200.1| Influenza A virus (A/american green-winged teal/Wisconsin/11OS3551/2011(H6N2)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3862 3862 100% 0.0 98% CY166200.1
Select seq gb|CY157548.1| Influenza A virus (A/mallard/California/2858/2012(H2N7)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3862 3862 100% 0.0 98% CY157548.1
Select seq gb|CY149578.1| Influenza A virus (A/black scoter/Maine/276/2011(H10N7)) polymerase PB1 (PB1) gene, complete cds; and PB1-F2 gene, complete sequence 3862 3862 100% 0.0 98% CY149578.1
Select seq gb|CY139959.1| Influenza A virus (A/mallard/Minnesota/AI06-1029/2006(H2N3)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3862 3862 100% 0.0 98% CY139959.1
Select seq gb|CY190025.1| Influenza A virus (A/blue-winged teal/Maryland/06MD462/2006(H12N2)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3858 3858 100% 0.0 98% CY190025.1
Select seq gb|CY189945.1| Influenza A virus (A/mallard/Maryland/13OS3019/2014(mixed)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3858 3858 100% 0.0 98% CY189945.1
Select seq gb|CY185927.1| Influenza A virus (A/mallard/Minnesota/AI07-3433/2007(H7N3)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3858 3858 100% 0.0 98% CY185927.1
Select seq gb|KJ568191.1| Influenza A virus (A/American green-winged teal/Ohio/13OS1775/2013(H4N8)) segment 2 polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3858 3858 100% 0.0 98% KJ568191.1
Select seq gb|CY157116.1| Influenza A virus (A/mallard/California/2805/2012(H2N7)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3858 3858 100% 0.0 98% CY157116.1
Select seq gb|CY157084.1| Influenza A virus (A/mallard/California/2755/2012(H2N7)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3858 3858 100% 0.0 98% CY157084.1
Select seq gb|CY140802.1| Influenza A virus (A/blue-winged Teal/North Dakota/AI09-3131/2009(H4N6)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3858 3858 100% 0.0 98% CY140802.1
Select seq gb|CY097174.1| Influenza A virus (A/mallard/Illinois/2956/2009(mixed)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3858 3858 100% 0.0 98% CY097174.1
Select seq gb|CY097032.1| Influenza A virus (A/blue-winged teal/Wisconsin/2741/2009(H4N6)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3858 3858 100% 0.0 98% CY097032.1
Select seq gb|CY191305.1| Influenza A virus (A/mallard/Maryland/13OS3036/2014(H1N1)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3853 3853 100% 0.0 98% CY191305.1
Select seq gb|KJ567959.1| Influenza A virus (A/mallard/Wisconsin/13OS2767/2013(H3N8)) segment 2 polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3853 3853 100% 0.0 98% KJ567959.1
Select seq gb|KJ568023.1| Influenza A virus (A/blue-winged teal/Ohio/13OS1783/2013(H4N8)) segment 2 polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3853 3853 100% 0.0 98% KJ568023.1
Select seq gb|CY166296.1| Influenza A virus (A/mallard/Illinois/11OS5570/2011(H3N8)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3853 3853 100% 0.0 98% CY166296.1
Select seq gb|CY149554.1| Influenza A virus (A/bufflehead/Maine/161/2011(H1N1)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3853 3853 100% 0.0 98% CY149554.1
Select seq gb|KF424240.1| Influenza A virus (A/mallard duck/Minnesota/Sg-00121/2007(H1N1)) segment 2 polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3853 3853 100% 0.0 98% KF424240.1
Select seq gb|CY141121.1| Influenza A virus (A/red-necked grebe/Minnesota/AI10-2529/2010(mixed)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3853 3853 100% 0.0 98% CY141121.1
Select seq gb|JX080900.1| Influenza A virus (A/lesser snow goose/Alaska/44301-116/2007(H2N3)) segment 2 polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3853 3853 100% 0.0 98% JX080900.1
Select seq gb|CY191265.1| Influenza A virus (A/mallard/Maryland/12OS565/2012(H2N2)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3849 3849 100% 0.0 98% CY191265.1
Select seq gb|CY191033.1| Influenza A virus (A/American black duck/Maryland/11OS3898/2012(H2N1)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3849 3849 100% 0.0 98% CY191033.1
Select seq gb|CY191025.1| Influenza A virus (A/mallard/Maryland/11OS3833/2012(H2N1)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3849 3849 100% 0.0 98% CY191025.1
Select seq gb|CY186628.1| Influenza A virus (A/blue-winged teal/Wisconsin/12OS2562/2012(mixed)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3849 3849 100% 0.0 98% CY186628.1
Select seq gb|CY187003.1| Influenza A virus (A/mallard/Ohio/12OS2174/2012(H6N1)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3849 3849 100% 0.0 98% CY187003.1
Select seq gb|CY186738.1| Influenza A virus (A/blue-winged teal/Illinois/12OS2929/2012(H3N8)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3849 3849 100% 0.0 98% CY186738.1
Select seq gb|KJ568327.1| Influenza A virus (A/mallard/Ohio/13OS1972/2013(H2N8)) segment 2 polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3849 3849 100% 0.0 98% KJ568327.1
Select seq gb|CY166433.1| Influenza A virus (A/mallard/Wisconsin/11OS3481/2011(H4N6)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3849 3849 100% 0.0 98% CY166433.1
Select seq gb|KF424200.1| Influenza A virus (A/mallard/Minnesota/AI07-3018/2007(H1N1)) segment 2 polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3849 3849 100% 0.0 98% KF424200.1
Select seq gb|CY144899.1| Influenza A virus (A/mallard/Minnesota/AI06-1017/2006(H10N3)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3849 3849 100% 0.0 98% CY144899.1
Select seq gb|CY128924.1| Influenza A virus (A/mallard/Nova Scotia/02153/2007(H1N1)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3849 3849 100% 0.0 98% CY128924.1
Select seq gb|CY096718.1| Influenza A virus (A/blue-winged teal/Guatemala/CIP049-09/2010(H5N3)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3849 3849 100% 0.0 98% CY096718.1
Select seq gb|CY191041.1| Influenza A virus (A/American black duck/Maryland/11OS3978/2012(H2N1)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3844 3844 100% 0.0 97% CY191041.1
Select seq gb|CY191017.1| Influenza A virus (A/mallard/Maryland/11OS3829/2012(H2N2)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3844 3844 100% 0.0 97% CY191017.1
Select seq gb|CY186705.1| Influenza A virus (A/mallard/Illinois/12OS4466/2012(mixed)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3844 3844 100% 0.0 97% CY186705.1
Select seq gb|CY186681.1| Influenza A virus (A/American green-winged teal/Illinois/12OS5103/2012(H3N8)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3844 3844 100% 0.0 97% CY186681.1
Select seq gb|CY132778.1| Influenza A virus (A/mallard/Wisconsin/10OS3868/2010(mixed)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3844 3844 100% 0.0 97% CY132778.1
Select seq gb|CY128948.1| Influenza A virus (A/mallard/Nova Scotia/02151/2007(H1N1)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3844 3844 100% 0.0 97% CY128948.1
Select seq gb|CY128720.1| Influenza A virus (A/American black duck/New Brunswick/02493/2007(H7N3)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3844 3844 100% 0.0 97% CY128720.1
Select seq gb|CY096702.1| Influenza A virus (A/blue-winged teal/Guatemala/CIP049-08/2010(H5N3)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3844 3844 100% 0.0 97% CY096702.1
Select seq gb|CY078128.1| Influenza A virus (A/mallard/Minnesota/Sg-00176/2007(H4N6)) segment 2, complete sequence 3842 3842 100% 0.0 97% CY078128.1
Select seq gb|KJ568015.1| Influenza A virus (A/American green-winged teal/Ohio/13OS1869/2013(H10N8)) segment 2 polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3840 3840 100% 0.0 97% KJ568015.1
Select seq gb|KJ568303.1| Influenza A virus (A/American green-winged teal/Ohio/13OS2086/2013(H6N8)) segment 2 polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3840 3840 100% 0.0 97% KJ568303.1
Select seq gb|CY166168.1| Influenza A virus (A/mallard/Wisconsin/11OS4489/2011(H8N4)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3840 3840 100% 0.0 97% CY166168.1
Select seq gb|CY166160.1| Influenza A virus (A/long-tailed duck/Wisconsin/11OS4599/2011(H4N2)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3840 3840 100% 0.0 97% CY166160.1
Select seq gb|CY140975.1| Influenza A virus (A/blue-winged teal/Texas/AI09-4463/2009(H4N8)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3840 3840 100% 0.0 97% CY140975.1
Select seq gb|CY139130.1| Influenza A virus (A/American black duck/New Brunswick/00612/2010(H10N7)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3840 3840 100% 0.0 97% CY139130.1
Select seq gb|CY138896.1| Influenza A virus (A/American black duck/New Brunswick/00469/2010(H4N6)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3840 3840 100% 0.0 97% CY138896.1
Select seq gb|CY138888.1| Influenza A virus (A/American black duck/New Brunswick/00468/2010(H4N6)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3840 3840 100% 0.0 97% CY138888.1
Select seq gb|CY133462.1| Influenza A virus (A/American wigeon/Iowa/10OS2748/2010(H2N2)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3840 3840 100% 0.0 97% CY133462.1
Select seq gb|CY129332.1| Influenza A virus (A/American black duck/New Brunswick/04388/2007(H7N3)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3840 3840 100% 0.0 97% CY129332.1
Select seq gb|KC110595.1| Influenza A virus (A/long-tailed duck/Wisconsin/10OS3912/2010(H14N6)) segment 2 polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3840 3840 100% 0.0 97% KC110595.1
Select seq gb|CY190577.1| Influenza A virus (A/snow goose/Delaware/07OS203/2007(H1N8)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3835 3835 100% 0.0 97% CY190577.1
Select seq gb|CY190313.1| Influenza A virus (A/mallard/Maryland/06OS196/2006(H6N2)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3835 3835 100% 0.0 97% CY190313.1
Select seq gb|CY064199.2| Influenza A virus (A/blue-winged teal/Texas/Sg-00075/2007(Mixed)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3835 3835 100% 0.0 97% CY064199.2
Select seq gb|CY187182.1| Influenza A virus (A/blue winged-teal/Wisconsin/12OS4239/2012(H3N2)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3835 3835 100% 0.0 97% CY187182.1
Select seq gb|KJ526078.1| Influenza A virus (A/blue-winged teal/Ohio/13OS1410/2013(H3N6)) segment 2 polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3835 3835 100% 0.0 97% KJ526078.1
Select seq gb|CY167044.1| Influenza A virus (A/northern pintail/Illinois/11OS4764/2011(mixed)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3835 3835 100% 0.0 97% CY167044.1
Select seq gb|CY143851.1| Influenza A virus (A/northern pintail/Interior Alaska/10BM10556R0/2010(mixed)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3835 3835 100% 0.0 97% CY143851.1
Select seq gb|CY140999.1| Influenza A virus (A/blue-winged teal/Louisiana/AI09-5234/2009(H11N2)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3835 3835 100% 0.0 97% CY140999.1
Select seq gb|CY140951.1| Influenza A virus (A/mallard/Minnesota/AI09-4324/2009(mixed)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3835 3835 100% 0.0 97% CY140951.1
Select seq gb|CY139038.1| Influenza A virus (A/American black duck/New Brunswick/00499/2010(H4N6)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3835 3835 100% 0.0 97% CY139038.1
Select seq gb|CY138904.1| Influenza A virus (A/American black duck/New Brunswick/00470/2010(H4N6)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3835 3835 100% 0.0 97% CY138904.1
Select seq gb|CY133666.1| Influenza A virus (A/American green-winged teal/Mississippi/11OS247/2011(mixed)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3835 3835 100% 0.0 97% CY133666.1
Select seq gb|CY133559.1| Influenza A virus (A/long-tailed duck/Wisconsin/10OS3918/2010(H14N8)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3835 3835 100% 0.0 97% CY133559.1
Select seq gb|CY133272.1| Influenza A virus (A/mallard/Wisconsin/10OS3941/2010(H14N6)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3835 3835 100% 0.0 97% CY133272.1
Select seq gb|KC110609.1| Influenza A virus (A/white-winged scoter/Wisconsin/10OS3922/2010(H14N8)) segment 2 polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3835 3835 100% 0.0 97% KC110609.1
Select seq gb|CY190585.1| Influenza A virus (A/snow goose/Delaware/07OS206/2007(H1N8)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3831 3831 100% 0.0 97% CY190585.1
Select seq gb|CY187150.1| Influenza A virus (A/American green-winged teal/Wisconsin/12OS4577/2012(mixed)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3831 3831 100% 0.0 97% CY187150.1
Select seq gb|CY143754.1| Influenza A virus (A/northern pintail/Interior Alaska/10CH00003R0/2010(H4N6)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3831 3831 100% 0.0 97% CY143754.1
Select seq gb|CY141948.1| Influenza A virus (A/northern pintail/Interior Alaska/10BM11366R0/2010(H7N3)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3831 3831 100% 0.0 97% CY141948.1
Select seq gb|CY139022.1| Influenza A virus (A/mallard/New Brunswick/00494/2010(mixed)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3831 3831 100% 0.0 97% CY139022.1
Select seq gb|CY138990.1| Influenza A virus (A/American black duck/New Brunswick/00487/2010(H4N8)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3831 3831 100% 0.0 97% CY138990.1
Select seq gb|CY138051.1| Influenza A virus (A/American black duck/New Brunswick/00464/2010(H4N6)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3831 3831 100% 0.0 97% CY138051.1
Select seq gb|CY130427.1| Influenza A virus (A/northern pintail/Interior Alaska/10BM02585R0/2010(H4N6)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3831 3831 100% 0.0 97% CY130427.1
Select seq gb|KC110603.1| Influenza A virus (A/long-tailed duck/Wisconsin/10OS4225/2010(H14N6)) segment 2 polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3831 3831 100% 0.0 97% KC110603.1
Select seq gb|CY093685.1| Influenza A virus (A/mallard/California/10126/2008(H10N7)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3831 3831 100% 0.0 97% CY093685.1
Select seq gb|CY078008.1| Influenza A virus (A/blue-winged teal/Louisiana/Sg-00093/2007(H10N7)) segment 2, complete sequence 3831 3831 100% 0.0 97% CY078008.1
Select seq gb|GQ923299.1| Influenza A virus (A/northern pintail/Utah/469648/2006(H5N2)) segment 2 polymerase PB1 (PB1) gene, complete cds 3831 3831 100% 0.0 97% GQ923299.1
Select seq gb|CY017755.1| Influenza A virus (A/mallard/Alaska/708/2005(H8N4)) segment 2, complete sequence 3831 3831 100% 0.0 97% CY017755.1
Select seq gb|CY003990.1| Influenza A virus (A/mallard/Alberta/149/2002(H2N4)) segment 2, complete sequence 3831 3831 100% 0.0 97% CY003990.1
Select seq gb|CY033785.1| Influenza A virus (A/mallard duck/Minnesota/Sg-00122/2007(H1N1)) segment 2 sequence 3829 3829 99% 0.0 98% CY033785.1
Select seq gb|EF655842.1| Influenza A virus (A/dunlin/Barrow/65/2005(H6N1)) segment 2 polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3828 3828 100% 0.0 97% EF655842.1
Select seq gb|CY190569.1| Influenza A virus (A/snow goose/Delaware/07OS201/2007(H1N8)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3826 3826 100% 0.0 97% CY190569.1
Select seq gb|CY064151.2| Influenza A virus (A/mallard/Minnesota/Sg-00065/2007(H10N7)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3826 3826 100% 0.0 97% CY064151.2
Select seq gb|CY063975.2| Influenza A virus (A/blue-winged teal/Minnesota/Sg-00042/2007(H4N6)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3826 3826 100% 0.0 97% CY063975.2
Select seq gb|CY063959.2| Influenza A virus (A/blue-winged teal/Minnesota/Sg-00040/2007(H4N6)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3826 3826 100% 0.0 97% CY063959.2
Select seq gb|KJ568175.1| Influenza A virus (A/blue-winged teal/Ohio/13OS2018/2013(H3N8)) segment 2 polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3826 3826 100% 0.0 97% KJ568175.1
Select seq gb|CY166734.1| Influenza A virus (A/mallard/Wisconsin/11OS4383/2011(H3N8)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3826 3826 100% 0.0 97% CY166734.1
Select seq gb|CY143762.1| Influenza A virus (A/mallard/Interior Alaska/10CH00021R0/2010(H4N6)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3826 3826 100% 0.0 97% CY143762.1
Select seq gb|CY141513.1| Influenza A virus (A/mallard/Interior Alaska/10BM12362R0/2010(H3N8)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3826 3826 100% 0.0 97% CY141513.1
Select seq gb|CY138947.1| Influenza A virus (A/American black duck/New Brunswick/00478/2010(H4N6)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3826 3826 100% 0.0 97% CY138947.1
Select seq gb|CY135817.1| Influenza A virus (A/mallard/Interior Alaska/10BM05797R0/2010(H3N8)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3826 3826 100% 0.0 97% CY135817.1
Select seq gb|CY135669.1| Influenza A virus (A/northern pintail/Interior Alaska/10BM05034R0/2010(H3N6)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3826 3826 100% 0.0 97% CY135669.1
Select seq gb|CY130378.1| Influenza A virus (A/mallard/Interior Alaska/10BM02111R0/2010(H12N5)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3826 3826 100% 0.0 97% CY130378.1
Select seq gb|CY102234.1| Influenza A virus (A/blue-winged teal/Alberta/16/1997(H2N9)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3826 3826 100% 0.0 97% CY102234.1
Select seq gb|CY097201.1| Influenza A virus (A/American green-winged teal/Illinois/3054/2009(H1N2)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3826 3826 100% 0.0 97% CY097201.1
Select seq gb|CY076315.1| Influenza A virus (A/northern shoveler/Washington/44249-765/2006(H10N2)) segment 2, complete sequence 3826 3826 100% 0.0 97% CY076315.1
Select seq gb|EU500842.1| Influenza A virus (A/Canada goose/BC/3752/2007(H7N3)) segment 2, complete sequence 3826 3826 100% 0.0 97% EU500842.1
Select seq gb|KM244098.1| Influenza A virus (A/chicken/Delaware/10851/2014(H7N7)) segment 2 polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3822 3822 100% 0.0 97% KM244098.1
Select seq gb|CY064167.2| Influenza A virus (A/ring-necked duck/Minnesota/Sg-00067/2007(H4N6)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3822 3822 100% 0.0 97% CY064167.2
Select seq gb|CY064135.2| Influenza A virus (A/mallard/Minnesota/Sg-00063/2007(H4N6)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3822 3822 100% 0.0 97% CY064135.2
Select seq gb|CY064087.2| Influenza A virus (A/mallard/Minnesota/Sg-00057/2007(H10N7)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3822 3822 100% 0.0 97% CY064087.2
Select seq gb|CY063999.2| Influenza A virus (A/mallard/Minnesota/Sg-00045/2007(H4N6)) polymerase PB1 (PB1) and PB1-F2 protein (PB1-F2) genes, complete cds 3822 3822 100% 0.0 97% CY063999.2

Author:  niman [ Sun Dec 27, 2015 12:07 pm ]
Post subject:  Re: Fujian H5N8 In Klamath Co OR With Wild Bird PB1 & PA

Influenza A virus (A/American wigeon/Oregon/AH0012525/2015(H5N8)) segment 3 polymerase PA (PA) gene, complete cds; and nonfunctional PA-X protein (PA-X) gene, complete sequence 3880 3880 100% 0.0 100% KU201751.1
Select seq gb|KU201743.1| Influenza A virus (A/Canada goose/Oregon/AH0012452/2015(H5N8)) segment 3 polymerase PA (PA) and PA-X protein (PA-X) genes, complete cds 3847 3847 100% 0.0 99% KU201743.1
Select seq gb|KU201855.1| Influenza A virus (A/American wigeon/Washington/196336/2015(H5N1)) segment 3 polymerase PA (PA) and PA-X protein (PA-X) genes, complete cds 3826 3826 100% 0.0 99% KU201855.1
Select seq gb|KU201863.1| Influenza A virus (A/American wigeon/Washington/196340/2015(H5N1)) segment 3 polymerase PA (PA) and PA-X protein (PA-X) genes, complete cds 3826 3826 100% 0.0 99% KU201863.1
Select seq gb|KP739420.1| Influenza A virus (A/American green-winged teal/Washington/195750/2014(H5N1)) segment 3 polymerase PA (PA) gene, complete cds 3826 3826 100% 0.0 99% KP739420.1
Select seq gb|CY166634.1| Influenza A virus (A/American green-winged teal/Wisconsin/11OS3425/2011(H12N5)) polymerase PA (PA) and PA-X protein (PA-X) genes, complete cds 3790 3790 100% 0.0 99% CY166634.1
Select seq gb|CY166677.1| Influenza A virus (A/mallard/Wisconsin/11OS3468/2011(H2N3)) polymerase PA (PA) and PA-X protein (PA-X) genes, complete cds 3784 3784 100% 0.0 99% CY166677.1
Select seq gb|CY167034.1| Influenza A virus (A/northern pintail/Illinois/11OS4756/2011(mixed)) polymerase PA (PA) and PA-X protein (PA-X) genes, complete cds 3781 3781 100% 0.0 99% CY167034.1
Select seq gb|CY166263.1| Influenza A virus (A/northern pintail/Wisconsin/11OS4111/2011(H6N2)) polymerase PA (PA) and PA-X protein (PA-X) genes, complete cds 3781 3781 100% 0.0 99% CY166263.1
Select seq gb|CY137759.1| Influenza A virus (A/mallard/Alberta/569/2008(H1N1)) polymerase PA (PA) and PA-X protein (PA-X) genes, complete cds 3775 3775 100% 0.0 99% CY137759.1
Select seq gb|KJ568120.1| Influenza A virus (A/American green-winged teal/Wisconsin/13OS3465/2013(H6N8)) segment 3 polymerase PA (PA) and PA-X protein (PA-X) genes, complete cds 3772 3772 100% 0.0 99% KJ568120.1
Select seq gb|CY103253.1| Influenza A virus (A/mallard/Alberta/115/2007(mixed)) polymerase PA (PA) gene, complete cds 3772 3772 100% 0.0 99% CY103253.1
Select seq gb|CY166944.1| Influenza A virus (A/blue-winged teal/Missouri/11OS2563/2011(H12N4)) polymerase PA (PA) and PA-X protein (PA-X) genes, complete cds 3766 3766 100% 0.0 99% CY166944.1
Select seq gb|CY187124.1| Influenza A virus (A/mallard/Wisconsin/12OS4331/2012(H3N8)) polymerase PA (PA) and PA-X protein (PA-X) genes, complete cds 3754 3754 100% 0.0 99% CY187124.1
Select seq gb|CY134356.1| Influenza A virus (A/green-winged teal/California/123/2012(H1N1)) polymerase PA (PA) gene, complete cds 3748 3748 100% 0.0 99% CY134356.1
Select seq gb|KJ195681.1| Influenza A virus (A/blue-winged teal/Guatemala/CIP049H105-15/2011(H14N3)) clone H105-15-S3b segment 3 polymerase PA (PA) and PA-X protein (PA-X) genes, complete cds 3745 3745 100% 0.0 99% KJ195681.1
Select seq gb|CY186589.1| Influenza A virus (A/gadwall/Ohio/12OS5640/2012(H5N2)) polymerase PA (PA) and PA-X protein (PA-X) genes, complete cds 3739 3739 100% 0.0 99% CY186589.1
Select seq gb|CY097691.1| Influenza A virus (A/American green-winged teal/Mississippi/300/2010(H11N9)) polymerase PA (PA) gene, complete cds 3739 3739 100% 0.0 99% CY097691.1
Select seq gb|CY187149.1| Influenza A virus (A/American green-winged teal/Wisconsin/12OS4577/2012(mixed)) polymerase PA (PA) and PA-X protein (PA-X) genes, complete cds 3736 3736 100% 0.0 99% CY187149.1
Select seq gb|JX908508.1| Influenza A virus (A/chicken/Jalisco/12283/2012(H7N3)) segment 3 polymerase PA (PA) gene, complete cds 3736 3736 100% 0.0 99% JX908508.1
Select seq gb|CY186986.1| Influenza A virus (A/gadwall/Ohio/12OS5632/2012(H5N2)) polymerase PA (PA) and PA-X protein (PA-X) genes, complete cds 3727 3727 100% 0.0 98% CY186986.1
Select seq gb|KJ568344.1| Influenza A virus (A/blue-winged teal/Iowa/13OS2316/2013(H7N3)) segment 3 polymerase PA (PA) and PA-X protein (PA-X) genes, complete cds 3727 3727 100% 0.0 98% KJ568344.1
Select seq gb|JX465636.2| Influenza A virus (A/chicken/Jalisco/CPA1/2012(H7N3)) segment 3 polymerase PA (PA) gene, complete cds 3727 3727 100% 0.0 98% JX465636.2
Select seq gb|CY097156.1| Influenza A virus (A/American green-winged teal/Mississippi/383/2010(H11N9)) polymerase PA (PA) gene, complete cds 3727 3727 100% 0.0 98% CY097156.1
Select seq gb|CY186688.1| Influenza A virus (A/northern shoveler/Illinois/12OS5128/2012(H2N5)) polymerase PA (PA) and PA-X protein (PA-X) genes, complete cds 3721 3721 100% 0.0 98% CY186688.1
Select seq gb|KM374025.1| Influenza A virus (A/mallard/Alaska/ND0006301/2013(H3N8)) segment 3 polymerase PA (PA) gene, complete cds 3712 3712 100% 0.0 98% KM374025.1
Select seq gb|CY125727.1| Influenza A virus (A/Mexico/InDRE7218/2012(H7N3)) polymerase PA (PA) gene, complete cds 3703 3703 100% 0.0 98% CY125727.1
Select seq gb|CY134340.1| Influenza A virus (A/bufflehead/California/3118/2011(H4N8)) polymerase PA (PA) gene, complete cds 3690 3690 100% 0.0 98% CY134340.1
Select seq gb|CY133214.1| Influenza A virus (A/mallard/Wisconsin/10OS2917/2010(H4N6)) polymerase PA (PA) gene, complete cds 3685 3685 100% 0.0 98% CY133214.1
Select seq gb|CY033759.1| Influenza A virus (A/mallard duck/Minnesota/Sg-00103/2007(H3N8)) segment 3 sequence 3678 3678 99% 0.0 98% CY033759.1
Select seq gb|KF424121.1| Influenza A virus (A/mallard/Missouri/466554-14/2007(H1N1)) segment 3 polymerase PA (PA) and PA-X protein (PA-X) genes, complete cds 3672 3672 100% 0.0 98% KF424121.1
Select seq gb|KM244107.1| Influenza A virus (A/chicken/Florida/14810-2/2014(H6N2)) segment 3 polymerase PA (PA) gene, complete cds 3663 3663 100% 0.0 98% KM244107.1
Select seq gb|KM244091.1| Influenza A virus (A/chicken/Texas/9686-3/2014(H6N5)) segment 3 polymerase PA (PA) gene, complete cds 3654 3654 100% 0.0 98% KM244091.1
Select seq gb|CY186704.1| Influenza A virus (A/mallard/Illinois/12OS4466/2012(mixed)) polymerase PA (PA) and PA-X protein (PA-X) genes, complete cds 3654 3654 100% 0.0 98% CY186704.1
Select seq gb|CY186644.1| Influenza A virus (A/blue-winged teal/Illinois/12OS4763/2012(mixed)) polymerase PA (PA) and PA-X protein (PA-X) genes, complete cds 3654 3654 100% 0.0 98% CY186644.1
Select seq gb|GU051397.1| Influenza A virus (A/northern pintail/Texas/184/2002(H6N4)) segment 3 polymerase PA (PA) gene, complete cds 3609 3609 100% 0.0 97% GU051397.1
Select seq gb|GU051373.1| Influenza A virus (A/northern pintail/Texas/161/2002(H6N2)) segment 3 polymerase PA (PA) gene, complete cds 3604 3604 100% 0.0 97% GU051373.1
Select seq gb|CY017754.1| Influenza A virus (A/mallard/Alaska/708/2005(H8N4)) segment 3, complete sequence 3604 3604 100% 0.0 97% CY017754.1
Select seq gb|CY016161.1| Influenza A virus (A/gadwall/Ohio/37/1999(H6N2)) segment 3, complete sequence 3595 3595 100% 0.0 97% CY016161.1
Select seq gb|CY137045.1| Influenza A virus (A/pintail/Alberta/207/2000(H1N1)) polymerase PA (PA) and PA-X protein (PA-X) genes, complete cds 3591 3591 100% 0.0 97% CY137045.1
Select seq gb|JX454726.1| Influenza A virus (A/wild bird/Korea/GD42/2005(H4N6)) segment 3 polymerase PA (PA) gene, complete cds 3582 3582 100% 0.0 97% JX454726.1
Select seq gb|EF655833.1| Influenza A virus (A/pintail/Barrow/38/2005(H8N4)) segment 3 polymerase PA (PA) gene, complete cds 3579 3579 100% 0.0 97% EF655833.1
Select seq gb|CY081287.1| Influenza A virus (A/pintail/Alaska/314/2005(mixed)) polymerase PA (PA) gene, complete cds 3577 3577 100% 0.0 97% CY081287.1
Select seq gb|CY078464.1| Influenza A virus (A/mallard/Interior Alaska/6MP0758/2006(H10N8)) segment 3, complete sequence 3577 3577 100% 0.0 97% CY078464.1
Select seq gb|CY096771.1| Influenza A virus (A/pintail/Alaska/246/2005(mixed)) polymerase PA (PA) gene, complete cds 3575 3575 100% 0.0 97% CY096771.1
Select seq gb|JX080971.1| Influenza A virus (A/American green-winged teal/Alaska/44155-169/2006(H3N8)) segment 3 polymerase PA (PA) gene, complete cds 3573 3573 100% 0.0 97% JX080971.1
Select seq gb|CY078592.1| Influenza A virus (A/mallard/Interior Alaska/6MP0878/2006(H3N8)) segment 3, complete sequence 3573 3573 100% 0.0 97% CY078592.1
Select seq gb|CY078560.1| Influenza A virus (A/northern shoveler/Interior Alaska/6MP1339/2006(H3N8)) segment 3, complete sequence 3573 3573 100% 0.0 97% CY078560.1
Select seq gb|CY039388.1| Influenza A virus (A/mallard/Alberta/12017/2005(H2N3)) segment 3, complete sequence 3573 3573 100% 0.0 97% CY039388.1
Select seq gb|CY047032.1| Influenza A virus (A/American green-winged teal/Interior Alaska/7MP2225/2007(H3N8)) segment 3, complete sequence 3568 3568 100% 0.0 97% CY047032.1
Select seq gb|CY017762.1| Influenza A virus (A/pintail/Alaska/779/2005(H3N8)) segment 3, complete sequence 3568 3568 100% 0.0 97% CY017762.1
Select seq gb|CY078656.1| Influenza A virus (A/green-winged teal/Interior Alaska/6MP0936R1/2006(H3N8)) segment 3, complete sequence 3564 3564 100% 0.0 97% CY078656.1
Select seq gb|CY045444.1| Influenza A virus (A/northern shoveler/Alaska/7MP1708/2007(H3N8)) segment 3, complete sequence 3564 3564 100% 0.0 97% CY045444.1
Select seq gb|EF634339.1| Influenza A virus (A/mallard/Hei Longjiang/131/2006(H6N2)) segment 3 polymerase PA (PA) gene, complete cds 3564 3564 100% 0.0 97% EF634339.1
Select seq gb|CY078680.1| Influenza A virus (A/mallard/Interior Alaska/6MP0160AR1/2006(H3N8)) segment 3, complete sequence 3559 3559 100% 0.0 97% CY078680.1
Select seq gb|CY078480.1| Influenza A virus (A/green-winged teal/Interior Alaska/6MP0909/2006(H3N8)) segment 3, complete sequence 3559 3559 100% 0.0 97% CY078480.1
Select seq gb|CY078432.1| Influenza A virus (A/mallard/Interior Alaska/6MP0155/2006(H3N8)) segment 3, complete sequence 3559 3559 100% 0.0 97% CY078432.1
Select seq gb|CY039754.1| Influenza A virus (A/mallard/Interior Alaska/6/2007(H3N8)) segment 3 sequence 3559 3559 100% 0.0 97% CY039754.1
Select seq gb|JX080950.1| Influenza A virus (A/spectacled eider/Alaska/44173-055/2006(H3N8)) segment 3 polymerase PA (PA) gene, complete cds 3555 3555 100% 0.0 97% JX080950.1
Select seq gb|CY078880.1| Influenza A virus (A/mallard/Interior Alaska/6MP0124/2006(H3N8)) segment 3, complete sequence 3555 3555 100% 0.0 97% CY078880.1
Select seq gb|CY075954.1| Influenza A virus (A/double-crested cormorant/California/20119-001/2007(H3N8)) segment 3, complete sequence 3555 3555 100% 0.0 97% CY075954.1
Select seq gb|GQ923298.1| Influenza A virus (A/northern pintail/Utah/469648/2006(H5N2)) segment 3 polymerase PA (PA) gene, complete cds 3555 3555 100% 0.0 97% GQ923298.1
Select seq gb|EF592494.1| Influenza A virus (A/mallard/SanJiang/151/2006(H6N2)) polymerase PA (PA) gene, complete cds 3555 3555 100% 0.0 97% EF592494.1
Select seq gb|CY078031.1| Influenza A virus (A/mallard/Minnesota/Sg-00103/2007(H3N8)) segment 3, complete sequence 3553 3553 95% 0.0 98% CY078031.1
Select seq gb|EU557467.1| Influenza A virus (A/northern pintail/Alaska/44184-003/2006(H3N8)) segment 3 polymerase PA (PA) gene, partial cds 3552 3552 99% 0.0 97% EU557467.1
Select seq gb|EU557466.1| Influenza A virus (A/northern pintail/Alaska/44182-129/2006(H3N8)) segment 3 polymerase PA (PA) gene, partial cds 3552 3552 99% 0.0 97% EU557466.1
Select seq gb|JX080927.1| Influenza A virus (A/greater white-fronted goose/Alaska/44299-002/2007(H3N8)) segment 3 polymerase PA (PA) gene, complete cds 3550 3550 100% 0.0 97% JX080927.1
Select seq gb|JX080979.1| Influenza A virus (A/greater white-fronted goose/Alaska/44299-054/2007(H3N8)) segment 3 polymerase PA (PA) gene, complete cds 3550 3550 100% 0.0 97% JX080979.1
Select seq gb|JX080936.1| Influenza A virus (A/greater white-fronted goose/Alaska/44299-055/2007(H3N8)) segment 3 polymerase PA (PA) gene, complete cds 3550 3550 100% 0.0 97% JX080936.1
Select seq gb|JX454766.1| Influenza A virus (A/wild bird/Korea/YJ117/2007(H4N6)) segment 3 polymerase PA (PA) gene, complete cds 3550 3550 100% 0.0 97% JX454766.1
Select seq gb|CY078688.1| Influenza A virus (A/northern pintail/Interior Alaska/6MP1080R1/2006(H3N8)) segment 3, complete sequence 3550 3550 100% 0.0 97% CY078688.1
Select seq gb|CY045372.1| Influenza A virus (A/mallard/Washington/20010-002/2006(H3N8)) segment 3, complete sequence 3550 3550 100% 0.0 97% CY045372.1
Select seq gb|CY043949.1| Influenza A virus (A/northern pintail/Alaska/7MP0608/2007(H3N8)) segment 3, complete sequence 3550 3550 100% 0.0 97% CY043949.1
Select seq gb|CY036658.1| Influenza A virus (A/green-winged teal/Interior Alaska/1/2007(H3N8)) segment 3 sequence 3550 3550 100% 0.0 97% CY036658.1
Select seq gb|CY141380.1| Influenza A virus (A/northern shoveler/Interior Alaska/9BM12350R0/2009(H8N4)) polymerase PA (PA) and PA-X protein (PA-X) genes, complete cds 3546 3546 100% 0.0 97% CY141380.1
Select seq gb|JN087311.1| Influenza A virus (A/environment/Korea/SH12-6/2008(H3N8)) segment 3 polymerase PA (PA) gene, complete cds 3546 3546 100% 0.0 97% JN087311.1
Select seq gb|CY077401.1| Influenza A virus (A/mallard/Interior Alaska/7MP1094/2007(H3N8)) polymerase PA (PA) and PA-X protein (PA-X) genes, complete cds 3546 3546 100% 0.0 97% CY077401.1
Select seq gb|CY077299.1| Influenza A virus (A/northern shoveler/Interior Alaska/7MP1077/2007(H1N1)) polymerase PA (PA) and PA-X protein (PA-X) genes, complete cds 3546 3546 100% 0.0 97% CY077299.1
Select seq gb|CY039801.1| Influenza A virus (A/American green-winged teal/Interior Alaska/4/2007(H3N8)) segment 3 sequence 3546 3546 100% 0.0 97% CY039801.1
Select seq gb|CY039777.1| Influenza A virus (A/northern pintail/Interior Alaska/1/2007(H3N8)) segment 3 sequence 3546 3546 100% 0.0 97% CY039777.1
Select seq gb|CY038369.1| Influenza A virus (A/northern pintail/Interior Alaska/2/2007(H4N8)) segment 3 sequence 3546 3546 100% 0.0 97% CY038369.1
Select seq gb|EU557473.1| Influenza A virus (A/northern pintail/Alaska/44228-129/2006(H3N8)) segment 3 polymerase PA (PA) gene, partial cds 3543 3543 99% 0.0 97% EU557473.1
Select seq gb|EU557455.1| Influenza A virus (A/northern pintail/Alaska/44183-072/2006(H3N8)) segment 3 polymerase PA (PA) gene, partial cds 3543 3543 99% 0.0 97% EU557455.1
Select seq gb|JX080983.1| Influenza A virus (A/brant/Alaska/44332-536/2007(H11N9)) segment 3 polymerase PA (PA) gene, complete cds 3541 3541 100% 0.0 97% JX080983.1
Select seq gb|CY130337.1| Influenza A virus (A/American wigeon/Interior Alaska/9BM2501R1/2009(H3N8)) polymerase PA (PA) gene, complete cds 3541 3541 100% 0.0 97% CY130337.1
Select seq gb|CY103167.1| Influenza A virus (A/mallard/Alberta/279/2006(H3N8)) polymerase PA (PA) gene, complete cds 3541 3541 100% 0.0 97% CY103167.1
Select seq gb|CY101302.1| Influenza A virus (A/mallard/Alberta/127/2000(mixed)) polymerase PA (PA) gene, complete cds 3541 3541 100% 0.0 97% CY101302.1
Select seq gb|CY079048.1| Influenza A virus (A/northern pintail/Interior Alaska/7MP1460R2/2007(H3N8)) segment 3, complete sequence 3541 3541 100% 0.0 97% CY079048.1
Select seq gb|CY078952.1| Influenza A virus (A/duck/Interior Alaska/7MP1591R1/2007(H3N8)) segment 3, complete sequence 3541 3541 100% 0.0 97% CY078952.1
Select seq gb|CY077353.1| Influenza A virus (A/northern shoveler/Interior Alaska/7MP1670/2007(H3N8)) segment 3, complete sequence 3541 3541 100% 0.0 97% CY077353.1
Select seq gb|CY076266.1| Influenza A virus (A/northern shoveler/Washington/44249-664/2006(H7N3)) segment 3, complete sequence 3541 3541 100% 0.0 97% CY076266.1
Select seq gb|HM193760.1| Influenza A virus (A/mallard/Alaska/44243-071/2006(H4N6)) segment 3 polymerase PA (PA) gene, complete cds 3541 3541 100% 0.0 97% HM193760.1
Select seq gb|CY045412.1| Influenza A virus (A/northern pintail/Interior Alaska/7MP0343/2007(H3N8)) segment 3, complete sequence 3541 3541 100% 0.0 97% CY045412.1
Select seq gb|CY043989.1| Influenza A virus (A/northern pintail/Alaska/7MP1092/2007(H3N8)) segment 3, complete sequence 3541 3541 100% 0.0 97% CY043989.1
Select seq gb|CY043941.1| Influenza A virus (A/northern pintail/Alaska/7MP0344/2007(H3N8)) segment 3, complete sequence 3541 3541 100% 0.0 97% CY043941.1
Select seq gb|CY039849.1| Influenza A virus (A/mallard/Interior Alaska/7/2007(H3N8)) segment 3 sequence 3541 3541 100% 0.0 97% CY039849.1
Select seq gb|CY039825.1| Influenza A virus (A/northern shoveler/Interior Alaska/4/2007(H3N8)) segment 3 sequence 3541 3541 100% 0.0 97% CY039825.1
Select seq gb|CY035814.1| Influenza A virus (A/northern shoveler/Interior Alaska/1/2007(H3N8)) segment 3 sequence 3541 3541 100% 0.0 97% CY035814.1
Select seq gb|CY035806.1| Influenza A virus (A/American widgeon/Interior Alaska/1/2007(H3N8)) segment 3 sequence 3541 3541 100% 0.0 97% CY035806.1
Select seq gb|EU557449.1| Influenza A virus (A/northern pintail/Alaska/44155-158/2006(H3N8)) segment 3 polymerase PA (PA) gene, partial cds 3539 3539 99% 0.0 97% EU557449.1
Select seq gb|EU557474.1| Influenza A virus (A/northern pintail/Alaska/44228-173/2006(H3N8)) segment 3 polymerase PA (PA) gene, partial cds 3539 3539 99% 0.0 97% EU557474.1
Select seq gb|CY143449.1| Influenza A virus (A/American green-winged teal/Interior Alaska/9BM12714R1/2009(H3N8)) polymerase PA (PA) and PA-X protein (PA-X) genes, complete cds 3537 3537 100% 0.0 96% CY143449.1
Select seq gb|CY103524.1| Influenza A virus (A/mallard/Alberta/417/2009(H2N3)) polymerase PA (PA) gene, complete cds 3537 3537 100% 0.0 96% CY103524.1
Select seq gb|CY088718.1| Influenza A virus (A/avian/Japan/8KI0184/2008(H4N6)) polymerase PA (PA) gene, complete cds 3537 3537 100% 0.0 96% CY088718.1
Select seq gb|CY079224.1| Influenza A virus (A/avian/Japan/8KI0185/2008(H4N6)) segment 3, complete sequence 3537 3537 100% 0.0 96% CY079224.1
Select seq gb|CY079072.1| Influenza A virus (A/mallard/Interior Alaska/8BM2967/2008(H12N5)) polymerase PA (PA) and PA-X protein (PA-X) genes, complete cds 3537 3537 100% 0.0 96% CY079072.1
Select seq gb|CY077385.1| Influenza A virus (A/American green-winged teal/Interior Alaska/7MP1049/2007(H3N8)) segment 3, complete sequence 3537 3537 100% 0.0 96% CY077385.1
Select seq gb|HM193759.1| Influenza A virus (A/mallard/Alaska/44244-097/2006(H3N8)) segment 3 polymerase PA (PA) gene, complete cds 3537 3537 100% 0.0 96% HM193759.1
Select seq gb|HM059983.1| Influenza A virus (A/king eider/Alaska/44397-858/2008(H10N9)) segment 3 polymerase PA (PA) gene, complete cds 3537 3537 100% 0.0 96% HM059983.1
Select seq gb|GU361380.1| Influenza A virus (A/aquatic bird/Korea/w235/2007(H5N2)) segment 3 polymerase PA (PA) gene, complete cds 3537 3537 100% 0.0 96% GU361380.1
Select seq gb|GU050880.1| Influenza A virus (A/blue-winged teal/Texas/108/2000(H10N7)) segment 3 polymerase PA (PA) gene, complete cds 3537 3537 100% 0.0 96% GU050880.1
Select seq gb|CY047040.1| Influenza A virus (A/mallard/Interior Alaska/7MP1757/2007(H3N8)) segment 3, complete sequence 3537 3537 100% 0.0 96% CY047040.1
Select seq gb|CY044029.1| Influenza A virus (A/northern shoveler/Alaska/7MP1668/2007(H3N8)) segment 3, complete sequence 3537 3537 100% 0.0 96% CY044029.1
Select seq gb|CY043973.1| Influenza A virus (A/mallard/Alaska/7MP1028/2007(H4N8)) segment 3, complete sequence 3537 3537 100% 0.0 96% CY043973.1
Select seq gb|CY038385.1| Influenza A virus (A/American green-winged teal/Interior Alaska/3/2007(H3N8)) segment 3 sequence 3537 3537 100% 0.0 96% CY038385.1
Select seq gb|EU094472.1| Influenza A virus (A/mallard/SanJiang/113/2006(H6N2)) segment 3 polymerase PA (PA) gene, complete cds 3535 3535 99% 0.0 96% EU094472.1
Select seq gb|EU557452.1| Influenza A virus (A/northern pintail/Alaska/44160-044/2006(H3N8)) segment 3 polymerase PA (PA) gene, partial cds 3534 3534 99% 0.0 97% EU557452.1
Select seq gb|EU557480.1| Influenza A virus (A/northern pintail/Alaska/44204-073/2006(H8N4)) segment 3 polymerase PA (PA) gene, partial cds 3534 3534 99% 0.0 97% EU557480.1
Select seq gb|EU557484.1| Influenza A virus (A/northern pintail/Alaska/44204-158/2006(H6N4)) segment 3 polymerase PA (PA) gene, partial cds 3534 3534 99% 0.0 97% EU557484.1
Select seq gb|CY079064.1| Influenza A virus (A/northern pintail/Interior Alaska/8BM2528R1/2008(H3N8)) polymerase PA (PA) and PA-X protein (PA-X) genes, complete cds 3532 3532 100% 0.0 96% CY079064.1
Select seq gb|CY076482.1| Influenza A virus (A/American green-winged teal/Oregon/44336-183/2007(H3N8)) segment 3, complete sequence 3532 3532 100% 0.0 96% CY076482.1
Select seq gb|HM193757.1| Influenza A virus (A/mallard/Alaska/44243-025/2006(H4N6)) segment 3 polymerase PA (PA) gene, complete cds 3532 3532 100% 0.0 96% HM193757.1
Select seq gb|HM193743.1| Influenza A virus (A/mallard/Alaska/44244-158/2006(H4N6)) segment 3 polymerase PA (PA) gene, complete cds 3532 3532 100% 0.0 96% HM193743.1
Select seq gb|CY045452.1| Influenza A virus (A/northern pintail/Alaska/7MP0508/2007(H3N8)) segment 3, complete sequence 3532 3532 100% 0.0 96% CY045452.1
Select seq gb|CY043965.1| Influenza A virus (A/northern shoveler/Alaska/7MP1026/2007(H3N8)) segment 3, complete sequence 3532 3532 100% 0.0 96% CY043965.1
Select seq gb|CY039817.1| Influenza A virus (A/mallard/Interior Alaska/5/2007(H3N8)) segment 3 sequence 3532 3532 100% 0.0 96% CY039817.1
Select seq gb|CY039762.1| Influenza A virus (A/northern shoveler/Interior Alaska/2/2007(H3N8)) segment 3 sequence 3532 3532 100% 0.0 96% CY039762.1
Select seq gb|EU743327.1| Influenza A virus (A/northern shoveler/TX/56/2000(H10N7)) segment 3 polymerase PA (PA) gene, complete cds 3532 3532 100% 0.0 96% EU743327.1
Select seq gb|KC609870.1| Influenza A virus (A/mallard/Korea/GG1/2007(H7N7)) segment 3 polymerase PA (PA) gene, partial cds 3530 3530 99% 0.0 96% KC609870.1
Select seq gb|JN087319.1| Influenza A virus (A/environment/Korea/SH12-8/2008(H3N8)) segment 3 polymerase PA (PA) gene, partial cds 3530 3530 99% 0.0 97% JN087319.1
Select seq gb|HM193775.1| Influenza A virus (A/mallard/Alaska/44244-050/2006(H3N8)) segment 3 polymerase PA (PA) gene, complete cds 3530 3530 100% 0.0 96% HM193775.1
Select seq gb|EU557475.1| Influenza A virus (A/northern pintail/Alaska/44228-175/2006(H3N8)) segment 3 polymerase PA (PA) gene, partial cds 3530 3530 99% 0.0 97% EU557475.1
Select seq gb|KJ568376.1| Influenza A virus (A/American green-winged teal/Ohio/13OS2070/2013(H6N7)) segment 3 polymerase PA (PA) and PA-X protein (PA-X) genes, complete cds 3528 3528 100% 0.0 96% KJ568376.1
Select seq gb|CY142070.1| Influenza A virus (A/American green-winged teal/Interior Alaska/9BM7190R0/2009(H10N7)) polymerase PA (PA) and PA-X protein (PA-X) genes, complete cds 3528 3528 100% 0.0 96% CY142070.1
Select seq gb|CY080244.1| Influenza A virus (A/avian/Japan/8KI0067/2008(H3N8)) segment 3, complete sequence 3528 3528 100% 0.0 96% CY080244.1
Select seq gb|CY079619.1| Influenza A virus (A/northern pintail/Interior Alaska/8BM1995R1/2008(H12N5)) polymerase PA (PA) and PA-X protein (PA-X) genes, complete cds 3528 3528 100% 0.0 96% CY079619.1
Select seq gb|CY079240.1| Influenza A virus (A/avian/Japan/8KI0150/2008(H3N8)) segment 3, complete sequence 3528 3528 100% 0.0 96% CY079240.1
Select seq gb|CY079192.1| Influenza A virus (A/mallard/Interior Alaska/8MP0792R1/2008(H12N5)) polymerase PA (PA) and PA-X protein (PA-X) genes, complete cds 3528 3528 100% 0.0 96% CY079192.1
Select seq gb|CY079136.1| Influenza A virus (A/mallard/Interior Alaska/8BM3614/2008(H3N8)) polymerase PA (PA) and PA-X protein (PA-X) genes, complete cds 3528 3528 100% 0.0 96% CY079136.1
Select seq gb|GQ414837.1| Influenza A virus (A/spot-billed duck/Korea/625/2008(H6N1)) segment 3 polymerase PA (PA) gene, complete cds 3528 3528 100% 0.0 96% GQ414837.1
Select seq gb|HM059974.1| Influenza A virus (A/glaucous gull/Alaska/44201-161/2006(H3N8)) segment 3 polymerase PA (PA) gene, complete cds 3525 3525 100% 0.0 96% HM059974.1
Select seq gb|EU557459.1| Influenza A virus (A/northern pintail/Alaska/44191-193/2006(H12N5)) segment 3 polymerase PA (PA) gene, partial cds 3525 3525 99% 0.0 96% EU557459.1
Select seq gb|KJ568400.1| Influenza A virus (A/wood duck/Ohio/13OS3300/2013(H3N8)) segment 3 polymerase PA (PA) and PA-X protein (PA-X) genes, complete cds 3523 3523 100% 0.0 96% KJ568400.1
Select seq gb|KC609872.1| Influenza A virus (A/mallard/Korea/GG3/2007(H7N7)) segment 3 polymerase PA (PA) gene, complete cds 3523 3523 100% 0.0 96% KC609872.1
Select seq gb|CY143175.1| Influenza A virus (A/American green-winged teal/Interior Alaska/9BM12318R0/2009(H3N8)) polymerase PA (PA) and PA-X protein (PA-X) genes, complete cds 3523 3523 100% 0.0 96% CY143175.1
Select seq gb|CY142711.1| Influenza A virus (A/northern pintail/Interior Alaska/9BM7258R0/2009(H3N8)) polymerase PA (PA) and PA-X protein (PA-X) genes, complete cds 3523 3523 100% 0.0 96% CY142711.1
Select seq gb|JX080944.1| Influenza A virus (A/American green-winged teal/Alaska/44419-241/2008(H4N6)) segment 3 polymerase PA (PA) gene, complete cds 3523 3523 100% 0.0 96% JX080944.1
Select seq gb|JX080959.1| Influenza A virus (A/American green-winged teal/Alaska/44419-256/2008(H4N6)) segment 3 polymerase PA (PA) gene, complete cds 3523 3523 100% 0.0 96% JX080959.1
Select seq gb|CY135412.1| Influenza A virus (A/northern pintail/Interior Alaska/9BM4583R0/2009(H4N6)) polymerase PA (PA) and PA-X protein (PA-X) genes, complete cds 3523 3523 100% 0.0 96% CY135412.1
Select seq gb|CY135332.1| Influenza A virus (A/northern shoveler/Interior Alaska/9BM2943R1/2009(H4N6)) polymerase PA (PA) and PA-X protein (PA-X) genes, complete cds 3523 3523 100% 0.0 96% CY135332.1
Select seq gb|CY077307.1| Influenza A virus (A/northern shoveler/Interior Alaska/7MP1080/2007(H3N8)) segment 3, complete sequence 3523 3523 100% 0.0 96% CY077307.1
Select seq gb|GQ168609.1| Influenza A virus (A/Pacific golden plover/Alaska/44201-109/2006(H3N8)) segment 3 polymerase PA (PA) gene, complete cds 3523 3523 100% 0.0 96% GQ168609.1
Select seq gb|KC609871.1| Influenza A virus (A/mallard/Korea/GG2/2007(H7N7)) segment 3 polymerase PA (PA) gene, partial cds 3521 3521 99% 0.0 96% KC609871.1
Select seq gb|CY077075.1| Influenza A virus (A/mallard/Sanjiang/390/2007(H1N1)) polymerase PA (PA) and PA-X protein (PA-X) genes, complete cds 3521 3521 100% 0.0 96% CY077075.1
Select seq gb|CY079080.1| Influenza A virus (A/northern pintail/Interior Alaska/8BM2974/2008(H12N5)) polymerase PA (PA) and PA-X protein (PA-X) genes, complete cds 3521 3521 100% 0.0 96% CY079080.1
Select seq gb|EU557471.1| Influenza A virus (A/northern pintail/Alaska/44244-108/2006(H3N8)) segment 3 polymerase PA (PA) gene, partial cds 3521 3521 99% 0.0 96% EU557471.1
Select seq gb|CY142951.1| Influenza A virus (A/northern pintail/Interior Alaska/9BM7934R0/2009(H4N6)) polymerase PA (PA) and PA-X protein (PA-X) genes, complete cds 3519 3519 100% 0.0 96% CY142951.1
Select seq gb|CY142695.1| Influenza A virus (A/northern pintail/Interior Alaska/9BM7252R0/2009(H3N8)) polymerase PA (PA) and PA-X protein (PA-X) genes, complete cds 3519 3519 100% 0.0 96% CY142695.1
Select seq gb|CY142615.1| Influenza A virus (A/American green-winged teal/Interior Alaska/9BM6258R0/2009(H4N6)) polymerase PA (PA) and PA-X protein (PA-X) genes, complete cds 3519 3519 100% 0.0 96% CY142615.1
Select seq gb|CY142255.1| Influenza A virus (A/northern pintail/Interior Alaska/9BM7694R0/2009(H10N4)) polymerase PA (PA) and PA-X protein (PA-X) genes, complete cds 3519 3519 100% 0.0 96% CY142255.1
Select seq gb|KC693621.1| Influenza A virus (A/duck/Taiwan/DC167/2010(H1N3)) segment 3 polymerase PA (PA) and PA-X protein (PA-X) genes, complete cds 3519 3519 100% 0.0 96% KC693621.1
Select seq gb|CY137165.1| Influenza A virus (A/shorebird/Delaware Bay/200/2001(H10N7)) polymerase PA (PA) and PA-X protein (PA-X) genes, complete cds 3519 3519 100% 0.0 96% CY137165.1
Select seq gb|CY136235.1| Influenza A virus (A/northern pintail/Interior Alaska/9BM9663R0/2009(H4N6)) polymerase PA (PA) and PA-X protein (PA-X) genes, complete cds 3519 3519 100% 0.0 96% CY136235.1
Select seq gb|CY136136.1| Influenza A virus (A/northern pintail/Interior Alaska/9BM8109R0/2009(H8N4)) polymerase PA (PA) and PA-X protein (PA-X) genes, complete cds 3519 3519 100% 0.0 96% CY136136.1
Select seq gb|CY136067.1| Influenza A virus (A/mallard/Interior Alaska/9BM6888R0/2009(H10N7)) polymerase PA (PA) and PA-X protein (PA-X) genes, complete cds 3519 3519 100% 0.0 96% CY136067.1
Select seq gb|CY135436.1| Influenza A virus (A/northern pintail/Interior Alaska/9BM4646R0/2009(H10N7)) polymerase PA (PA) and PA-X protein (PA-X) genes, complete cds 3519 3519 100% 0.0 96% CY135436.1
Select seq gb|JF323818.1| Influenza A virus (A/Steller's eider/Alaska/44422-253/2008(H11N9)) segment 3 polymerase PA (PA) gene, complete cds 3519 3519 100% 0.0 96% JF323818.1
Select seq gb|CY080008.1| Influenza A virus (A/mallard/Interior Alaska/8BM3092/2008(H12N5)) segment 3, complete sequence 3519 3519 100% 0.0 96% CY080008.1
Select seq gb|CY079216.1| Influenza A virus (A/avian/Japan/8KI0195/2008(H6N8)) polymerase PA (PA) and PA-X protein (PA-X) genes, complete cds 3519 3519 100% 0.0 96% CY079216.1
Select seq gb|CY077267.1| Influenza A virus (A/mallard/Interior Alaska/7MP0512/2007(H4N6)) segment 3, complete sequence 3519 3519 100% 0.0 96% CY077267.1
Select seq gb|GU050903.1| Influenza A virus (A/red knot/Delaware/1561/2001(H10N7)) segment 3 polymerase PA (PA) gene, complete cds 3519 3519 100% 0.0 96% GU050903.1
Select seq gb|EU743438.1| Influenza A virus (A/ruddy turnstone/NJ/1605/2001(H10N7)) segment 3 polymerase PA (PA) gene, complete cds 3519 3519 100% 0.0 96% EU743438.1
Select seq gb|EU743446.1| Influenza A virus (A/ruddy turnstone/NJ/1956/2001(H10N7)) segment 3 polymerase PA (PA) gene, complete cds 3519 3519 100% 0.0 96% EU743446.1
Select seq gb|GU051371.2| Influenza A virus (A/ruddy turnstone/Delaware/69/2001(H6N2)) segment 3 polymerase PA (PA) gene, complete cds 3514 3514 100% 0.0 96% GU051371.2
Select seq gb|CY144257.1| Influenza A virus (A/ruddy turnstone/Delaware/828199/2001(H12N7)) polymerase PA (PA) and PA-X protein (PA-X) genes, complete cds 3514 3514 100% 0.0 96% CY144257.1
Select seq gb|CY144241.1| Influenza A virus (A/ruddy turnstone/New Jersey/828227/2001(H5N8)) polymerase PA (PA) and PA-X protein (PA-X) genes, complete cds 3514 3514 100% 0.0 96% CY144241.1
Select seq gb|CY142967.1| Influenza A virus (A/northern pintail/Interior Alaska/9BM8119R0/2009(H4N6)) polymerase PA (PA) and PA-X protein (PA-X) genes, complete cds 3514 3514 100% 0.0 96% CY142967.1
Select seq gb|CY142791.1| Influenza A virus (A/mallard/Interior Alaska/9BM11015R0/2009(H4N6)) polymerase PA (PA) and PA-X protein (PA-X) genes, complete cds 3514 3514 100% 0.0 96% CY142791.1
Select seq gb|CY142543.1| Influenza A virus (A/mallard/Interior Alaska/9BM10369R0/2009(H10N7)) polymerase PA (PA) and PA-X protein (PA-X) genes, complete cds 3514 3514 100% 0.0 96% CY142543.1
Select seq gb|CY142003.1| Influenza A virus (A/northern pintail/Interior Alaska/9BM6205R0/2009(H10N7)) polymerase PA (PA) and PA-X protein (PA-X) genes, complete cds 3514 3514 100% 0.0 96% CY142003.1
Select seq gb|CY141454.1| Influenza A virus (A/mallard/Interior Alaska/9BM10563R2/2009(H4N6)) polymerase PA (PA) and PA-X protein (PA-X) genes, complete cds 3514 3514 100% 0.0 96% CY141454.1
Select seq gb|JX080937.1| Influenza A virus (A/American green-winged teal/Alaska/44493-527/2009(H3N8)) segment 3 polymerase PA (PA) gene, complete cds 3514 3514 100% 0.0 96% JX080937.1
Select seq gb|CY137205.1| Influenza A virus (A/shorebird/Delaware Bay/216/2001(mixed)) polymerase PA (PA) and PA-X protein (PA-X) genes, complete cds 3514 3514 100% 0.0 96% CY137205.1
Select seq gb|CY137141.1| Influenza A virus (A/shorebird/Delaware Bay/192/2001(H10N7)) polymerase PA (PA) and PA-X protein (PA-X) genes, complete cds 3514 3514 100% 0.0 96% CY137141.1
Select seq gb|CY137101.1| Influenza A virus (A/shorebird/Delaware Bay/109/2001(H10N7)) polymerase PA (PA) and PA-X protein (PA-X) genes, complete cds 3514 3514 100% 0.0 96% CY137101.1
Select seq gb|CY137093.1| Influenza A virus (A/shorebird/Delaware Bay/102/2001(H10N7)) polymerase PA (PA) and PA-X protein (PA-X) genes, complete cds 3514 3514 100% 0.0 96% CY137093.1
Select seq gb|CY137085.1| Influenza A virus (A/shorebird/Delaware Bay/101/2001(H10N7)) polymerase PA (PA) and PA-X protein (PA-X) genes, complete cds 3514 3514 100% 0.0 96% CY137085.1
Select seq gb|CY137053.1| Influenza A virus (A/ruddy turnstone/Delaware Bay/31/2001(H10N7)) polymerase PA (PA) and PA-X protein (PA-X) genes, complete cds 3514 3514 100% 0.0 96% CY137053.1
Select seq gb|CY136486.1| Influenza A virus (A/shorebird/Delaware Bay/293/2001(mixed)) polymerase PA (PA) and PA-X protein (PA-X) genes, complete cds 3514 3514 100% 0.0 96% CY136486.1
Select seq gb|CY136177.1| Influenza A virus (A/northern pintail/Interior Alaska/9BM8583R0/2009(mixed)) polymerase PA (PA) and PA-X protein (PA-X) genes, complete cds 3514 3514 100% 0.0 96% CY136177.1
Select seq gb|CY135588.1| Influenza A virus (A/northern pintail/Interior Alaska/9BM5698R0/2009(H10N7)) polymerase PA (PA) and PA-X protein (PA-X) genes, complete cds 3514 3514 100% 0.0 96% CY135588.1
Select seq gb|CY135532.1| Influenza A virus (A/American green-winged teal/Interior Alaska/9BM5041R0/2009(H4N6)) polymerase PA (PA) and PA-X protein (PA-X) genes, complete cds 3514 3514 100% 0.0 96% CY135532.1
Select seq gb|CY135428.1| Influenza A virus (A/northern pintail/Interior Alaska/9BM4641R0/2009(H4N6)) polymerase PA (PA) and PA-X protein (PA-X) genes, complete cds 3514 3514 100% 0.0 96% CY135428.1
Select seq gb|CY135372.1| Influenza A virus (A/northern pintail/Interior Alaska/9BM4347R0/2009(H4N6)) polymerase PA (PA) and PA-X protein (PA-X) genes, complete cds 3514 3514 100% 0.0 96% CY135372.1
Select seq gb|CY102659.1| Influenza A virus (A/shorebird/Delaware Bay/113/2001(mixed)) polymerase PA (PA) gene, complete cds 3514 3514 100% 0.0 96% CY102659.1
Select seq gb|CY080052.1| Influenza A virus (A/mallard/Interior Alaska/8BM3519/2008(H12N5)) segment 3, complete sequence 3514 3514 100% 0.0 96% CY080052.1
Select seq gb|GU051350.1| Influenza A virus (A/ruddy turnstone/New Jersey/1851/2001(H5N8)) segment 3 polymerase PA (PA) gene, complete cds 3514 3514 100% 0.0 96% GU051350.1
Select seq gb|GU050967.1| Influenza A virus (A/ruddy turnstone/Delaware/2005/2001(H10N7)) segment 3 polymerase PA (PA) gene, complete cds 3514 3514 100% 0.0 96% GU050967.1
Select seq gb|EU743335.1| Influenza A virus (A/red knot/DE/1587/2001(H10N7)) segment 3 polymerase PA (PA) gene, complete cds 3514 3514 100% 0.0 96% EU743335.1
Select seq gb|EU743375.1| Influenza A virus (A/ruddy turnstone/DE/1529/2001(H10N7)) segment 3 polymerase PA (PA) gene, complete cds 3514 3514 100% 0.0 96% EU743375.1
Select seq gb|CY144841.1| Influenza A virus (A/sanderling/New Jersey/471580/2001(H12N7)) polymerase PA (PA) and PA-X protein (PA-X) genes, complete cds 3510 3510 100% 0.0 96% CY144841.1
Select seq gb|CY143457.1| Influenza A virus (A/mallard/Interior Alaska/9BM9984R0/2009(H4N6)) polymerase PA (PA) and PA-X protein (PA-X) genes, complete cds 3510 3510 100% 0.0 96% CY143457.1
Select seq gb|CY143015.1| Influenza A virus (A/northern pintail/Interior Alaska/9BM8815R0/2009(H4N6)) polymerase PA (PA) and PA-X protein (PA-X) genes, complete cds 3510 3510 100% 0.0 96% CY143015.1
Select seq gb|CY142879.1| Influenza A virus (A/northern pintail/Interior Alaska/9BM11915R0/2009(H4N6)) polymerase PA (PA) and PA-X protein (PA-X) genes, complete cds 3510 3510 100% 0.0 96% CY142879.1
Select seq gb|CY142767.1| Influenza A virus (A/northern pintail/Interior Alaska/9BM10877R0/2009(H4N6)) polymerase PA (PA) and PA-X protein (PA-X) genes, complete cds 3510 3510 100% 0.0 96% CY142767.1
Select seq gb|CY142687.1| Influenza A virus (A/northern pintail/Interior Alaska/9BM7232R0/2009(H4N6)) polymerase PA (PA) and PA-X protein (PA-X) genes, complete cds 3510 3510 100% 0.0 96% CY142687.1
Select seq gb|CY137254.1| Influenza A virus (A/shorebird/Delaware Bay/286/2001(H10N7)) polymerase PA (PA) and PA-X protein (PA-X) genes, complete cds 3510 3510 100% 0.0 96% CY137254.1
Select seq gb|CY137214.1| Influenza A virus (A/shorebird/Delaware Bay/261/2001(H10N7)) polymerase PA (PA) and PA-X protein (PA-X) genes, complete cds 3510 3510 100% 0.0 96% CY137214.1
Select seq gb|CY137133.1| Influenza A virus (A/shorebird/Delaware Bay/142/2001(H10N7)) polymerase PA (PA) and PA-X protein (PA-X) genes, complete cds 3510 3510 100% 0.0 96% CY137133.1
Select seq gb|CY137125.1| Influenza A virus (A/shorebird/Delaware Bay/135/2001(H10N7)) polymerase PA (PA) and PA-X protein (PA-X) genes, complete cds 3510 3510 100% 0.0 96% CY137125.1
Select seq gb|CY137109.1| Influenza A virus (A/shorebird/Delaware Bay/132/2001(H10N7)) polymerase PA (PA) and PA-X protein (PA-X) genes, complete cds 3510 3510 100% 0.0 96% CY137109.1
Select seq gb|CY137069.1| Influenza A virus (A/shorebird/Delaware Bay/43/2001(H10N7)) polymerase PA (PA) and PA-X protein (PA-X) genes, complete cds 3510 3510 100% 0.0 96% CY137069.1
Select seq gb|CY136476.1| Influenza A virus (A/shorebird/Delaware Bay/92/2001(H10N7)) polymerase PA (PA) and PA-X protein (PA-X) genes, complete cds 3510 3510 100% 0.0 96% CY136476.1
Select seq gb|CY135316.1| Influenza A virus (A/mallard/Interior Alaska/9BM8472R0/2009(mixed)) polymerase PA (PA) and PA-X protein (PA-X) genes, complete cds 3510 3510 100% 0.0 96% CY135316.1
Select seq gb|CY135296.1| Influenza A virus (A/mallard/Interior Alaska/9BM8469R0/2009(mixed)) polymerase PA (PA) and PA-X protein (PA-X) genes, complete cds 3510 3510 100% 0.0 96% CY135296.1
Select seq gb|CY135178.1| Influenza A virus (A/American green-winged teal/Interior Alaska/9BM5433R0/2009(N6)) polymerase PA (PA) and PA-X protein (PA-X) genes, complete cds 3510 3510 100% 0.0 96% CY135178.1
Select seq gb|GU051344.1| Influenza A virus (A/ruddy turnstone/Delaware/2046/2001(H5N7)) segment 3 polymerase PA (PA) gene, complete cds 3510 3510 100% 0.0 96% GU051344.1
Select seq gb|GU051195.1| Influenza A virus (A/ruddy turnstone/New Jersey/918/2005(H3N8)) segment 3 polymerase PA (PA) gene, complete cds 3510 3510 100% 0.0 96% GU051195.1
Select seq gb|GU051065.1| Influenza A virus (A/sanderling/New Jersey/821/2001(H10N7)) segment 3 polymerase PA (PA) gene, complete cds 3510 3510 100% 0.0 96% GU051065.1
Select seq gb|CY043981.1| Influenza A virus (A/American widgeon/Alaska/7MP1061/2007(H3N8)) segment 3, complete sequence 3510 3510 100% 0.0 96% CY043981.1
Select seq gb|FJ517264.1| Influenza A virus (A/shorebird/DE/1346/2001(H5N7)) segment 3 polymerase PA (PA) gene, complete cds 3510 3510 100% 0.0 96% FJ517264.1
Select seq gb|EU871865.1| Influenza A virus (A/sanderling/NJ/1042/2005(H3N6)) segment 3 polymerase PA (PA) gene, complete cds 3510 3510 100% 0.0 96% EU871865.1
Select seq gb|EU743343.1| Influenza A virus (A/red knot/GA/1721/2001(H10N7)) segment 3 polymerase PA (PA) gene, complete cds 3510 3510 100% 0.0 96% EU743343.1
Select seq gb|EU743367.1| Influenza A virus (A/ruddy turnstone/DE/1450/2001(H10N7)) segment 3 polymerase PA (PA) gene, complete cds 3510 3510 100% 0.0 96% EU743367.1
Select seq gb|EU743454.1| Influenza A virus (A/ruddy turnstone/NJ/2002/2001(H10N7)) segment 3 polymerase PA (PA) gene, complete cds 3510 3510 100% 0.0 96% EU743454.1
Select seq gb|CY021234.1| Influenza A virus (A/environment/Delaware/251/2005(H3N6)) segment 3, complete sequence 3510 3510 100% 0.0 96% CY021234.1
Select seq gb|EU557472.1| Influenza A virus (A/northern pintail/Alaska/44244-150/2006(H10N7)) segment 3 polymerase PA (PA) gene, partial cds 3507 3507 99% 0.0 96% EU557472.1
Select seq gb|CY190016.1| Influenza A virus (A/environment/Delaware/05OS237/2005(H3N8)) polymerase PA (PA) and PA-X protein (PA-X) genes, complete cds 3505 3505 100% 0.0 96% CY190016.1
Select seq gb|KC609881.1| Influenza A virus (A/common teal/Korea/MHC5-8/2009(H7N7)) segment 3 polymerase PA (PA) gene, complete cds 3505 3505 100% 0.0 96% KC609881.1
Select seq gb|CY143279.1| Influenza A virus (A/northern pintail/Interior Alaska/9BM9975R0/2009(H4N6)) polymerase PA (PA) and PA-X protein (PA-X) genes, complete cds 3505 3505 100% 0.0 96% CY143279.1
Select seq gb|CY143247.1| Influenza A virus (A/northern pintail/Interior Alaska/9BM9447R0/2009(H3N8)) polymerase PA (PA) and PA-X protein (PA-X) genes, complete cds 3505 3505 100% 0.0 96% CY143247.1
Select seq gb|CY142919.1| Influenza A virus (A/northern pintail/Interior Alaska/9BM7496R0/2009(H4N6)) polymerase PA (PA) and PA-X protein (PA-X) genes, complete cds 3505 3505 100% 0.0 96% CY142919.1
Select seq gb|CY142647.1| Influenza A virus (A/mallard/Interior Alaska/9BM6886R0/2009(H4N6)) polymerase PA (PA) and PA-X protein (PA-X) genes, complete cds 3505 3505 100% 0.0 96% CY142647.1
Select seq gb|CY137238.1| Influenza A virus (A/shorebird/Delaware Bay/267/2001(H10N7)) polymerase PA (PA) and PA-X protein (PA-X) genes, complete cds 3505 3505 100% 0.0 96% CY137238.1
Select seq gb|CY137197.1| Influenza A virus (A/shorebird/Delaware Bay/214/2001(H10N7)) polymerase PA (PA) and PA-X protein (PA-X) genes, complete cds 3505 3505 100% 0.0 96% CY137197.1
Select seq gb|CY136227.1| Influenza A virus (A/northern pintail/Interior Alaska/9BM9419R0/2009(mixed)) polymerase PA (PA) and PA-X protein (PA-X) genes, complete cds 3505 3505 100% 0.0 96% CY136227.1
Select seq gb|CY127755.1| Influenza A virus (A/shorebird/Delaware Bay/146/2005(H11N6)) polymerase PA (PA) gene, complete cds 3505 3505 100% 0.0 96% CY127755.1
Select seq gb|CY102940.1| Influenza A virus (A/shorebird/Delaware Bay/518/2005(H3N6)) polymerase PA (PA) gene, complete cds 3505 3505 100% 0.0 96% CY102940.1
Select seq gb|CY101334.1| Influenza A virus (A/shorebird/Delaware Bay/477/2005(H3N8)) polymerase PA (PA) gene, complete cds 3505 3505 100% 0.0 96% CY101334.1
Select seq gb|GU051106.1| Influenza A virus (A/ruddy turnstone/New Jersey/680/2005(H11N8)) segment 3 polymerase PA (PA) gene, complete cds 3505 3505 100% 0.0 96% GU051106.1
Select seq gb|GU050952.1| Influenza A virus (A/ruddy turnstone/Delaware/1057/2001(H10N7)) segment 3 polymerase PA (PA) gene, complete cds 3505 3505 100% 0.0 96% GU050952.1
Select seq gb|CY043909.1| Influenza A virus (A/shorebird/Delaware/246/2006(H1N1)) segment 3, complete sequence 3505 3505 100% 0.0 96% CY043909.1
Select seq gb|CY042327.1| Influenza A virus (A/mallard/Minnesota/Sg-00447/2008(H1N1)) segment 3 sequence 3505 3505 100% 0.0 96% CY042327.1
Select seq gb|CY042233.1| Influenza A virus (A/green-winged teal/Minnesota/Sg-00228/2006(H6N8)) segment 3 sequence 3505 3505 100% 0.0 96% CY042233.1
Select seq gb|EU743415.1| Influenza A virus (A/ruddy turnstone/NJ/823/2001(H10N7)) segment 3 polymerase PA (PA) gene, complete cds 3505 3505 100% 0.0 96% EU743415.1
Select seq gb|CY190976.1| Influenza A virus (A/mallard/Maryland/09OS254/2009(H1N1)) polymerase PA (PA) and PA-X protein (PA-X) genes, complete cds 3501 3501 100% 0.0 96% CY190976.1
Select seq gb|CY143023.1| Influenza A virus (A/mallard/Interior Alaska/9BM8829R0/2009(H4N6)) polymerase PA (PA) and PA-X protein (PA-X) genes, complete cds 3501 3501 100% 0.0 96% CY143023.1
Select seq gb|CY136304.1| Influenza A virus (A/mallard/Interior Alaska/9BM8470R0/2009(mixed)) polymerase PA (PA) and PA-X protein (PA-X) genes, complete cds 3501 3501 100% 0.0 96% CY136304.1
Select seq gb|CY136117.1| Influenza A virus (A/northern pintail/Interior Alaska/9BM11661R0/2009(mixed)) polymerase PA (PA) and PA-X protein (PA-X) genes, complete cds 3501 3501 100% 0.0 96% CY136117.1
Select seq gb|CY094378.1| Influenza A virus (A/northern shoveler/California/HKWF1372C/2007(H7N3)) polymerase PA (PA) gene, complete cds 3501 3501 100% 0.0 96% CY094378.1

Author:  niman [ Sun Dec 27, 2015 12:17 pm ]
Post subject:  Re: Fujian H5N8 In Klamath Co OR With Wild Bird PB1 & PA

Influenza A virus (A/American wigeon/Oregon/AH0012525/2015(H5N8)) segment 5 nucleocapsid protein (NP) gene, complete cds 2700 2700 100% 0.0 100% KU201753.1
Select seq gb|KU201745.1| Influenza A virus (A/Canada goose/Oregon/AH0012452/2015(H5N8)) segment 5 nucleocapsid protein (NP) gene, complete cds 2691 2691 100% 0.0 99% KU201745.1
Select seq gb|KU201881.1| Influenza A virus (A/American American wigeon/Washington/195198/2014(H5N8)) segment 5 nucleocapsid protein (NP) gene, complete cds 2686 2686 100% 0.0 99% KU201881.1
Select seq gb|KU201905.1| Influenza A virus (A/peregrine falcon/Washington/196426/2014(H5N8)) segment 5 nucleocapsid protein (NP) gene, complete cds 2686 2686 100% 0.0 99% KU201905.1
Select seq gb|KR150902.1| Influenza A virus (A/turkey/California/K1500169-1.2/2015(H5N8)) segment 5 nucleocapsid protein (NP) gene, complete cds 2686 2686 100% 0.0 99% KR150902.1
Select seq gb|KP307985.1| Influenza A virus (A/gyrfalcon/Washington/41088-6/2014(H5N8)) segment 5 nucleocapsid protein (NP) gene, complete cds 2686 2686 100% 0.0 99% KP307985.1
Select seq gb|KU201761.1| Influenza A virus (A/mallard/Nevada/AH0006855/2015(H5N8)) segment 5 nucleocapsid protein (NP) gene, complete cds 2682 2682 100% 0.0 99% KU201761.1
Select seq gb|KU201793.1| Influenza A virus (A/chicken/California/15-004912/2015(H5N8)) segment 5 nucleocapsid protein (NP) gene, complete cds 2682 2682 100% 0.0 99% KU201793.1
Select seq gb|KU201801.1| Influenza A virus (A/bald eagle/Idaho/15-002892-2/2015(H5N8)) segment 5 nucleocapsid protein (NP) gene, complete cds 2682 2682 100% 0.0 99% KU201801.1
Select seq gb|KU201825.1| Influenza A virus (A/American wigeon/Washington/195968/2014(H5N8)) segment 5 nucleocapsid protein (NP) gene, complete cds 2682 2682 100% 0.0 99% KU201825.1
Select seq gb|KU201841.1| Influenza A virus (A/Northern pintail/Washington/196271/2014(H5N8)) segment 5 nucleocapsid protein (NP) gene, complete cds 2682 2682 100% 0.0 99% KU201841.1
Select seq gb|KU201889.1| Influenza A virus (A/American wigeon/Washington/195205/2014(H5N8)) segment 5 nucleocapsid protein (NP) gene, complete cds 2682 2682 100% 0.0 99% KU201889.1
Select seq gb|KU201689.1| Influenza A virus (A/mallard/Idaho/AH0008597/2015(H5N8)) segment 5 nucleocapsid protein (NP) gene, complete cds 2677 2677 100% 0.0 99% KU201689.1
Select seq gb|KU201769.1| Influenza A virus (A/mallard/Idaho/AH0005954/2014(H5N8)) segment 5 nucleocapsid protein (NP) gene, complete cds 2677 2677 100% 0.0 99% KU201769.1
Select seq gb|KU201777.1| Influenza A virus (A/mallard/Idaho/AH0005955/2014(H5N8)) segment 5 nucleocapsid protein (NP) gene, complete cds 2677 2677 100% 0.0 99% KU201777.1
Select seq gb|KU201857.1| Influenza A virus (A/American wigeon/Washington/196336/2015(H5N1)) segment 5 nucleocapsid protein (NP) gene, complete cds 2677 2677 100% 0.0 99% KU201857.1
Select seq gb|KU201865.1| Influenza A virus (A/American wigeon/Washington/196340/2015(H5N1)) segment 5 nucleocapsid protein (NP) gene, complete cds 2677 2677 100% 0.0 99% KU201865.1
Select seq gb|KU201873.1| Influenza A virus (A/mallard/Oregon/195536/2014(H5N8)) segment 5 nucleocapsid protein (NP) gene, complete cds 2677 2677 100% 0.0 99% KU201873.1
Select seq gb|KP739422.1| Influenza A virus (A/American green-winged teal/Washington/195750/2014(H5N1)) segment 5 nucleocapsid protein (NP) gene, complete cds 2677 2677 100% 0.0 99% KP739422.1
Select seq gb|KU201617.1| Influenza A virus (A/American wigeon/Utah/AH0007824/2015(H5N8)) segment 5 nucleocapsid protein (NP) gene, complete cds 2673 2673 100% 0.0 99% KU201617.1
Select seq gb|KT388701.1| Influenza A virus (A/goose/Taiwan/TNO19/2015(H5N8)) segment 5 cRNA sequence 2668 2668 100% 0.0 99% KT388701.1
Select seq gb|KT388693.1| Influenza A virus (A/goose/Taiwan/TNO18/2015(H5N8)) segment 5 cRNA sequence 2668 2668 100% 0.0 99% KT388693.1
Select seq gb|KT388685.1| Influenza A virus (A/goose/Taiwan/TNO17/2015(H5N8)) segment 5 cRNA sequence 2668 2668 100% 0.0 99% KT388685.1
Select seq gb|KT388653.1| Influenza A virus (A/goose/Taiwan/TNO13/2015(H5N8)) segment 5 cRNA sequence 2668 2668 100% 0.0 99% KT388653.1
Select seq gb|KT388645.1| Influenza A virus (A/goose/Taiwan/TNO12/2015(H5N8)) segment 5 cRNA sequence 2668 2668 100% 0.0 99% KT388645.1
Select seq gb|KT388637.1| Influenza A virus (A/goose/Taiwan/TNO11/2015(H5N8)) segment 5 cRNA sequence 2668 2668 100% 0.0 99% KT388637.1
Select seq gb|KT388613.1| Influenza A virus (A/goose/Taiwan/TNO8/2015(H5N8)) segment 5 cRNA sequence 2668 2668 100% 0.0 99% KT388613.1
Select seq gb|KT388557.1| Influenza A virus (A/goose/Taiwan/TNO1/2015(H5N8)) segment 5 cRNA sequence 2668 2668 100% 0.0 99% KT388557.1
Select seq gb|KT388549.1| Influenza A virus (A/goose/Taiwan/TNC14/2015(H5N8)) segment 5 cRNA sequence 2668 2668 100% 0.0 99% KT388549.1
Select seq gb|KT388533.1| Influenza A virus (A/goose/Taiwan/TNC12/2015(H5N8)) segment 5 cRNA sequence 2668 2668 100% 0.0 99% KT388533.1
Select seq gb|KT388517.1| Influenza A virus (A/goose/Taiwan/TNC10/2015(H5N8)) segment 5 cRNA sequence 2668 2668 100% 0.0 99% KT388517.1
Select seq gb|KT388501.1| Influenza A virus (A/goose/Taiwan/TNC8/2015(H5N8)) segment 5 cRNA sequence 2668 2668 100% 0.0 99% KT388501.1
Select seq gb|KT388493.1| Influenza A virus (A/goose/Taiwan/TNC7/2015(H5N8)) segment 5 cRNA sequence 2668 2668 100% 0.0 99% KT388493.1
Select seq gb|KT388485.1| Influenza A virus (A/goose/Taiwan/TNC6/2015(H5N8)) segment 5 cRNA sequence 2668 2668 100% 0.0 99% KT388485.1
Select seq gb|KT388453.1| Influenza A virus (A/goose/Taiwan/TNC2/2015(H5N8)) segment 5 cRNA sequence 2668 2668 100% 0.0 99% KT388453.1
Select seq gb|KT388445.1| Influenza A virus (A/goose/Taiwan/TNC1/2015(H5N8)) segment 5 cRNA sequence 2668 2668 100% 0.0 99% KT388445.1
Select seq gb|KJ756647.1| Influenza A virus (A/baikal teal/Korea/1456/2014(H5N8)) segment 5 nucleocapsid protein (NP) gene, complete cds 2668 2668 100% 0.0 99% KJ756647.1
Select seq gb|KT388661.1| Influenza A virus (A/goose/Taiwan/TNO14/2015(H5N8)) segment 5 cRNA sequence 2664 2664 100% 0.0 99% KT388661.1
Select seq gb|KT388629.1| Influenza A virus (A/goose/Taiwan/TNO10/2015(H5N8)) segment 5 cRNA sequence 2664 2664 100% 0.0 99% KT388629.1
Select seq gb|KT388605.1| Influenza A virus (A/goose/Taiwan/TNO7/2015(H5N8)) segment 5 cRNA sequence 2664 2664 100% 0.0 99% KT388605.1
Select seq gb|KT388573.1| Influenza A virus (A/goose/Taiwan/TNO3/2015(H5N8)) segment 5 cRNA sequence 2664 2664 100% 0.0 99% KT388573.1
Select seq gb|KT388509.1| Influenza A virus (A/goose/Taiwan/TNC9/2015(H5N8)) segment 5 cRNA sequence 2664 2664 100% 0.0 99% KT388509.1
Select seq gb|KT388461.1| Influenza A virus (A/goose/Taiwan/TNC3/2015(H5N8)) segment 5 cRNA sequence 2664 2664 100% 0.0 99% KT388461.1
Select seq gb|KJ756638.1| Influenza A virus (A/baikal teal/Korea/1437/2014(H5N8)) segment 5 nucleocapsid protein (NP) gene, complete cds 2664 2664 100% 0.0 99% KJ756638.1
Select seq gb|KJ508933.1| Influenza A virus (A/Baikal teal/Korea/H41/2014(H5N8)) segment 5 nucleocapsid protein (NP) gene, complete cds 2664 2664 100% 0.0 99% KJ508933.1
Select seq gb|KJ509141.1| Influenza A virus (A/bean goose/Korea/H328/2014(H5N8)) segment 5 nucleocapsid protein (NP) gene, complete cds 2664 2664 100% 0.0 99% KJ509141.1
Select seq gb|KT388541.1| Influenza A virus (A/goose/Taiwan/TNC13/2015(H5N8)) segment 5 cRNA sequence 2661 2661 100% 0.0 99% KT388541.1
Select seq gb|KJ756642.1| Influenza A virus (A/baikal teal/Korea/1447/2014(H5N8)) segment 5 nucleocapsid protein (NP) gene, complete cds 2659 2659 100% 0.0 99% KJ756642.1
Select seq gb|KJ756640.1| Influenza A virus (A/baikal teal/Korea/1445/2014(H5N8)) segment 5 nucleocapsid protein (NP) gene, complete cds 2659 2659 100% 0.0 99% KJ756640.1
Select seq gb|KJ509053.1| Influenza A virus (A/breeder duck/Korea/H128/2014(H5N8)) segment 5 nucleocapsid protein (NP) gene, complete cds 2659 2659 100% 0.0 99% KJ509053.1
Select seq gb|KJ509077.1| Influenza A virus (A/breeder duck/Korea/H158/2014(H5N8)) segment 5 nucleocapsid protein (NP) gene, complete cds 2659 2659 100% 0.0 99% KJ509077.1
Select seq gb|KJ509101.1| Influenza A virus (A/white-fronted goose/Korea/H231/2014(H5N8)) segment 5 nucleocapsid protein (NP) gene, complete cds 2659 2659 100% 0.0 99% KJ509101.1
Select seq gb|KJ509133.1| Influenza A virus (A/mallard/Korea/H297/2014(H5N8)) segment 5 nucleocapsid protein (NP) gene, complete cds 2659 2659 100% 0.0 99% KJ509133.1
Select seq gb|KJ746112.1| Influenza A virus (A/mallard/Korea/W452/2014(H5N8)) segment 5 nucleocapsid protein (NP) gene, complete cds 2659 2659 100% 0.0 99% KJ746112.1
Select seq dbj|AB932557.1| Influenza A virus (A/chicken/kumamoto/1-7/2014(H5N8)) NP gene for nucleocapsid protein, complete cds 2659 2659 100% 0.0 99% AB932557.1
Select seq gb|KJ756639.1| Influenza A virus (A/baikal teal/Korea/1441/2014(H5N8)) segment 5 nucleocapsid protein (NP) gene, complete cds 2655 2655 100% 0.0 99% KJ756639.1
Select seq gb|KJ509093.1| Influenza A virus (A/mallard/Korea/H207/2014(H5N8)) segment 5 nucleocapsid protein (NP) gene, complete cds 2655 2655 100% 0.0 99% KJ509093.1
Select seq gb|KJ509157.1| Influenza A virus (A/common teal/Korea/H455-30/2014(H5N8)) segment 5 nucleocapsid protein (NP) gene, complete cds 2655 2655 100% 0.0 99% KJ509157.1
Select seq gb|KJ413851.1| Influenza A virus (A/baikal teal/Korea/Donglim3/2014(H5N8)) segment 5 nucleocapsid protein (NP) gene, complete cds 2655 2655 100% 0.0 99% KJ413851.1
Select seq gb|KJ756644.1| Influenza A virus (A/baikal teal/Korea/1449/2014(H5N8)) segment 5 nucleocapsid protein (NP) gene, complete cds 2650 2650 100% 0.0 99% KJ756644.1
Select seq gb|KJ508981.1| Influenza A virus (A/Baikal teal/Korea/H62/2014(H5N8)) segment 5 nucleocapsid protein (NP) gene, complete cds 2650 2650 100% 0.0 99% KJ508981.1
Select seq gb|KJ509061.1| Influenza A virus (A/broiler duck/Korea/H133/2014(H5N8)) segment 5 nucleocapsid protein (NP) gene, complete cds 2650 2650 100% 0.0 99% KJ509061.1
Select seq gb|KJ509165.1| Influenza A virus (A/spot-billed duck/Korea/H455-42/2014(H5N8)) segment 5 nucleocapsid protein (NP) gene, complete cds 2650 2650 100% 0.0 99% KJ509165.1
Select seq gb|KJ511813.1| Influenza A virus (A/waterfowl/Korea/S005/2014(H5N8)) segment 5 nucleocapsid protein (NP) gene, complete cds 2650 2650 100% 0.0 99% KJ511813.1
Select seq gb|KJ413843.1| Influenza A virus (A/broiler duck/Korea/Buan2/2014(H5N8)) segment 5 nucleocapsid protein (NP) gene, complete cds 2650 2650 100% 0.0 99% KJ413843.1
Select seq gb|KR233675.1| Influenza A virus (A/eurasian wigeon/Netherlands/1/2014(H5N8)) segment 5 nucleocapsid protein (NP) gene, partial cds 2614 2614 99% 0.0 99% KR233675.1
Select seq gb|KR233683.1| Influenza A virus (A/eurasian wigeon/Netherlands/2/2014(H5N8)) segment 5 nucleocapsid protein (NP) gene, partial cds 2605 2605 99% 0.0 99% KR233683.1
Select seq gb|KR232365.1| Influenza A virus (A/eurasian wigeon/Netherlands/1/2015(H5N8)) segment 5 nucleocapsid protein (NP) gene, partial cds 2605 2605 99% 0.0 99% KR232365.1
Select seq gb|JX534550.1| Influenza A virus (A/wild duck/Shandong/1/2011(H5N1)) segment 5 nucleocapsid protein (NP) gene, complete cds 2601 2601 100% 0.0 99% JX534550.1
Select seq gb|KR233691.1| Influenza A virus (A/chicken/Netherlands/emc-3/2014(H5N8)) segment 5 nucleocapsid protein (NP) gene, partial cds 2596 2596 98% 0.0 99% KR233691.1
Select seq gb|JX507356.1| Influenza A virus (A/duck/Jiangsu/m234/2012(H5N2)) segment 5 nucleocapsid protein (NP) gene, complete cds 2596 2596 100% 0.0 98% JX507356.1
Select seq gb|JX534566.1| Influenza A virus (A/wild duck/Shandong/628/2011(H5N1)) segment 5 nucleocapsid protein (NP) gene, complete cds 2592 2592 100% 0.0 98% JX534566.1
Select seq gb|JQ973695.1| Influenza A virus (A/duck/Jiangsu/k1203/2010(H5N8)) segment 5 nucleocapsid protein (NP) gene, partial cds 2545 2545 98% 0.0 98% JQ973695.1
Select seq gb|KJ508966.1| Influenza A virus (A/Baikal teal/Korea/H52/2014(H5N8)) segment 5 nucleocapsid protein (NP) gene, complete cds 2533 2533 100% 0.0 98% KJ508966.1
Select seq gb|KJ413835.1| Influenza A virus (A/breeder duck/Korea/Gochang1/2014(H5N8)) segment 5 nucleocapsid protein (NP) gene, complete cds 2533 2533 100% 0.0 98% KJ413835.1
Select seq gb|KP417070.1| Influenza A virus (A/duck/Jiangxi/23970/2013(mixed)) clone b segment 5 nucleocapsid protein (NP) gene, complete cds 2529 2529 100% 0.0 97% KP417070.1
Select seq gb|KP414811.1| Influenza A virus (A/duck/Shaoxing/5240/2013(mixed)) segment 5 nucleocapsid protein (NP) gene, complete cds 2529 2529 100% 0.0 97% KP414811.1
Select seq gb|KJ476672.1| Influenza A virus (A/duck/Zhejiang/6D18/2013(H5N8)) segment 5 nucleocapsid protein (NP) gene, complete cds 2524 2524 100% 0.0 97% KJ476672.1
Select seq gb|KT221067.1| Influenza A virus (A/goose/Jiangsu/QD5/2014(H5N8)) segment 5 nucleocapsid protein (NP) gene, complete cds 2520 2520 100% 0.0 97% KT221067.1
Select seq gb|KP286575.1| Influenza A virus (A/duck/Ningbo/3262/2013(mixed)) segment 5 nucleocapsid protein (NP) gene, complete cds 2520 2520 100% 0.0 97% KP286575.1
Select seq gb|KJ476658.1| Influenza A virus (A/mallard/Shanghai/SH-9/2013(H5N8)) segment 5 nucleocapsid protein (NP) gene, complete cds 2520 2520 100% 0.0 97% KJ476658.1
Select seq gb|KT221075.1| Influenza A virus (A/goose/Shandong/WFSG1/2014(H5N8)) segment 5 nucleocapsid protein (NP) gene, complete cds 2515 2515 100% 0.0 97% KT221075.1
Select seq gb|KT221083.1| Influenza A virus (A/goose/Yangzhou/0420/2014(H5N8)) segment 5 nucleocapsid (NP) gene, complete cds 2511 2511 100% 0.0 97% KT221083.1
Select seq gb|KT383487.1| Influenza A virus (A/duck/Guangdong/s14044/2014(H5N8)) segment 5 nucleocapsid protein (NP) gene, complete cds 2511 2511 100% 0.0 97% KT383487.1
Select seq gb|KJ476671.1| Influenza A virus (A/duck/Zhejiang/W24/2013(H5N8)) segment 5 nucleocapsid protein (NP) gene, complete cds 2511 2511 100% 0.0 97% KJ476671.1
Select seq gb|KM504102.1| Influenza A virus (A/duck/Shandong/Q1/2013(H5N8)) segment 5 nucleocapsid protein (NP) gene, complete cds 2502 2502 99% 0.0 97% KM504102.1
Select seq gb|KU042789.1| Influenza A virus (A/goose/Zhejiang/925106/2014(H5N6)) segment 5 nucleocapsid protein (NP) gene, complete cds 2479 2479 100% 0.0 97% KU042789.1
Select seq gb|KU042797.1| Influenza A virus (A/duck/Zhejiang/925169/2014(H5N8)) segment 5 nucleocapsid protein (NP) gene, complete cds 2479 2479 100% 0.0 97% KU042797.1
Select seq gb|KU042799.1| Influenza A virus (A/goose/Zhejiang/925104/2014(H5N8)) segment 5 nucleocapsid protein (NP) gene, complete cds 2475 2475 100% 0.0 97% KU042799.1
Select seq gb|KU042796.1| Influenza A virus (A/duck/Zhejiang/925019/2014(H5N8)) segment 5 nucleocapsid protein (NP) gene, complete cds 2470 2470 100% 0.0 97% KU042796.1
Select seq gb|CY091636.1| Influenza A virus (A/duck/Guangdong/wy19/2008(H5N5)) nucleocapsid protein (NP) gene, complete cds 2415 2415 100% 0.0 96% CY091636.1
Select seq gb|CY091628.1| Influenza A virus (A/duck/Guangdong/wy11/2008(H5N5)) nucleocapsid protein (NP) gene, complete cds 2415 2415 100% 0.0 96% CY091628.1
Select seq gb|GU727654.1| Influenza A virus (A/duck/Eastern China/008/2008(H5N5)) segment 5 nucleocapsid protein (NP) gene, complete cds 2412 2412 99% 0.0 96% GU727654.1
Select seq gb|GU727670.1| Influenza A virus (A/duck/Eastern China/108/2008(H5N1)) segment 5 nucleocapsid protein (NP) gene, complete cds 2412 2412 100% 0.0 96% GU727670.1
Select seq gb|JQ041405.1| Influenza A virus (A/duck/Eastern China/1111/2011(H5N2)) segment 5 nucleocapsid protein (NP) gene, complete cds 2406 2406 100% 0.0 96% JQ041405.1
Select seq gb|GU727662.1| Influenza A virus (A/duck/Eastern China/031/2009(H5N5)) segment 5 nucleocapsid protein (NP) gene, complete cds 2406 2406 100% 0.0 96% GU727662.1
Select seq gb|KC282880.1| Influenza A virus (A/duck/Jiangsu/1-15/2011(H4N2)) segment 5 nucleocapsid protein (NP) gene, complete cds 2403 2403 100% 0.0 96% KC282880.1
Select seq gb|CY091644.1| Influenza A virus (A/duck/Guangdong/wy24/2008(H5N5)) nucleocapsid protein (NP) gene, complete cds 2397 2397 100% 0.0 96% CY091644.1
Select seq gb|JQ041406.1| Influenza A virus (A/goose/Eastern China/1112/2011(H5N2)) segment 5 nucleocapsid protein (NP) gene, complete cds 2397 2397 100% 0.0 96% JQ041406.1
Select seq gb|HM145113.1| Influenza A virus (A/duck/Shantou/494/2002(H6N2)) segment 5 nucleocapsid protein (NP) gene, complete cds 2397 2397 100% 0.0 96% HM145113.1
Select seq gb|JQ973687.1| Influenza A virus (A/goose/Guangdong/k0103/2010(H5N5)) segment 5 nucleocapsid protein (NP) gene, complete cds 2394 2394 100% 0.0 95% JQ973687.1
Select seq gb|HM145081.1| Influenza A virus (A/duck/Shantou/728/2001(H6N2)) segment 5 nucleocapsid protein (NP) gene, complete cds 2394 2394 100% 0.0 95% HM145081.1
Select seq gb|HM145101.1| Influenza A virus (A/duck/Shantou/4534/2001(H6N2)) segment 5 nucleocapsid protein (NP) gene, complete cds 2379 2379 100% 0.0 95% HM145101.1
Select seq gb|GQ162790.1| Influenza A virus (A/duck/Primorie/2621/2001(H5N2)) segment 5 nucleocapsid protein (NP) gene, complete cds 2376 2376 100% 0.0 95% GQ162790.1
Select seq gb|KU042798.1| Influenza A virus (A/goose/Zhejiang/925037/2014(H5N8)) segment 5 nucleocapsid protein (NP) gene, complete cds 2370 2370 100% 0.0 95% KU042798.1
Select seq gb|GQ227606.1| Influenza A virus (A/duck/Primorie/2633/2001(H5N3)) segment 5 nucleocapsid protein (NP) gene, complete cds 2361 2361 100% 0.0 95% GQ227606.1
Select seq gb|HM145190.1| Influenza A virus (A/duck/Hunan/491/2005(H6N2)) segment 5 nucleocapsid protein (NP) gene, complete cds 2352 2352 100% 0.0 95% HM145190.1
Select seq gb|JF965207.1| Influenza A virus (A/duck/Eastern China/50/2002(H6N8)) segment 5 nucleocapsid protein (NP) gene, complete cds 2349 2349 100% 0.0 95% JF965207.1
Select seq emb|AJ427298.1| Influenza A virus (A/aquatic bird/Hong Kong/399/99(H3N8)) NP gene for nucleoprotein, genomic RNA 2349 2349 100% 0.0 95% AJ427298.1
Select seq gb|HM145146.1| Influenza A virus (A/duck/Shantou/1838/2003(H6N2)) segment 5 nucleocapsid protein (NP) gene, complete cds 2343 2343 100% 0.0 95% HM145146.1
Select seq gb|JF965211.1| Influenza A virus (A/duck/Eastern China/55/2003(H6N2)) segment 5 nucleocapsid protein (NP) gene, complete cds 2340 2340 100% 0.0 95% JF965211.1
Select seq gb|EF597347.3| Influenza A virus (A/wild duck/Shantou/1737/2000(H6N8)) nucleoprotein (NP) gene, complete cds 2340 2340 100% 0.0 95% EF597347.3
Select seq dbj|AB268554.2| Influenza A virus (A/duck/Mongolia/47/2001(H7N1)) NP gene for nucleoprotein, complete cds 2340 2340 100% 0.0 95% AB268554.2
Select seq gb|KF259811.1| Influenza A virus (A/duck/Guangdong/707/2000(H2N9)) segment 5 nucleocapsid protein (NP) gene, complete cds 2334 2334 100% 0.0 95% KF259811.1
Select seq gb|JQ973679.1| Influenza A virus (A/quail/Jiangsu/k0104/2010(H5N5)) segment 5 nucleocapsid protein (NP) gene, complete cds 2334 2334 100% 0.0 95% JQ973679.1
Select seq gb|JF965212.1| Influenza A virus (A/duck/Eastern China/57/2003(H6N2)) segment 5 nucleocapsid protein (NP) gene, complete cds 2334 2334 100% 0.0 95% JF965212.1
Select seq gb|JF965197.1| Influenza A virus (A/duck/Eastern China/29/2004(H6N2)) segment 5 nucleocapsid protein (NP) gene, complete cds 2334 2334 100% 0.0 95% JF965197.1
Select seq gb|CY117376.1| Influenza A virus (A/wild duck/Shantou/992/2000(H2N8)) nucleocapsid protein (NP) gene, complete cds 2331 2331 100% 0.0 95% CY117376.1
Select seq gb|EF597352.1| Influenza A virus (A/duck/Jiang Xi/197820/2003(H5N3)) nucleoprotein (NP) gene, complete cds 2331 2331 100% 0.0 95% EF597352.1
Select seq gb|DQ997327.1| Influenza A virus (A/chicken/Jilin/hk/2004(H5N1)) nucleoprotein (NP) gene, complete cds 2331 2331 100% 0.0 95% DQ997327.1
Select seq gb|AY862661.1| Influenza A virus (A/duck/Korea/S17/03(H6N1)) nucleocapsid protein (NP) gene, complete cds 2331 2331 100% 0.0 95% AY862661.1
Select seq gb|EF597348.2| Influenza A virus (A/wild duck/Shantou/19988/2000(H4N9)) nucleoprotein (NP) gene, partial cds 2329 2329 99% 0.0 95% EF597348.2
Select seq gb|AY585428.1| Influenza A virus (A/duck/Guangdong/40/2000(H5N1)) nucleoprotein (NP) mRNA, complete cds 2327 2327 99% 0.0 95% AY585428.1
Select seq gb|KF695337.1| Influenza A virus (A/mallard/Sweden/105/2002(H7N7)) segment 5 nucleocapsid protein (NP) gene, complete cds 2325 2325 100% 0.0 94% KF695337.1
Select seq gb|JF965209.1| Influenza A virus (A/duck/Eastern China/52/2002(H6N2)) segment 5 nucleocapsid protein (NP) gene, complete cds 2325 2325 100% 0.0 95% JF965209.1
Select seq gb|JF965208.1| Influenza A virus (A/duck/Eastern China/51/2002(H6N2)) segment 5 nucleocapsid protein (NP) gene, complete cds 2325 2325 100% 0.0 94% JF965208.1
Select seq gb|JF965198.1| Influenza A virus (A/duck/Eastern China/31/2004(H6N2)) segment 5 nucleocapsid protein (NP) gene, complete cds 2325 2325 100% 0.0 94% JF965198.1
Select seq gb|HM145233.1| Influenza A virus (A/wild duck/Shantou/311/2001(H6N9)) segment 5 nucleocapsid protein (NP) gene, complete cds 2325 2325 100% 0.0 94% HM145233.1
Select seq gb|HM145087.1| Influenza A virus (A/duck/Shantou/1586/2001(H6N2)) segment 5 nucleocapsid protein (NP) gene, complete cds 2325 2325 100% 0.0 94% HM145087.1
Select seq gb|GU053145.1| Influenza A virus (A/mallard/Sweden/105/2002(H7N7)) segment 5 nucleocapsid protein (NP) gene, complete cds 2325 2325 100% 0.0 94% GU053145.1
Select seq gb|HM145079.1| Influenza A virus (A/duck/Shantou/1840/2000(H6N2)) segment 5 nucleocapsid protein (NP) gene, complete cds 2322 2322 100% 0.0 94% HM145079.1
Select seq gb|HM145066.1| Influenza A virus (A/mallard/Jiangxi/6845/2003(H6N1)) segment 5 nucleocapsid protein (NP) gene, complete cds 2322 2322 100% 0.0 94% HM145066.1
Select seq gb|CY060336.1| Influenza A virus (A/mallard/Sweden/58/2003(H11N1)) segment 5 sequence 2322 2322 100% 0.0 94% CY060336.1
Select seq gb|EF597349.2| Influenza A virus (A/wild duck/Shantou/1411/2000(H11N3)) nucleoprotein (NP) gene, partial cds 2320 2320 99% 0.0 95% EF597349.2
Select seq gb|CY165581.1| Influenza A virus (A/mallard/Sweden/80166/2008(H4N6)) nucleocapsid protein (NP) gene, complete cds 2316 2316 100% 0.0 94% CY165581.1
Select seq gb|KF259812.1| Influenza A virus (A/duck/Guangdong/455/2000(H3N9)) segment 5 nucleocapsid protein (NP) gene, complete cds 2316 2316 100% 0.0 94% KF259812.1
Select seq gb|CY121970.1| Influenza A virus (A/mallard/Netherlands/31/2006(H2N2)) nucleocapsid protein (NP) gene, complete cds 2316 2316 100% 0.0 94% CY121970.1
Select seq gb|CY109323.1| Influenza A virus (A/duck/Hunan/4056/2006(H6N8)) nucleocapsid protein (NP) gene, complete cds 2316 2316 100% 0.0 94% CY109323.1
Select seq gb|CY041229.1| Influenza A virus (A/mallard/Netherlands/31/2006(H2N2)) segment 5, complete sequence 2316 2316 100% 0.0 94% CY041229.1
Select seq gb|DQ997320.1| Influenza A virus (A/chicken/Jilin/hj/2003(H5N1)) nucleoprotein (NP) gene, complete cds 2316 2316 100% 0.0 94% DQ997320.1
Select seq gb|CY183810.1| Influenza A virus (A/mallard/Sweden/69773/2007(H10N5)) nucleocapsid protein (NP) gene, complete cds 2313 2313 100% 0.0 94% CY183810.1
Select seq gb|KF259759.1| Influenza A virus (A/wild duck/Jiangxi/19615/2009(H7N8)) segment 5 nucleocapsid protein (NP) gene, complete cds 2313 2313 100% 0.0 94% KF259759.1
Select seq gb|CY117198.1| Influenza A virus (A/duck/Nanchang/2-0485/2000(H2N9)) nucleocapsid protein (NP) gene, complete cds 2313 2313 100% 0.0 94% CY117198.1
Select seq gb|HM145090.1| Influenza A virus (A/wild duck/Shantou/2395/2001(H6N2)) segment 5 nucleocapsid protein (NP) gene, complete cds 2313 2313 100% 0.0 94% HM145090.1
Select seq gb|CY005433.1| Influenza A virus (A/Duck/Nanchang/2-0486/2000(H2N9)) segment 5, complete sequence 2313 2313 100% 0.0 94% CY005433.1
Select seq gb|JF965217.1| Influenza A virus (A/duck/Eastern China/54/2002(H6N2)) segment 5 nucleocapsid protein (NP) gene, complete cds 2311 2311 100% 0.0 94% JF965217.1
Select seq dbj|AB839937.1| Influenza A virus (A/duck/Quang Ninh/17/2013(H6N6)) viral cRNA, segment 5, complete sequence 2307 2307 100% 0.0 94% AB839937.1
Select seq gb|JX878676.1| Influenza A virus (A/swine/HuBei/06/2009(H4N1)) segment 5 nucleocapsid protein (NP) gene, complete cds 2307 2307 100% 0.0 94% JX878676.1
Select seq gb|HM145229.1| Influenza A virus (A/duck/Shantou/2954/2003(H6N8)) segment 5 nucleocapsid protein (NP) gene, complete cds 2307 2307 100% 0.0 94% HM145229.1
Select seq gb|HM145153.1| Influenza A virus (A/duck/Shantou/3550/2003(H6N2)) segment 5 nucleocapsid protein (NP) gene, complete cds 2307 2307 100% 0.0 94% HM145153.1
Select seq gb|KU161076.1| Influenza A virus (A/goose/Hunan/S2466/2011(H4N8)) segment 5 nucleocapsid protein (NP) gene, complete cds 2304 2304 100% 0.0 94% KU161076.1
Select seq dbj|LC053469.1| Influenza A virus (A/duck/Quang Ninh/90c112/2013(H3N2)) viral cRNA, segment 5, complete sequence 2304 2304 100% 0.0 94% LC053469.1
Select seq gb|CY183818.1| Influenza A virus (A/mallard/Sweden/69777/2007(H10N6)) nucleocapsid protein (NP) gene, complete cds 2304 2304 100% 0.0 94% CY183818.1
Select seq gb|CY164195.1| Influenza A virus (A/mallard/Sweden/80261/2008(H4N9)) nucleocapsid protein (NP) gene, complete cds 2304 2304 100% 0.0 94% CY164195.1
Select seq gb|KF259772.1| Influenza A virus (A/duck/Guizhou/1078/2011(H11N9)) segment 5 nucleocapsid protein (NP) gene, complete cds 2304 2304 100% 0.0 94% KF259772.1
Select seq gb|JQ973671.1| Influenza A virus (A/goose/Shandong/k1204/2009(H5N5)) segment 5 nucleocapsid protein (NP) gene, partial cds 2304 2304 98% 0.0 95% JQ973671.1
Select seq gb|HM145228.1| Influenza A virus (A/duck/Hunan/1469/2002(H6N8)) segment 5 nucleocapsid protein (NP) gene, complete cds 2304 2304 100% 0.0 94% HM145228.1
Select seq gb|CY060179.1| Influenza A virus (A/common teal/Netherlands/10/2000(H1N1)) segment 5 sequence 2304 2304 100% 0.0 94% CY060179.1
Select seq gb|CY005395.1| Influenza A virus (A/mallard duck/AST/244/1982(H14N6)) segment 5, complete sequence 2304 2304 100% 0.0 94% CY005395.1
Select seq gb|GU361152.1| Influenza A virus (A/aquatic bird/Korea/w16/2005(H5N3)) segment 5 nucleocapsid protein (NP) gene, partial cds 2300 2300 99% 0.0 94% GU361152.1
Select seq gb|JF965178.1| Influenza A virus (A/chicken/Eastern China/42/2007(H6N2)) segment 5 nucleocapsid protein (NP) gene, complete cds 2298 2298 100% 0.0 94% JF965178.1
Select seq gb|GU050305.1| Influenza A virus (A/avian/Egypt/920431/2006(H9N2)) segment 5 nucleocapsid protein (NP) gene, complete cds 2298 2298 100% 0.0 94% GU050305.1
Select seq gb|GQ325639.1| Influenza A virus (A/environment/Dongting Lake/Hunan/3-9/2007(H10N8)) mouse adapted-P2 segment 5 nucleocapsid protein (NP) gene, complete cds 2298 2298 100% 0.0 94% GQ325639.1
Select seq gb|CY034761.1| Influenza A virus (A/mallard/Italy/4223-2/2006(H5N2)) segment 5, complete sequence 2298 2298 100% 0.0 94% CY034761.1
Select seq gb|EF597337.1| Influenza A virus (A/migratory duck/Jiang Xi/13487/2005(H5N3)) nucleoprotein (NP) gene, partial cds 2298 2298 98% 0.0 94% EF597337.1
Select seq gb|M30764.1|FLANPV Influenza A virus (A/mallard/Astrakhan/244/1982(N6)) nucleoprotein, complete cds 2298 2298 100% 0.0 94% M30764.1
Select seq gb|JF965181.1| Influenza A virus (A/chicken/Eastern China/45/2007(H6N2)) segment 5 nucleocapsid protein (NP) gene, complete cds 2295 2295 100% 0.0 94% JF965181.1
Select seq gb|GQ325655.1| Influenza A virus (A/environment/Dongting Lake/Hunan/3-9/2007(H10N8)) mouse adapted-P6 segment 5 nucleocapsid protein (NP) gene, complete cds 2295 2295 100% 0.0 94% GQ325655.1
Select seq gb|GQ290469.1| Influenza A virus (A/environment/Dongting Lake/Hunan/3-9/2007(H10N8)) segment 5 nucleocapsid protein (NP) gene, complete cds 2295 2295 100% 0.0 94% GQ290469.1
Select seq gb|FJ432765.1| Influenza A virus (A/duck/Italy/194659/2006(H3N2)) segment 5 nucleocapsid protein (NP) gene, complete cds 2295 2295 100% 0.0 94% FJ432765.1
Select seq dbj|AB212281.1| Influenza A virus (A/duck/Yokohama/aq10/2003(H5N1)) NP gene for nucleoprotein, complete cds 2295 2295 100% 0.0 94% AB212281.1
Select seq gb|CY166043.1| Influenza A virus (A/mallard/Sweden/104931/2009(H4N6)) nucleocapsid protein (NP) gene, complete cds 2289 2289 100% 0.0 94% CY166043.1
Select seq gb|CY165865.1| Influenza A virus (A/mallard/Sweden/101658/2009(H4N6)) nucleocapsid protein (NP) gene, complete cds 2289 2289 100% 0.0 94% CY165865.1
Select seq gb|CY165817.1| Influenza A virus (A/mallard/Sweden/101602/2009(H4N6)) nucleocapsid protein (NP) gene, complete cds 2289 2289 100% 0.0 94% CY165817.1
Select seq gb|CY165165.1| Influenza A virus (A/mallard/Sweden/68561/2007(H4N6)) nucleocapsid protein (NP) gene, complete cds 2289 2289 100% 0.0 94% CY165165.1
Select seq gb|JN087013.1| Influenza A virus (A/environment/Korea/CSM3/2002(H3N6)) segment 5 nucleocapsid protein (NP) gene, partial cds 2289 2289 99% 0.0 94% JN087013.1
Select seq gb|DQ822199.1| Influenza A virus (A/Bewick's swan/Netherlands/2/2005(H6N8)) NP gene, partial cds 2287 2287 99% 0.0 94% DQ822199.1
Select seq gb|CY166019.1| Influenza A virus (A/mallard/Sweden/104831/2009(H4N6)) nucleocapsid protein (NP) gene, complete cds 2286 2286 100% 0.0 94% CY166019.1
Select seq gb|CY165729.1| Influenza A virus (A/mallard/Sweden/101010/2009(H4N6)) nucleocapsid protein (NP) gene, complete cds 2286 2286 100% 0.0 94% CY165729.1
Select seq gb|CY165133.1| Influenza A virus (A/mallard/Sweden/68541/2007(H4N6)) nucleocapsid protein (NP) gene, complete cds 2286 2286 100% 0.0 94% CY165133.1
Select seq gb|CY165085.1| Influenza A virus (A/mallard/Sweden/60063/2007(H4N6)) nucleocapsid protein (NP) gene, complete cds 2286 2286 100% 0.0 94% CY165085.1
Select seq gb|CY122018.1| Influenza A virus (A/mallard/Sweden/88/2002(H2N1)) nucleocapsid protein (NP) gene, complete cds 2286 2286 100% 0.0 94% CY122018.1
Select seq gb|CY109651.1| Influenza A virus (A/duck/Guizhou/1560/2007(H6N8)) nucleocapsid protein (NP) gene, complete cds 2286 2286 100% 0.0 94% CY109651.1
Select seq gb|CY109603.1| Influenza A virus (A/duck/Guangxi/890/2007(H6N8)) nucleocapsid protein (NP) gene, complete cds 2286 2286 100% 0.0 94% CY109603.1
Select seq gb|CY109347.1| Influenza A virus (A/duck/Yunnan/3136/2006(H6N2)) nucleocapsid protein (NP) gene, complete cds 2286 2286 100% 0.0 94% CY109347.1
Select seq gb|CY093097.1| Influenza A virus (A/quail/Lebanon/273/2010(H9N2)) nucleocapsid protein (NP) gene, complete cds 2286 2286 100% 0.0 94% CY093097.1
Select seq gb|CY093089.1| Influenza A virus (A/quail/Lebanon/272/2010(H9N2)) nucleocapsid protein (NP) gene, complete cds 2286 2286 100% 0.0 94% CY093089.1
Select seq gb|CY060397.1| Influenza A virus (A/mallard/Sweden/88/2002(H2N1)) segment 5 sequence 2286 2286 100% 0.0 94% CY060397.1
Select seq gb|CY060191.1| Influenza A virus (A/common teal/Netherlands/9/2000(H11N9)) segment 5 sequence 2286 2286 100% 0.0 94% CY060191.1
Select seq gb|EU301305.1| Influenza A virus (A/aquatic bird/Korea/CN-1/2004(H3N6)) nucleoprotein (NP) gene, partial cds 2282 2282 99% 0.0 94% EU301305.1
Select seq gb|KP288023.1| Influenza A virus (A/migratory duck/Jiangxi/7231/2003(H10N5)) segment 5 nucleocapsid protein (NP) gene, complete cds 2280 2280 100% 0.0 94% KP288023.1
Select seq gb|CY184539.1| Influenza A virus (A/mallard/Sweden/1690/2002(H7N7)) nucleocapsid protein (NP) gene, complete cds 2280 2280 100% 0.0 94% CY184539.1
Select seq gb|CY166059.1| Influenza A virus (A/mallard/Sweden/105012/2009(H4N6)) nucleocapsid protein (NP) gene, complete cds 2280 2280 100% 0.0 94% CY166059.1
Select seq gb|CY165833.1| Influenza A virus (A/mallard/Sweden/101632/2009(H4N6)) nucleocapsid protein (NP) gene, complete cds 2280 2280 100% 0.0 94% CY165833.1
Select seq gb|CY165785.1| Influenza A virus (A/mallard/Sweden/101504/2009(H4N6)) nucleocapsid protein (NP) gene, complete cds 2280 2280 100% 0.0 94% CY165785.1
Select seq gb|GU052187.1| Influenza A virus (A/mallard/Netherlands/02/2000(H10N7)) segment 5 nucleocapsid protein (NP) gene, complete cds 2280 2280 100% 0.0 94% GU052187.1
Select seq gb|EF597356.2| Influenza A virus (A/migratory duck/Jiang Xi/7231/2004(H10N5)) nucleoprotein (NP) gene, complete cds 2280 2280 100% 0.0 94% EF597356.2
Select seq gb|JN087097.1| Influenza A virus (A/duck/Korea/JS53/2004(H3N2)) segment 5 nucleocapsid protein (NP) gene, partial cds 2278 2278 99% 0.0 94% JN087097.1
Select seq gb|CY165995.1| Influenza A virus (A/mallard/Sweden/104681/2009(H4N6)) nucleocapsid protein (NP) gene, complete cds 2277 2277 100% 0.0 94% CY165995.1
Select seq gb|CY164243.1| Influenza A virus (A/mallard/Sweden/622/2002(H4N6)) nucleocapsid protein (NP) gene, complete cds 2277 2277 100% 0.0 94% CY164243.1
Select seq gb|KF695194.1| Influenza A virus (A/whitefronted goose/Netherlands/22/1999(H2N2)) segment 5 nucleocapsid protein (NP) gene, complete cds 2277 2277 100% 0.0 94% KF695194.1
Select seq gb|KF695322.1| Influenza A virus (A/mallard/Sweden/111/2002(H2N6)) segment 5 nucleocapsid protein (NP) gene, complete cds 2277 2277 100% 0.0 94% KF695322.1
Select seq gb|CY121962.1| Influenza A virus (A/white fronted goose/Netherlands/22/1999(H2N2)) nucleocapsid protein (NP) gene, complete cds 2277 2277 100% 0.0 94% CY121962.1
Select seq gb|CY060269.1| Influenza A virus (A/mallard/Sweden/3/2002(H1N2)) segment 5 sequence 2277 2277 100% 0.0 94% CY060269.1
Select seq gb|DQ376754.1| Influenza A virus (A/duck/Taiwan/A68/03(H6N1)) nucleoprotein (NP) gene, complete cds 2277 2277 100% 0.0 94% DQ376754.1
Select seq gb|EU301310.1| Influenza A virus (A/aquatic bird/Korea/JN-2/2006(H3N2)) nucleoprotein (NP) gene, partial cds 2275 2275 99% 0.0 94% EU301310.1
Select seq gb|CY184434.1| Influenza A virus (A/mallard/Sweden/75334/2008(H11N9)) nucleocapsid protein (NP) gene, complete cds 2271 2271 100% 0.0 94% CY184434.1
Select seq gb|CY121994.1| Influenza A virus (A/mallard/Netherlands/14/2001(H2N3)) nucleocapsid protein (NP) gene, complete cds 2271 2271 100% 0.0 94% CY121994.1
Select seq gb|EU301312.1| Influenza A virus (A/aquatic bird/Korea/KN-2/2005(H3N2)) nucleoprotein (NP) gene, partial cds 2271 2271 99% 0.0 94% EU301312.1
Select seq gb|KR052705.1| Influenza A virus (A/muskrat/Russia/63/2014(H2N2)) segment 5 nucleocapsid protein (NP) gene, complete cds 2268 2268 100% 0.0 94% KR052705.1
Select seq gb|KP288015.1| Influenza A virus (A/migratory duck/Jiangxi/6847/2003(H10N5)) segment 5 nucleocapsid protein (NP) gene, complete cds 2268 2268 100% 0.0 94% KP288015.1
Select seq gb|CY184515.1| Influenza A virus (A/mallard/Sweden/1337/2002(H7N7)) nucleocapsid protein (NP) gene, complete cds 2268 2268 100% 0.0 94% CY184515.1
Select seq gb|KF695294.1| Influenza A virus (A/mallard/Sweden/85/2002(H7N7)) segment 5 nucleocapsid protein (NP) gene, complete cds 2268 2268 100% 0.0 94% KF695294.1
Select seq gb|CY146757.1| Influenza A virus (A/environment/Hunan/S4350/2011(H3N8)) nucleocapsid protein (NP) gene, complete cds 2268 2268 100% 0.0 94% CY146757.1
Select seq gb|JF965204.1| Influenza A virus (A/duck/Eastern China/46/2008(H6N2)) segment 5 nucleocapsid protein (NP) gene, complete cds 2268 2268 100% 0.0 94% JF965204.1
Select seq gb|JF965200.1| Influenza A virus (A/duck/Eastern China/38/2007(H6N2)) segment 5 nucleocapsid protein (NP) gene, complete cds 2268 2268 100% 0.0 94% JF965200.1
Select seq gb|CY076893.1| Influenza A virus (A/duck/Guangxi/912/2008(H4N2)) segment 5 sequence 2268 2268 100% 0.0 94% CY076893.1
Select seq dbj|AB438942.1| Influenza A virus (A/chicken/Netherlands/2586/2003(H7N7)) NP gene for nucleoprotein, complete cds 2268 2268 100% 0.0 94% AB438942.1
Select seq dbj|AB300229.1| Influenza A virus (A/duck/Hokkaido/447/2000(H5N3)) NP gene for nucleoprotein, complete cds 2268 2268 100% 0.0 94% AB300229.1
Select seq gb|AY342426.1| Influenza A virus (A/Netherlands/033/03(H7N7)) nucleocapsid protein gene, complete cds 2268 2268 100% 0.0 94% AY342426.1
Select seq gb|CY186303.1| Influenza A virus (A/mallard/Sweden/1628/2002(H7N7)) nucleocapsid protein (NP) gene, complete cds 2262 2262 100% 0.0 94% CY186303.1
Select seq gb|JX307140.1| Influenza A virus (A/duck/Thailand/CU-7518C/2010(H3N8)) segment 5 nucleocapsid protein (NP) gene, partial cds 2262 2262 97% 0.0 94% JX307140.1
Select seq gb|JF965205.1| Influenza A virus (A/duck/Eastern China/47/2008(H6N2)) segment 5 nucleocapsid protein (NP) gene, complete cds 2262 2262 100% 0.0 94% JF965205.1
Select seq gb|GU053124.1| Influenza A virus (A/Netherlands/219/2003(H7N7)) segment 5 nucleocapsid protein (NP) gene, complete cds 2262 2262 100% 0.0 94% GU053124.1
Select seq gb|EU301306.1| Influenza A virus (A/aquatic bird/Korea/CN-2/2004(H3N2)) nucleoprotein (NP) gene, partial cds 2262 2262 99% 0.0 94% EU301306.1
Select seq gb|AY342425.1| Influenza A virus (A/Netherlands/219/03(H7N7)) nucleocapsid protein gene, complete cds 2262 2262 100% 0.0 94% AY342425.1
Select seq gb|JN087036.1| Influenza A virus (A/environment/Korea/ESD11/2003(H3N2)) segment 5 nucleocapsid protein (NP) gene, partial cds 2260 2260 99% 0.0 94% JN087036.1
Select seq gb|CY184066.1| Influenza A virus (A/mallard/Sweden/69794/2007(H12N5)) nucleocapsid protein (NP) gene, complete cds 2259 2259 100% 0.0 93% CY184066.1
Select seq gb|KF695232.1| Influenza A virus (A/mallard/Sweden/9/2003(H2N5)) segment 5 nucleocapsid protein (NP) gene, complete cds 2259 2259 100% 0.0 93% KF695232.1
Select seq gb|JX307236.1| Influenza A virus (A/duck/Thailand/CU-7519C/2010(H3N8)) segment 5 nucleocapsid protein (NP) gene, partial cds 2259 2259 97% 0.0 94% JX307236.1
Select seq gb|CY122142.1| Influenza A virus (A/mallard/Sweden/9/2003(H2N7)) nucleocapsid protein (NP) gene, complete cds 2259 2259 100% 0.0 93% CY122142.1
Select seq gb|CY116726.1| Influenza A virus (A/Peking duck/Wagun/1827-6/1984(H11N2)) nucleocapsid protein (NP) gene, complete cds 2259 2259 100% 0.0 93% CY116726.1
Select seq gb|JF965184.1| Influenza A virus (A/duck/Eastern China/2/2008(H6N2)) segment 5 nucleocapsid protein (NP) gene, complete cds 2259 2259 100% 0.0 93% JF965184.1
Select seq gb|CY060411.1| Influenza A virus (A/mallard/Sweden/98/2002(H1N6)) segment 5 sequence 2259 2259 100% 0.0 93% CY060411.1
Select seq gb|CY060359.1| Influenza A virus (A/mallard/Sweden/65/2002(H10N9)) segment 5 sequence 2259 2259 100% 0.0 93% CY060359.1
Select seq gb|CY041261.1| Influenza A virus (A/common teal/Netherlands/1/2005(H8N4)) segment 5, complete sequence 2259 2259 100% 0.0 93% CY041261.1
Select seq emb|AJ620352.1| Influenza A virus (A/Chicken/Germany/R28/03(H7N7)) NP gene for nucleoprotein, genomic RNA 2259 2259 100% 0.0 93% AJ620352.1
Select seq gb|GU396905.1| Influenza A virus (A/wild duck/Taiwan/WB904/2006(H4N6)) segment 5 nucleocapsid protein (NP) gene, partial cds 2257 2257 98% 0.0 94% GU396905.1
Select seq gb|CY184627.1| Influenza A virus (A/mallard/Sweden/936/2002(H10N9)) nucleocapsid protein (NP) gene, complete cds 2253 2253 100% 0.0 93% CY184627.1
Select seq gb|CY060432.2| Influenza A virus (A/whitefronted goose/Netherlands/1/1999(H6N1)) segment 5 sequence 2253 2253 100% 0.0 93% CY060432.2
Select seq gb|CY146565.1| Influenza A virus (A/duck/Hunan/S11205/2012(H10N3)) nucleocapsid protein (NP) gene, complete cds 2253 2253 100% 0.0 93% CY146565.1
Select seq gb|CY130097.1| Influenza A virus (A/mallard/Astrakhan/263/1982(H14N5)) nucleocapsid protein (NP) gene, complete cds 2253 2253 100% 0.0 93% CY130097.1
Select seq gb|CY122102.1| Influenza A virus (A/mallard/Sweden/70/2002(H2N3)) nucleocapsid protein (NP) gene, complete cds 2253 2253 100% 0.0 93% CY122102.1
Select seq gb|CY060309.1| Influenza A virus (A/mallard/Sweden/50/2002(H3N8)) segment 5 sequence 2253 2253 100% 0.0 93% CY060309.1
Select seq gb|GU052255.1| Influenza A virus (A/mallard/Gurjev/263/1982(H14N5)) segment 5 nucleocapsid protein (NP) gene, complete cds 2253 2253 100% 0.0 93% GU052255.1
Select seq gb|CY043851.1| Influenza A virus (A/mallard/Netherlands/1/2006(H8N4)) segment 5, complete sequence 2253 2253 100% 0.0 93% CY043851.1
Select seq gb|M63785.1|FLANPAAM Influenza A virus (A/mallard/Astrakhan(Gurjev)/263/1982(H14N5)) nucleoprotein (NP) gene, complete cds 2253 2253 100% 0.0 93% M63785.1
Select seq gb|JN087089.1| Influenza A virus (A/duck/Korea/JS49/2004(H3N2)) segment 5 nucleocapsid protein (NP) gene, partial cds 2251 2251 98% 0.0 94% JN087089.1
Select seq gb|KM267821.1| Influenza A virus (A/duck/Bangladesh/14VIR1121-10/2013(H4N6)) segment 5 nucleocapsid protein (NP) gene, complete cds 2250 2250 100% 0.0 93% KM267821.1
Select seq gb|CY185436.1| Influenza A virus (A/mallard/Republic of Georgia/3/2010(H7N3)) nucleocapsid protein (NP) gene, complete cds 2250 2250 100% 0.0 93% CY185436.1

Author:  niman [ Sun Dec 27, 2015 12:18 pm ]
Post subject:  Re: Fujian H5N8 In Klamath Co OR With Wild Bird PB1 & PA

Influenza A virus (A/American wigeon/Oregon/AH0012525/2015(H5N8)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1512 1512 100% 0.0 100% KU201756.1
Select seq gb|KU201748.1| Influenza A virus (A/Canada goose/Oregon/AH0012452/2015(H5N8)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1507 1507 100% 0.0 99% KU201748.1
Select seq gb|KU201620.1| Influenza A virus (A/American wigeon/Utah/AH0007824/2015(H5N8)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1503 1503 100% 0.0 99% KU201620.1
Select seq gb|KU201628.1| Influenza A virus (A/mallard/Oregon/AH0003952/2015(H5N2)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1503 1503 100% 0.0 99% KU201628.1
Select seq gb|KU201652.1| Influenza A virus (A/wood duck/Oregon/AH0007257/2015(H5N2)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1503 1503 100% 0.0 99% KU201652.1
Select seq gb|KU201660.1| Influenza A virus (A/wood duck/Oregon/AH0007263/2015(H5N2)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1503 1503 100% 0.0 99% KU201660.1
Select seq gb|KU201692.1| Influenza A virus (A/mallard/Idaho/AH0008597/2015(H5N8)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1503 1503 100% 0.0 99% KU201692.1
Select seq gb|KU201700.1| Influenza A virus (A/mallard/Oregon/AH0008887/2015(H5N2)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1503 1503 100% 0.0 99% KU201700.1
Select seq gb|KU201708.1| Influenza A virus (A/Northern pintail/Oregon/AH0003871/2015(H5N2)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1503 1503 100% 0.0 99% KU201708.1
Select seq gb|KU201780.1| Influenza A virus (A/mallard/Idaho/AH0005955/2014(H5N8)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1503 1503 100% 0.0 99% KU201780.1
Select seq gb|KU201796.1| Influenza A virus (A/chicken/California/15-004912/2015(H5N8)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1503 1503 100% 0.0 99% KU201796.1
Select seq gb|KU201804.1| Influenza A virus (A/bald eagle/Idaho/15-002892-2/2015(H5N8)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1503 1503 100% 0.0 99% KU201804.1
Select seq gb|KU201812.1| Influenza A virus (A/Northern pintail/Washington/195365/2014(H5N2)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1503 1503 100% 0.0 99% KU201812.1
Select seq gb|KU201828.1| Influenza A virus (A/American wigeon/Washington/195968/2014(H5N8)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1503 1503 100% 0.0 99% KU201828.1
Select seq gb|KU201836.1| Influenza A virus (A/mallard/Washington/196262/2015(H5N2)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1503 1503 100% 0.0 99% KU201836.1
Select seq gb|KU201876.1| Influenza A virus (A/mallard/Oregon/195536/2014(H5N8)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1503 1503 100% 0.0 99% KU201876.1
Select seq gb|KU201884.1| Influenza A virus (A/American American wigeon/Washington/195198/2014(H5N8)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1503 1503 100% 0.0 99% KU201884.1
Select seq gb|KU201892.1| Influenza A virus (A/American wigeon/Washington/195205/2014(H5N8)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1503 1503 100% 0.0 99% KU201892.1
Select seq gb|KU201916.1| Influenza A virus (A/mallard/Washington/195810/2014(H5N2)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1503 1503 100% 0.0 99% KU201916.1
Select seq gb|KU201924.1| Influenza A virus (A/Canada goose/Washington/197619/2014(H5N2)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1503 1503 100% 0.0 99% KU201924.1
Select seq gb|KJ756695.1| Influenza A virus (A/baikal teal/Korea/1437/2014(H5N8)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1503 1503 100% 0.0 99% KJ756695.1
Select seq gb|KR150913.1| Influenza A virus (A/pheasant/Washington/3147-2/2015(H5N2)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1503 1503 100% 0.0 99% KR150913.1
Select seq gb|KP795733.1| Influenza A virus (A/chicken/BC/FAV8/2014(H5N2)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1503 1503 100% 0.0 99% KP795733.1
Select seq gb|KP307988.1| Influenza A virus (A/gyrfalcon/Washington/41088-6/2014(H5N8)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1503 1503 100% 0.0 99% KP307988.1
Select seq gb|KJ746115.1| Influenza A virus (A/mallard/Korea/W452/2014(H5N8)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1503 1503 100% 0.0 99% KJ746115.1
Select seq gb|KJ413854.1| Influenza A virus (A/baikal teal/Korea/Donglim3/2014(H5N8)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1503 1503 100% 0.0 99% KJ413854.1
Select seq gb|KU201612.1| Influenza A virus (A/snow goose/Missouri/15-011246-1/2015(H5N2)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1498 1498 100% 0.0 99% KU201612.1
Select seq gb|KU201636.1| Influenza A virus (A/Northern pintail/Oregon/AH0003967/2015(H5N2)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1498 1498 100% 0.0 99% KU201636.1
Select seq gb|KU201644.1| Influenza A virus (A/wood duck/Oregon/AH0007244/2015(H5N2)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1498 1498 100% 0.0 99% KU201644.1
Select seq gb|KU201668.1| Influenza A virus (A/Northern shoveler/Oregon/AH0007332/2015(H5N2)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1498 1498 100% 0.0 99% KU201668.1
Select seq gb|KU201676.1| Influenza A virus (A/Northern shoveler/Oregon/AH0007337/2015(H5N2)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1498 1498 100% 0.0 99% KU201676.1
Select seq gb|KU201684.1| Influenza A virus (A/Northern shoveler/Oregon/AH0007339/2015(H5N2)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1498 1498 100% 0.0 99% KU201684.1
Select seq gb|KU201740.1| Influenza A virus (A/American green-winged teal/Oregon/AH0012403/2015(H5N2)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1498 1498 100% 0.0 99% KU201740.1
Select seq gb|KU201772.1| Influenza A virus (A/mallard/Idaho/AH0005954/2014(H5N8)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1498 1498 100% 0.0 99% KU201772.1
Select seq gb|KU201788.1| Influenza A virus (A/mallard/Oregon/AH0003821/2014(H5N2)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1498 1498 100% 0.0 99% KU201788.1
Select seq gb|KU201820.1| Influenza A virus (A/mallard/Oregon/195547/2014(H5N2)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1498 1498 100% 0.0 99% KU201820.1
Select seq gb|KU201844.1| Influenza A virus (A/Northern pintail/Washington/196271/2014(H5N8)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1498 1498 100% 0.0 99% KU201844.1
Select seq gb|KU201852.1| Influenza A virus (A/mallard/Washington/196865/2015(H5N2)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1498 1498 100% 0.0 99% KU201852.1
Select seq gb|KU201908.1| Influenza A virus (A/peregrine falcon/Washington/196426/2014(H5N8)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1498 1498 100% 0.0 99% KU201908.1
Select seq gb|KT762888.1| Influenza A virus (A/chicken/Montana/15-010559-1/2015(H5N2)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1498 1498 100% 0.0 99% KT762888.1
Select seq gb|KR234034.1| Influenza A virus (A/chicken/Kansas/8395-3/2015(H5N2)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1498 1498 100% 0.0 99% KR234034.1
Select seq gb|KR234018.1| Influenza A virus (A/turkey/Missouri/7458-1/2015(H5N2)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1498 1498 100% 0.0 99% KR234018.1
Select seq gb|KR234010.1| Influenza A virus (A/turkey/Minnesota/7172-1/2015(H5N2)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1498 1498 100% 0.0 99% KR234010.1
Select seq gb|KJ756703.1| Influenza A virus (A/baikal teal/Korea/1454/2014(H5N8)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1498 1498 100% 0.0 99% KJ756703.1
Select seq gb|KJ756701.1| Influenza A virus (A/baikal teal/Korea/1449/2014(H5N8)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1498 1498 100% 0.0 99% KJ756701.1
Select seq gb|KJ756700.1| Influenza A virus (A/baikal teal/Korea/1448/2014(H5N8)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1498 1498 100% 0.0 99% KJ756700.1
Select seq gb|KJ756696.1| Influenza A virus (A/baikal teal/Korea/1441/2014(H5N8)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1498 1498 100% 0.0 99% KJ756696.1
Select seq gb|KR150905.1| Influenza A virus (A/turkey/California/K1500169-1.2/2015(H5N8)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1498 1498 100% 0.0 99% KR150905.1
Select seq gb|KP739401.1| Influenza A virus (A/turkey/Washington/61-22/2014(H5N2)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1498 1498 100% 0.0 99% KP739401.1
Select seq gb|KJ508928.1| Influenza A virus (A/bean goose/Korea/H40/2014(H5N8)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1498 1498 100% 0.0 99% KJ508928.1
Select seq gb|KJ508944.1| Influenza A virus (A/broiler duck/Korea/H47/2014(H5N8)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1498 1498 100% 0.0 99% KJ508944.1
Select seq gb|KJ508952.1| Influenza A virus (A/broiler duck/Korea/H48/2014(H5N8)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1498 1498 100% 0.0 99% KJ508952.1
Select seq gb|KJ509008.1| Influenza A virus (A/Baikal teal/Korea/H68/2014(H5N8)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1498 1498 100% 0.0 99% KJ509008.1
Select seq gb|KJ509064.1| Influenza A virus (A/broiler duck/Korea/H133/2014(H5N8)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1498 1498 100% 0.0 99% KJ509064.1
Select seq gb|KJ509072.1| Influenza A virus (A/broiler duck/Korea/H145/2014(H5N8)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1498 1498 100% 0.0 99% KJ509072.1
Select seq gb|KJ509112.1| Influenza A virus (A/breeder duck/Korea/H249/2014(H5N8)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1498 1498 100% 0.0 99% KJ509112.1
Select seq gb|KJ511816.1| Influenza A virus (A/waterfowl/Korea/S005/2014(H5N8)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1498 1498 100% 0.0 99% KJ511816.1
Select seq gb|KU201716.1| Influenza A virus (A/mallard/Idaho/AH0007412/2015(H5N2)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1494 1494 100% 0.0 99% KU201716.1
Select seq gb|KU201724.1| Influenza A virus (A/mallard/Idaho/AH0007413/2015(H5N2)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1494 1494 100% 0.0 99% KU201724.1
Select seq gb|KU201732.1| Influenza A virus (A/American green-winged teal/Idaho/AH0011899/2015(H5N2)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1494 1494 100% 0.0 99% KU201732.1
Select seq gb|KU201764.1| Influenza A virus (A/mallard/Nevada/AH0006855/2015(H5N8)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1494 1494 100% 0.0 99% KU201764.1
Select seq gb|KU201900.1| Influenza A virus (A/mallard/Washington/195246/2014(H5N2)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1494 1494 100% 0.0 99% KU201900.1
Select seq gb|KU201932.1| Influenza A virus (A/Cooper's hawk/Minnesota/198225/2015(H5N2)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1494 1494 100% 0.0 99% KU201932.1
Select seq gb|KU201940.1| Influenza A virus (A/snowy owl/Wisconsin/198399/2015(H5N2)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1494 1494 100% 0.0 99% KU201940.1
Select seq gb|KU201947.1| Influenza A virus (A/Canada goose/Kansas/197850/2015(H5N2)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1494 1494 100% 0.0 99% KU201947.1
Select seq gb|KT388712.1| Influenza A virus (A/goose/Taiwan/TNO20/2015(H5N8)) segment 8 cRNA sequence 1494 1494 100% 0.0 99% KT388712.1
Select seq gb|KT388704.1| Influenza A virus (A/goose/Taiwan/TNO19/2015(H5N8)) segment 8 cRNA sequence 1494 1494 100% 0.0 99% KT388704.1
Select seq gb|KT388696.1| Influenza A virus (A/goose/Taiwan/TNO18/2015(H5N8)) segment 8 cRNA sequence 1494 1494 100% 0.0 99% KT388696.1
Select seq gb|KT388688.1| Influenza A virus (A/goose/Taiwan/TNO17/2015(H5N8)) segment 8 cRNA sequence 1494 1494 100% 0.0 99% KT388688.1
Select seq gb|KT388680.1| Influenza A virus (A/goose/Taiwan/TNO16/2015(H5N8)) segment 8 cRNA sequence 1494 1494 100% 0.0 99% KT388680.1
Select seq gb|KT388672.1| Influenza A virus (A/goose/Taiwan/TNO15/2015(H5N8)) segment 8 cRNA sequence 1494 1494 100% 0.0 99% KT388672.1
Select seq gb|KT388664.1| Influenza A virus (A/goose/Taiwan/TNO14/2015(H5N8)) segment 8 cRNA sequence 1494 1494 100% 0.0 99% KT388664.1
Select seq gb|KT388656.1| Influenza A virus (A/goose/Taiwan/TNO13/2015(H5N8)) segment 8 cRNA sequence 1494 1494 100% 0.0 99% KT388656.1
Select seq gb|KT388648.1| Influenza A virus (A/goose/Taiwan/TNO12/2015(H5N8)) segment 8 cRNA sequence 1494 1494 100% 0.0 99% KT388648.1
Select seq gb|KT388640.1| Influenza A virus (A/goose/Taiwan/TNO11/2015(H5N8)) segment 8 cRNA sequence 1494 1494 100% 0.0 99% KT388640.1
Select seq gb|KT388632.1| Influenza A virus (A/goose/Taiwan/TNO10/2015(H5N8)) segment 8 cRNA sequence 1494 1494 100% 0.0 99% KT388632.1
Select seq gb|KT388624.1| Influenza A virus (A/goose/Taiwan/TNO9/2015(H5N8)) segment 8 cRNA sequence 1494 1494 100% 0.0 99% KT388624.1
Select seq gb|KT388616.1| Influenza A virus (A/goose/Taiwan/TNO8/2015(H5N8)) segment 8 cRNA sequence 1494 1494 100% 0.0 99% KT388616.1
Select seq gb|KT388608.1| Influenza A virus (A/goose/Taiwan/TNO7/2015(H5N8)) segment 8 cRNA sequence 1494 1494 100% 0.0 99% KT388608.1
Select seq gb|KT388600.1| Influenza A virus (A/goose/Taiwan/TNO6/2015(H5N8)) segment 8 cRNA sequence 1494 1494 100% 0.0 99% KT388600.1
Select seq gb|KT388592.1| Influenza A virus (A/goose/Taiwan/TNO5/2015(H5N8)) segment 8 cRNA sequence 1494 1494 100% 0.0 99% KT388592.1
Select seq gb|KT388584.1| Influenza A virus (A/goose/Taiwan/TNO4/2015(H5N8)) segment 8 cRNA sequence 1494 1494 100% 0.0 99% KT388584.1
Select seq gb|KT388568.1| Influenza A virus (A/goose/Taiwan/TNO2/2015(H5N8)) segment 8 cRNA sequence 1494 1494 100% 0.0 99% KT388568.1
Select seq gb|KT388560.1| Influenza A virus (A/goose/Taiwan/TNO1/2015(H5N8)) segment 8 cRNA sequence 1494 1494 100% 0.0 99% KT388560.1
Select seq gb|KT388552.1| Influenza A virus (A/goose/Taiwan/TNC14/2015(H5N8)) segment 8 cRNA sequence 1494 1494 100% 0.0 99% KT388552.1
Select seq gb|KT388544.1| Influenza A virus (A/goose/Taiwan/TNC13/2015(H5N8)) segment 8 cRNA sequence 1494 1494 100% 0.0 99% KT388544.1
Select seq gb|KT388536.1| Influenza A virus (A/goose/Taiwan/TNC12/2015(H5N8)) segment 8 cRNA sequence 1494 1494 100% 0.0 99% KT388536.1
Select seq gb|KT388528.1| Influenza A virus (A/goose/Taiwan/TNC11/2015(H5N8)) segment 8 cRNA sequence 1494 1494 100% 0.0 99% KT388528.1
Select seq gb|KT388520.1| Influenza A virus (A/goose/Taiwan/TNC10/2015(H5N8)) segment 8 cRNA sequence 1494 1494 100% 0.0 99% KT388520.1
Select seq gb|KT388512.1| Influenza A virus (A/goose/Taiwan/TNC9/2015(H5N8)) segment 8 cRNA sequence 1494 1494 100% 0.0 99% KT388512.1
Select seq gb|KT388504.1| Influenza A virus (A/goose/Taiwan/TNC8/2015(H5N8)) segment 8 cRNA sequence 1494 1494 100% 0.0 99% KT388504.1
Select seq gb|KT388496.1| Influenza A virus (A/goose/Taiwan/TNC7/2015(H5N8)) segment 8 cRNA sequence 1494 1494 100% 0.0 99% KT388496.1
Select seq gb|KT388488.1| Influenza A virus (A/goose/Taiwan/TNC6/2015(H5N8)) segment 8 cRNA sequence 1494 1494 100% 0.0 99% KT388488.1
Select seq gb|KT388480.1| Influenza A virus (A/goose/Taiwan/TNC5/2015(H5N8)) segment 8 cRNA sequence 1494 1494 100% 0.0 99% KT388480.1
Select seq gb|KT388472.1| Influenza A virus (A/goose/Taiwan/TNC4/2015(H5N8)) segment 8 cRNA sequence 1494 1494 100% 0.0 99% KT388472.1
Select seq gb|KT388456.1| Influenza A virus (A/goose/Taiwan/TNC2/2015(H5N8)) segment 8 cRNA sequence 1494 1494 100% 0.0 99% KT388456.1
Select seq gb|KT388448.1| Influenza A virus (A/goose/Taiwan/TNC1/2015(H5N8)) segment 8 cRNA sequence 1494 1494 100% 0.0 99% KT388448.1
Select seq gb|KT762896.1| Influenza A virus (A/turkey/North Dakota/15-011420-13/2015(H5N2)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1494 1494 100% 0.0 99% KT762896.1
Select seq gb|KT762912.1| Influenza A virus (A/turkey/Wisconsin/15-012012-2/2015(H5N2)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1494 1494 100% 0.0 99% KT762912.1
Select seq gb|KT762920.1| Influenza A virus (A/turkey/North Dakota/15-013049-1/2015(H5N2)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1494 1494 100% 0.0 99% KT762920.1
Select seq gb|KT762928.1| Influenza A virus (A/chicken/Minnesota/15-013533-1/2015(H5N2)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1494 1494 100% 0.0 99% KT762928.1
Select seq gb|KT762952.1| Influenza A virus (A/chicken/Wisconsin/15-011595-1/2015(H5N2)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1494 1494 100% 0.0 99% KT762952.1
Select seq gb|KT280936.1| Influenza A virus (A/chicken/Iowa/21981/2015(H5N2)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1494 1494 100% 0.0 99% KT280936.1
Select seq gb|KT002477.1| Influenza A virus (A/turkey/Iowa/11762-1/2015(H5N2)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1494 1494 100% 0.0 99% KT002477.1
Select seq gb|KT002485.1| Influenza A virus (A/turkey/Iowa/13541-1/2015(H5N2)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1494 1494 100% 0.0 99% KT002485.1
Select seq gb|KT002493.1| Influenza A virus (A/chicken/Iowa/13542-2/2015(H5N2)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1494 1494 100% 0.0 99% KT002493.1
Select seq gb|KT002501.1| Influenza A virus (A/turkey/Iowa/14318-1/2015(H5N2)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1494 1494 100% 0.0 99% KT002501.1
Select seq gb|KT002509.1| Influenza A virus (A/turkey/Iowa/14319-1/2015(H5N2)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1494 1494 100% 0.0 99% KT002509.1
Select seq gb|KT002517.1| Influenza A virus (A/chicken/Iowa/14322-6/2015(H5N2)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1494 1494 100% 0.0 99% KT002517.1
Select seq gb|KT002532.1| Influenza A virus (A/chicken/Iowa/14589-1/2015(H5N2)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1494 1494 100% 0.0 99% KT002532.1
Select seq gb|KR233994.1| Influenza A virus (A/chicken/Washington/3490-18/2015(H5N2)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1494 1494 100% 0.0 99% KR233994.1
Select seq gb|KR233986.1| Influenza A virus (A/turkey/Minnesota/9892-2/2015(H5N2)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1494 1494 100% 0.0 99% KR233986.1
Select seq gb|KR492978.1| Influenza A virus (A/chicken/Iowa/04-20/2015(H5N2)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1494 1494 100% 0.0 99% KR492978.1
Select seq gb|KJ756704.1| Influenza A virus (A/baikal teal/Korea/1456/2014(H5N8)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1494 1494 100% 0.0 99% KJ756704.1
Select seq gb|KP795741.1| Influenza A virus (A/chicken/BC/FAV9/2014(H5N2)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1494 1494 100% 0.0 99% KP795741.1
Select seq gb|KP739393.1| Influenza A virus (A/domestic duck/Washington/61-16/2014(H5N2)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1494 1494 100% 0.0 99% KP739393.1
Select seq gb|KP307961.1| Influenza A virus (A/turkey/BC/FAV10/2014(H5N2)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1494 1494 100% 0.0 99% KP307961.1
Select seq gb|KJ508976.1| Influenza A virus (A/bean goose/Korea/H53/2014(H5N8)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1494 1494 100% 0.0 99% KJ508976.1
Select seq gb|KJ509032.1| Influenza A virus (A/Baikal teal/Korea/H84/2014(H5N8)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1494 1494 100% 0.0 99% KJ509032.1
Select seq gb|KJ509080.1| Influenza A virus (A/breeder duck/Korea/H158/2014(H5N8)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1494 1494 100% 0.0 99% KJ509080.1
Select seq gb|KJ509104.1| Influenza A virus (A/white-fronted goose/Korea/H231/2014(H5N8)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1494 1494 100% 0.0 99% KJ509104.1
Select seq dbj|AB932560.1| Influenza A virus (A/chicken/kumamoto/1-7/2014(H5N8)) NS1, NS2 genes for nonstructural protein 1, nonstructural protein 2, complete cds 1494 1494 100% 0.0 99% AB932560.1
Select seq gb|KT388576.1| Influenza A virus (A/goose/Taiwan/TNO3/2015(H5N8)) segment 8 cRNA sequence 1489 1489 100% 0.0 99% KT388576.1
Select seq gb|KT388464.1| Influenza A virus (A/goose/Taiwan/TNC3/2015(H5N8)) segment 8 cRNA sequence 1489 1489 100% 0.0 99% KT388464.1
Select seq gb|KT762936.1| Influenza A virus (A/turkey/South Dakota/15-010371/2015(H5N2)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1489 1489 100% 0.0 99% KT762936.1
Select seq gb|KT762944.1| Influenza A virus (A/chicken/Nebraska/15-017990-5/2015(H5N2)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1489 1489 100% 0.0 99% KT762944.1
Select seq gb|KT002525.1| Influenza A virus (A/chicken/Iowa/14399-4/2015(H5N2)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1489 1489 100% 0.0 99% KT002525.1
Select seq gb|KR234042.1| Influenza A virus (A/turkey/Minnesota/9845-4/2015(H5N2)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1489 1489 100% 0.0 99% KR234042.1
Select seq gb|KR234026.1| Influenza A virus (A/turkey/Arkansas/7791-1/2015(H5N2)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1489 1489 100% 0.0 99% KR234026.1
Select seq gb|KR234002.1| Influenza A virus (A/chicken/Oregon/A01819044/2015(H5N2)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1489 1489 100% 0.0 99% KR234002.1
Select seq gb|KJ508960.1| Influenza A virus (A/broiler duck/Korea/H49/2014(H5N8)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1489 1489 100% 0.0 99% KJ508960.1
Select seq gb|KJ508992.1| Influenza A virus (A/broiler duck/Korea/H65/2014(H5N8)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1489 1489 100% 0.0 99% KJ508992.1
Select seq gb|KT762904.1| Influenza A virus (A/chicken/Nebraska/15-017897-1/2015(H5N2)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1485 1485 100% 0.0 99% KT762904.1
Select seq gb|KT762960.1| Influenza A virus (A/chicken/Wisconsin/15-012160-1/2015(H5N2)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1485 1485 100% 0.0 99% KT762960.1
Select seq gb|JQ041417.1| Influenza A virus (A/duck/Eastern China/1111/2011(H5N2)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS) genes, complete cds 1458 1458 100% 0.0 99% JQ041417.1
Select seq gb|KC282883.1| Influenza A virus (A/duck/Jiangsu/1-15/2011(H4N2)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1452 1452 100% 0.0 98% KC282883.1
Select seq gb|KR233694.1| Influenza A virus (A/chicken/Netherlands/emc-3/2014(H5N8)) segment 8 nuclear export protein (NEP) gene, partial cds; and nonstructural protein 1 (NS1) gene, complete cds 1451 1451 97% 0.0 99% KR233694.1
Select seq gb|JQ041418.1| Influenza A virus (A/goose/Eastern China/1112/2011(H5N2)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS) genes, complete cds 1449 1449 100% 0.0 98% JQ041418.1
Select seq gb|KR233678.1| Influenza A virus (A/eurasian wigeon/Netherlands/1/2014(H5N8)) segment 8 nonstructural protein 1 (NS1) and nuclear export protein (NEP) genes, partial cds 1429 1429 95% 0.0 99% KR233678.1
Select seq gb|JX534569.1| Influenza A virus (A/wild duck/Shandong/628/2011(H5N1)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1422 1422 100% 0.0 98% JX534569.1
Select seq gb|KR232368.1| Influenza A virus (A/eurasian wigeon/Netherlands/1/2015(H5N8)) segment 8 nonstructural protein 1 (NS1) and nuclear export protein (NEP) genes, partial cds 1406 1406 94% 0.0 99% KR232368.1
Select seq gb|JX507359.1| Influenza A virus (A/duck/Jiangsu/m234/2012(H5N2)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1404 1404 99% 0.0 97% JX507359.1
Select seq gb|KR233686.1| Influenza A virus (A/eurasian wigeon/Netherlands/2/2014(H5N8)) segment 8 nonstructural protein 1 (NS1) and nuclear export protein (NEP) genes, partial cds 1366 1366 92% 0.0 99% KR233686.1
Select seq gb|CY183592.1| Influenza A virus (A/mallard/Sweden/737/2002(H10N2)) nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1359 1359 100% 0.0 96% CY183592.1
Select seq gb|CY077020.1| Influenza A virus (A/mallard/Sweden/95/2005(H7N7)) segment 8, complete sequence 1359 1359 100% 0.0 96% CY077020.1
Select seq gb|CY005497.1| Influenza A virus (A/duck/Nanchang/1904/1992(H7N1)) segment 8, complete sequence 1359 1359 100% 0.0 96% CY005497.1
Select seq gb|U49493.1|IAU49493 Influenza A virus (A/duck/Nanchang/1944/1993(H7N4)) nonstructural protein NS2 (NS) gene, complete cds, alternatively spliced; and nonstructural protein NS1 (NS) gene, complete cds 1359 1359 100% 0.0 96% U49493.1
Select seq gb|CY184620.1| Influenza A virus (A/mallard/Sweden/396/2002(H10N4)) nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1353 1353 100% 0.0 96% CY184620.1
Select seq gb|CY183584.1| Influenza A virus (A/mallard/Sweden/223/2002(H10N2)) nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1353 1353 100% 0.0 96% CY183584.1
Select seq gb|CY183340.1| Influenza A virus (A/mallard/Sweden/1985/2003(H7N7)) nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1353 1353 100% 0.0 96% CY183340.1
Select seq gb|CY164220.1| Influenza A virus (A/mallard/Sweden/274/2002(H4N2)) nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1353 1353 100% 0.0 96% CY164220.1
Select seq gb|KF695281.1| Influenza A virus (A/mallard/Sweden/64/2003(H7N7)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1353 1353 100% 0.0 96% KF695281.1
Select seq gb|KF695365.1| Influenza A virus (A/mallard/Sweden/17/2002(H10N4)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1353 1353 100% 0.0 96% KF695365.1
Select seq gb|CY121995.1| Influenza A virus (A/mallard/Netherlands/14/2001(H2N3)) nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1353 1353 100% 0.0 96% CY121995.1
Select seq gb|HM145042.1| Influenza A virus (A/mallard/Jiangxi/8341/2004(H6N5)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1353 1353 100% 0.0 96% HM145042.1
Select seq gb|CY060443.1| Influenza A virus (A/whitefronted goose/Netherlands/2/1999(H6N2)) segment 8 sequence 1353 1353 100% 0.0 96% CY060443.1
Select seq gb|CY060435.1| Influenza A virus (A/whitefronted goose/Netherlands/1/1999(H6N1)) segment 8 sequence 1353 1353 100% 0.0 96% CY060435.1
Select seq gb|CY060304.1| Influenza A virus (A/mallard/Sweden/4/2002(H10N2)) segment 8 sequence 1353 1353 100% 0.0 96% CY060304.1
Select seq gb|CY060202.1| Influenza A virus (A/greylag goose/Netherlands/4/1999(H6N1)) segment 8 sequence 1353 1353 100% 0.0 96% CY060202.1
Select seq gb|CY041382.1| Influenza A virus (A/black-headed gull/Netherlands/1/2005(H6N8)) segment 8, complete sequence 1353 1353 100% 0.0 96% CY041382.1
Select seq gb|DQ787810.1| Influenza A virus (A/duck/Primorie/3691/02(H12N2)) nonstructural protein 2 (NS2) and nonstructural protein 1 (NS1) genes, partial cds 1352 1352 98% 0.0 96% DQ787810.1
Select seq gb|KU160943.1| Influenza A virus (A/duck/Henan/S1091/2010(H4N6)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1350 1350 100% 0.0 96% KU160943.1
Select seq gb|KP287962.1| Influenza A virus (A/migratory duck/Jiangxi/21248/2009(H10N8)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1350 1350 100% 0.0 96% KP287962.1
Select seq gb|CY184556.1| Influenza A virus (A/mallard/Sweden/1983/2003(H7N7)) nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1350 1350 100% 0.0 96% CY184556.1
Select seq gb|CY183601.1| Influenza A virus (A/mallard/Sweden/766/2002(mixed)) nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1350 1350 100% 0.0 96% CY183601.1
Select seq gb|CY183364.1| Influenza A virus (A/mallard/Sweden/2003/2003(H7N7)) nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1350 1350 100% 0.0 96% CY183364.1
Select seq gb|CY165024.1| Influenza A virus (A/mallard/Sweden/58359/2006(mixed)) nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1350 1350 100% 0.0 96% CY165024.1
Select seq gb|CY164428.1| Influenza A virus (A/mallard/Sweden/4514/2004(H4N6)) nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1350 1350 100% 0.0 96% CY164428.1
Select seq gb|CY164228.1| Influenza A virus (A/mallard/Sweden/310/2002(H4N6)) nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1350 1350 100% 0.0 96% CY164228.1
Select seq gb|CY164212.1| Influenza A virus (A/mallard/Sweden/146/2002(H4N6)) nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1350 1350 100% 0.0 96% CY164212.1
Select seq gb|KF695219.1| Influenza A virus (A/mallard/Sweden/46/2002(H4N3)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1350 1350 100% 0.0 96% KF695219.1
Select seq gb|KF260028.1| Influenza A virus (A/eurasian wigeon/Hong Kong/MPK655/2009(H11N9)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1350 1350 100% 0.0 96% KF260028.1
Select seq gb|KC815855.1| Influenza A virus (A/mallard/Italy/3401/2005(H5N1)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1350 1350 100% 0.0 96% KC815855.1
Select seq gb|KC815871.1| Influenza A virus (A/mallard/Italy/3401/2005(H5N1)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1350 1350 100% 0.0 96% KC815871.1
Select seq gb|CY095581.1| Influenza A virus (A/mallard/Italy/3401/2005(H5N1)) nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1350 1350 100% 0.0 96% CY095581.1
Select seq gb|HM145043.1| Influenza A virus (A/mallard/Jiangxi/8346/2004(H6N5)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1350 1350 100% 0.0 96% HM145043.1
Select seq gb|CY060327.1| Influenza A virus (A/mallard/Sweden/55/2002(H11N2)) nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1350 1350 100% 0.0 96% CY060327.1
Select seq gb|CY021401.1| Influenza A virus (A/mallard/Italy/3401/2005(H5N1)) segment 8, complete sequence 1350 1350 100% 0.0 96% CY021401.1
Select seq gb|CY186418.1| Influenza A virus (A/mallard/Sweden/1448/2002(H7N7)) nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1344 1344 100% 0.0 96% CY186418.1
Select seq gb|CY183511.1| Influenza A virus (A/mallard/Sweden/8005/2005(H8N4)) nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1344 1344 100% 0.0 96% CY183511.1
Select seq gb|CY183453.1| Influenza A virus (A/mallard/Sweden/3240/2003(H8N4)) nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1344 1344 100% 0.0 96% CY183453.1
Select seq gb|CY183372.1| Influenza A virus (A/mallard/Sweden/2834/2003(H8N4)) nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1344 1344 100% 0.0 96% CY183372.1
Select seq gb|CY164989.1| Influenza A virus (A/mallard/Sweden/52484/2006(H4N6)) nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1344 1344 100% 0.0 96% CY164989.1
Select seq gb|CY164284.1| Influenza A virus (A/mallard/Sweden/1544/2002(H4N6)) nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1344 1344 100% 0.0 96% CY164284.1
Select seq gb|KF695289.1| Influenza A virus (A/mallard/Sweden/102/2002(H7N7)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1344 1344 100% 0.0 96% KF695289.1
Select seq gb|KF695297.1| Influenza A virus (A/mallard/Sweden/85/2002(H7N7)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1344 1344 100% 0.0 96% KF695297.1
Select seq gb|KF695358.1| Influenza A virus (A/mallard/Sweden/56/2002(H7N7)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1344 1344 100% 0.0 96% KF695358.1
Select seq gb|KF695371.1| Influenza A virus (A/mallard/Sweden/39/2002(H5N3)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1344 1344 100% 0.0 96% KF695371.1
Select seq gb|JN087092.1| Influenza A virus (A/duck/Korea/JS49/2004(H3N2)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1344 1344 100% 0.0 96% JN087092.1
Select seq gb|JN087084.1| Influenza A virus (A/environment/Korea/ESD18/2004(H3N6)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1344 1344 100% 0.0 96% JN087084.1
Select seq gb|HM849021.1| Influenza A virus (A/mallard/PT/35910-2/2006(H4N6)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1344 1344 100% 0.0 96% HM849021.1
Select seq gb|HM145064.1| Influenza A virus (A/wild duck/Shantou/311/2001(H6N9)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1344 1344 100% 0.0 96% HM145064.1
Select seq gb|HM144913.1| Influenza A virus (A/duck/Shantou/1090/2001(H6N2)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1344 1344 100% 0.0 96% HM144913.1
Select seq gb|CY060407.1| Influenza A virus (A/mallard/Sweden/8/2003(H8N4)) segment 8 sequence 1344 1344 100% 0.0 96% CY060407.1
Select seq gb|CY060312.1| Influenza A virus (A/mallard/Sweden/50/2002(H3N8)) segment 8 sequence 1344 1344 100% 0.0 96% CY060312.1
Select seq gb|CY060298.1| Influenza A virus (A/mallard/Sweden/48/2002(H11N9)) segment 8 sequence 1344 1344 100% 0.0 96% CY060298.1
Select seq gb|GU053139.1| Influenza A virus (A/mallard/Sweden/85/2002(H7N7)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1344 1344 100% 0.0 96% GU053139.1
Select seq gb|GU053131.1| Influenza A virus (A/mallard/Sweden/56/2002(H7N7)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1344 1344 100% 0.0 96% GU053131.1
Select seq gb|GU052584.1| Influenza A virus (A/mallard/Netherlands/2/2005(H5N2)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1344 1344 100% 0.0 96% GU052584.1
Select seq gb|GU052188.1| Influenza A virus (A/mallard/Netherlands/02/2000(H10N7)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1344 1344 100% 0.0 96% GU052188.1
Select seq gb|DQ376795.1| Influenza A virus (A/duck/Taiwan/WB459/04(H6N5)) nonstructural protein 2 (NS2) and nonstructural protein 1 (NS1) genes, complete cds 1344 1344 100% 0.0 96% DQ376795.1
Select seq gb|AY586442.1| Influenza A virus (A/mallard/Italy/33/01(H7N3)) NS1 gene, complete cds 1344 1344 100% 0.0 96% AY586442.1
Select seq gb|KP287802.1| Influenza A virus (A/duck/Jiangxi/24570/2009(mixed)) clone b segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1341 1341 100% 0.0 95% KP287802.1
Select seq gb|KP286858.1| Influenza A virus (A/duck/Jiangxi/17142/2013(mixed)) clone b segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1341 1341 100% 0.0 95% KP286858.1
Select seq gb|CY183665.1| Influenza A virus (A/mallard/Sweden/4401/2004(H10N4)) nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1341 1341 100% 0.0 95% CY183665.1
Select seq gb|CY183503.1| Influenza A virus (A/mallard/Sweden/7996/2005(H8N4)) nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1341 1341 100% 0.0 95% CY183503.1
Select seq gb|CY183421.1| Influenza A virus (A/mallard/Sweden/7206/2004(H7N7)) nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1341 1341 100% 0.0 95% CY183421.1
Select seq gb|CY183445.1| Influenza A virus (A/mallard/Sweden/2990/2003(H8N4)) nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1341 1341 100% 0.0 95% CY183445.1
Select seq gb|KF695234.1| Influenza A virus (A/mallard/Sweden/9/2003(H2N5)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1341 1341 100% 0.0 95% KF695234.1
Select seq gb|KF695318.1| Influenza A virus (A/mallard/Sweden/64/2002(H5N2)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1341 1341 100% 0.0 95% KF695318.1
Select seq gb|KF695332.1| Influenza A virus (A/mallard/Sweden/49/2002(H5N9)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1341 1341 100% 0.0 95% KF695332.1
Select seq gb|KF695347.1| Influenza A virus (A/mallard/Sweden/54/2002(H4N6)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1341 1341 100% 0.0 95% KF695347.1
Select seq gb|KC815879.1| Influenza A virus (A/mallard/Italy/3401/2005(H5N1)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1341 1341 100% 0.0 95% KC815879.1
Select seq gb|CY121922.1| Influenza A virus (A/mallard/Sweden/88/2005(mixed)) nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1341 1341 100% 0.0 95% CY121922.1
Select seq gb|CY122224.1| Influenza A virus (A/mallard/Sweden/103/2005(H2N9)) nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1341 1341 100% 0.0 95% CY122224.1
Select seq gb|CY122151.1| Influenza A virus (A/mallard/Sweden/53/2003(H2N3)) nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1341 1341 100% 0.0 95% CY122151.1
Select seq gb|CY122143.1| Influenza A virus (A/mallard/Sweden/9/2003(H2N7)) nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1341 1341 100% 0.0 95% CY122143.1
Select seq gb|CY122079.1| Influenza A virus (A/mallard/Sweden/32/2002(H2N3)) nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1341 1341 100% 0.0 95% CY122079.1
Select seq gb|CY122051.1| Influenza A virus (A/mallard/Sweden/112/2002(H2N7)) nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1341 1341 100% 0.0 95% CY122051.1
Select seq gb|CY122011.1| Influenza A virus (A/mallard/Sweden/6/2002(H2N3)) nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1341 1341 100% 0.0 95% CY122011.1
Select seq gb|CY109294.1| Influenza A virus (A/duck/Guizhou/1084/2006(H6N2)) nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1341 1341 100% 0.0 95% CY109294.1
Select seq gb|CY098536.1| Influenza A virus (A/aquatic bird/Korea/W69/2005(H6N5)) nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1341 1341 100% 0.0 95% CY098536.1
Select seq gb|JN087076.1| Influenza A virus (A/environment/Korea/CSM08/2004(H3N3)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1341 1341 100% 0.0 95% JN087076.1
Select seq gb|HM145021.1| Influenza A virus (A/duck/Hunan/491/2005(H6N2)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1341 1341 100% 0.0 95% HM145021.1
Select seq gb|HM144896.1| Influenza A virus (A/mallard/Jiangxi/227/2003(H6N1)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1341 1341 100% 0.0 95% HM144896.1
Select seq gb|CY060370.1| Influenza A virus (A/mallard/Sweden/6/2002(H2N3)) segment 8 sequence 1341 1341 100% 0.0 95% CY060370.1
Select seq gb|GU052872.1| Influenza A virus (A/mallard/Sweden/49/2002(H5N9)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1341 1341 100% 0.0 95% GU052872.1
Select seq gb|FJ803187.1| Influenza A virus (A/mallard/Sweden/S90735/2003(H7N7)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1341 1341 100% 0.0 95% FJ803187.1
Select seq gb|CY041254.1| Influenza A virus (A/mallard/Netherlands/2/2005(H4N2)) segment 8, complete sequence 1341 1341 100% 0.0 95% CY041254.1
Select seq dbj|AB473547.1| Influenza A virus (A/duck/Mongolia/867/2002(H7N1)) genomic RNA, segment 8, complete sequence 1341 1341 100% 0.0 95% AB473547.1
Select seq gb|EF597393.1| Influenza A virus (A/migratory duck/Jiang Xi/8624/2004(H6N2)) nonstructural protein 2 (NS2) and nonstructural protein 1 (NS1) genes, complete cds 1341 1341 100% 0.0 95% EF597393.1
Select seq gb|EF597371.1| Influenza A virus (A/migratory duck/Hong Kong/MP206/2004(H5N2)) nonstructural protein 2 (NS2) and nonstructural protein 1 (NS1) genes, complete cds 1341 1341 100% 0.0 95% EF597371.1
Select seq gb|DQ251446.1| Influenza A virus (A/mallard/Denmark/64650/03(H5N7)) nonstructural protein 2 (NS2) and nonstructural protein 1 (NS1) genes, complete cds 1341 1341 100% 0.0 95% DQ251446.1
Select seq dbj|AB263196.1| Influenza A virus (A/R(duck/Mongolia/54/01-duck/Mongolia/47/01) (H5N1)) genomic RNA, segment 8, complete sequence 1341 1341 100% 0.0 95% AB263196.1
Select seq gb|AY862677.1| Influenza A virus (A/duck/Korea/S17/03(H6N1)) NS1 and NS2 genes, complete sequence 1341 1341 100% 0.0 95% AY862677.1
Select seq gb|KP862031.1| Influenza A virus (A/duck/Hunan/S3137/2009(H10N8)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1335 1335 100% 0.0 95% KP862031.1
Select seq gb|KP287736.1| Influenza A virus (A/duck/Jiangxi/3008/2009(mixed)) clone a segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1335 1335 100% 0.0 95% KP287736.1
Select seq gb|CY098250.1| Influenza A virus (A/mallard/Jiangxi/1-15/2010(H3N2)) nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1335 1335 100% 0.0 95% CY098250.1
Select seq gb|CY186296.1| Influenza A virus (A/mallard/Sweden/1621/2002(H7N9)) nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1335 1335 100% 0.0 95% CY186296.1
Select seq gb|CY185453.1| Influenza A virus (A/domestic duck/Republic of Georgia/1/2010(H10N7)) nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1335 1335 100% 0.0 95% CY185453.1
Select seq gb|CY184661.1| Influenza A virus (A/mallard/Sweden/8004/2005(H10N4)) nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1335 1335 100% 0.0 95% CY184661.1
Select seq gb|CY184003.1| Influenza A virus (A/mallard/Sweden/343/2002(H12N5)) nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1335 1335 100% 0.0 95% CY184003.1
Select seq gb|CY183762.1| Influenza A virus (A/mallard/Sweden/51933/2006(H10N9)) nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1335 1335 100% 0.0 95% CY183762.1
Select seq gb|CY183714.1| Influenza A virus (A/mallard/Sweden/8023/2005(H10N4)) nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1335 1335 100% 0.0 95% CY183714.1
Select seq gb|CY183681.1| Influenza A virus (A/mallard/Sweden/5812/2005(H10N9)) nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1335 1335 100% 0.0 95% CY183681.1
Select seq gb|CY183657.1| Influenza A virus (A/mallard/Sweden/4258/2004(H10N4)) nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1335 1335 100% 0.0 95% CY183657.1
Select seq gb|CY183461.1| Influenza A virus (A/mallard/Sweden/3244/2003(H8N4)) nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1335 1335 100% 0.0 95% CY183461.1
Select seq gb|CY043876.3| Influenza A virus (A/mallard/Sweden/4/2005(H10N4)) nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1335 1335 100% 0.0 95% CY043876.3
Select seq gb|JN029638.2| Influenza A virus (A/canvasback/Mongolia/2-69/2007(H10N6)) segment 8 nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1335 1335 100% 0.0 95% JN029638.2
Select seq gb|CY164556.1| Influenza A virus (A/mallard/Sweden/50041/2006(H4N6)) nuclear export protein (NEP) and nonstructural protein 1 (NS1) genes, complete cds 1335 1335 100% 0.0 95% CY164556.1

Page 2 of 2 All times are UTC - 5 hours [ DST ]
Powered by phpBB® Forum Software © phpBB Group
http://www.phpbb.com/