Rhiza Labs FluTracker Forum

The place to discuss the flu
It is currently Fri Sep 22, 2017 2:36 pm

All times are UTC - 5 hours [ DST ]




Post new topic Reply to topic  [ 3 posts ] 
Author Message
PostPosted: Thu Oct 22, 2015 7:54 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
Newly released 2015 chicken, duck, and turkey H5N1 sequences in Israel match Egypt.

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Thu Oct 22, 2015 7:55 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
LOCUS KT792910 1750 bp cRNA linear VRL 20-OCT-2015
DEFINITION Influenza A virus (A/chicken/Gaza/876/2015(H5N1)) segment 4
hemagglutinin (HA) gene, complete cds.
ACCESSION KT792910
VERSION KT792910.1 GI:938454686
KEYWORDS .
SOURCE Influenza A virus (A/chicken/Gaza/876/2015(H5N1))
ORGANISM Influenza A virus (A/chicken/Gaza/876/2015(H5N1))
Viruses; ssRNA viruses; ssRNA negative-strand viruses;
Orthomyxoviridae; Influenzavirus A.
REFERENCE 1 (bases 1 to 1750)
AUTHORS Shkoda,I., Lapin,K., Simanov,L., Alnakhal,R. and Lublin,A.
TITLE Highly pathogenic avian influenza A virus H5N1 isolated in Israel
2015
JOURNAL Unpublished
REFERENCE 2 (bases 1 to 1750)
AUTHORS Shkoda,I., Lapin,K., Simanov,L., Alnakhal,R. and Lublin,A.
TITLE Direct Submission
JOURNAL Submitted (21-SEP-2015) Division of Avian Diseases, Kimron
Veterinari Institute, P.O.Box 12, Bet Dagan 50250, Israel
COMMENT ##Assembly-Data-START##
Assembly Method :: SeqMan DNAStar v. DNASTAR Lasergene 8
Sequencing Technology :: IonTorrent
##Assembly-Data-END##
FEATURES Location/Qualifiers
source 1..1750
/organism="Influenza A virus
(A/chicken/Gaza/876/2015(H5N1))"
/mol_type="viral cRNA"
/strain="A/chicken/Gaza/876/2015"
/serotype="H5N1"
/host="chicken"
/db_xref="taxon:1720089"
/segment="4"
/country="Israel"
/collection_date="29-Jun-2015"
/note="passage details: E1"
gene 4..1707
/gene="HA"
CDS 4..1707
/gene="HA"
/function="receptor binding and fusion protein"
/codon_start=1
/product="hemagglutinin"
/protein_id="ALJ33525.1"
/db_xref="GI:938454687"
/translation="MEKIVLLLAIASIVKSDQICIGYHANNSTEQVDTIMEKNVTVTH
AQHILEKTHNGKLCNLDGVKPLILRDCSVAGWLLGNPMCDEFLNVPEWSYILKKINPA
NDLCYPGNFNDYEELKHLLSRINHFEKIQIIPKDSWSDHEASGVSSACPYQGRSSFFR
NVVWLTKKNDAYPTIKKSYNNTNQEDLLVLWGIHHPNDAAEQTRLYQNPTTYISVGTS
TLNQRLVPKIATRSKVNGQSGRMEFFWTILKSNDAINFESNGNFIAPENAYKIVKKGD
STIMKSELEYSNCNTKCQTPIGAINSSMPFHNIHPLTIGECPKYVKSNRLVLATGLRN
SPQGEKRRKKRGLFGAIAGFIEGGWQGMVDGWYGYHHSNEQGSGYAADKESTQRAIDG
VTNKVNSIIDKMNTQFEAVGREFNNLERRIENLNKKMEDGFLDVWTYNAELLVLMENE
RTLDFHDSNVKNLYDKVRLQLRDNAKELGNGCFEFYHRCDNECMESVRNGTYDYPQYS
EEARLKREEISGVKLESIGTYQILSIYSTVASSLALAIMVAGLSLWMCSNGSLQCRIC
I"
sig_peptide 4..51
/gene="HA"
mat_peptide 52..1038
/gene="HA"
/product="HA1"
mat_peptide 1039..1704
/gene="HA"
/product="HA2"
ORIGIN
1 aaaatggaga aaatagtgct tcttcttgca atagccagta ttgtcaaaag tgatcagatt
61 tgcattggtt accatgcaaa caactcgaca gagcaggttg acacaataat ggaaaagaac
121 gtcactgtta cacacgccca acacatactg gaaaagacac acaacgggaa actctgcaat
181 ctagatggag tgaagcctct cattttaaga gattgtagtg tagctggatg gctcctcggg
241 aacccaatgt gcgatgagtt cctcaatgtg ccggaatggt cttacatact gaagaaaatc
301 aatccagcca atgacctctg ttatccaggg aatttcaacg actatgaaga actgaaacac
361 ctattgagca gaataaacca ttttgagaaa attcagatca ttcccaaaga ttcttggtca
421 gatcatgaag cctcaggagt gagctcagca tgcccatacc aaggaagatc ctcctttttt
481 agaaatgttg tatggcttac caaaaagaac gatgcatacc caacaataaa gaaaagttac
541 aataatacta accaagaaga tcttttggta ctatggggga ttcaccatcc aaatgatgct
601 gcagagcaga caaggcttta tcaaaaccca actacctata tctccgttgg gacatcaaca
661 ctaaaccaga gattggtacc caaaatagct actagatcta aggtaaacgg gcaaagtgga
721 aggatggagt tcttttggac aattttaaaa tcgaatgatg caataaactt tgagagcaat
781 ggaaacttca ttgctccaga aaatgcatac aaaattgtca agaaaggaga ttcaacaatt
841 atgaaaagtg agttggaata tagtaactgc aacaccaagt gtcagactcc aataggggcg
901 ataaactcca gtatgccatt ccacaacatc caccctctca ccatcgggga atgccccaaa
961 tatgtgaaat caaacagatt agtccttgct actgggctca ggaatagccc tcaaggagag
1021 aaaagaagaa aaaagagagg actattcgga gccatagcag gttttataga gggaggatgg
1081 cagggaatgg tagatggttg gtatgggtac caccatagca acgagcaggg gagtgggtac
1141 gctgcagaca aagaatccac tcaaagggct atagatggag tcaccaataa ggtcaattca
1201 atcattgaca aaatgaacac ccagtttgag gctgttggaa gggaatttaa taacttagaa
1261 aggagaatag aaaatttgaa caagaagatg gaagacggat tcctagatgt ctggacctat
1321 aatgctgaac ttctggttct catggaaaat gagagaactc tagactttca tgactcaaat
1381 gtcaaaaatc tttatgacaa ggtccgacta cagcttaggg ataatgcaaa ggagcttggt
1441 aacggctgtt tcgagttcta tcacagatgt gataatgaat gtatggaaag tgtaagaaac
1501 ggaacgtatg actatcctca atattcagaa gaagcaagat taaaaagaga ggaaataagt
1561 ggagtaaaat tggagtcaat aggaacttac caaatactgt caatttattc aacagtggcg
1621 agctccctag cactggcaat catggtggct ggtctatctt tatggatgtg ctccaatgga
1681 tcgctacaat gcagaatttg catttaaatt tgtgagttca aattgtagtt aaaaacaccc
1741 ttgtttctac

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Thu Oct 22, 2015 7:57 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
EPI579781 A/duck/Egypt/CLEVB-25_N00239/2015 (A/H5N1) segment 4 (HA) 3092.4 0.000000e+00 1694/1704 (99%)
EPI579780 A/duck/Egypt/CLEVB-24_N00238/2015 (A/H5N1) segment 4 (HA) 3092.4 0.000000e+00 1694/1704 (99%)
EPI584778 A/chicken/Egypt/A10351A/2014 (A/H5N1) segment 4 (HA) 3059.2 0.000000e+00 1688/1704 (99%)
EPI573268 A/Turkey/Egypt/AR238-SD177NLQP/2014 (A/H5N1) segment 4 (HA) 3053.6 0.000000e+00 1685/1701 (99%)
EPI579006 A/chicken/Egypt/CLEVB-1_N00215/2014 (A/H5N1) segment 4 (HA) 3049.9 0.000000e+00 1686/1704 (98%)
EPI573252 A/Turkey/Egypt/AR235-S240NLQP/2014 (A/H5N1) segment 4 (HA) 3048.1 0.000000e+00 1684/1701 (99%)
EPI573250 A/chicken/Egypt/AR234-FAOF8NLQP/2014 (A/H5N1) segment 4 (HA) 3048.1 0.000000e+00 1684/1701 (99%)
EPI573244 A/chicken/Egypt/AR231-CA113NLQP/2014 (A/H5N1) segment 4 (HA) 3048.1 0.000000e+00 1684/1701 (99%)
EPI579784 A/chicken/Egypt/CLEVB-18_N00232/2015 (A/H5N1) segment 4 (HA) 3042.6 0.000000e+00 1685/1704 (98%)
EPI579783 A/chicken/Egypt/CLEVB-21_N00235/2015 (A/H5N1) segment 4 (HA) 3042.6 0.000000e+00 1685/1704 (98%)
EPI579782 A/chicken/Egypt/CLEVB-20_N00234/2015 (A/H5N1) segment 4 (HA) 3042.6 0.000000e+00 1685/1704 (98%)
EPI579520 A/chicken/Egypt/CLEVB-17_N00231/2015 (A/H5N1) segment 4 (HA) 3042.6 0.000000e+00 1685/1704 (98%)
EPI579325 A/chicken/Egypt/CLEVB-16_N00230/2014 (A/H5N1) segment 4 (HA) 3042.6 0.000000e+00 1685/1704 (98%)
EPI579324 A/chicken/Egypt/CLEVB-19_N00233/2015 (A/H5N1) segment 4 (HA) 3042.6 0.000000e+00 1685/1704 (98%)
EPI574132 A/Egypt/MOH-NRC-7305/2014 (A/H5N1) segment 4 (HA) 3042.6 0.000000e+00 1685/1704 (98%)
EPI557138 A/Quail/Egypt/BSU5514-AR2219/2014 (A/H5N1) segment 4 (HA) 3042.6 0.000000e+00 1683/1701 (98%)
EPI573248 A/chicken/Egypt/AR233-S283NLQP/2014 (A/H5N1) segment 4 (HA) 3038.9 0.000000e+00 1681/1699 (98%)
EPI642537 A/Egypt/682/2015 (A/H5N1) segment 4 (HA) 3031.5 0.000000e+00 1683/1704 (98%)
EPI573260 A/Duck/Egypt/AR236-A3NLQP/2015 (A/H5N1) segment 4 (HA) 3031.5 0.000000e+00 1681/1701 (98%)
EPI573246 A/Duck/Egypt/AR232-A13NLQP/2014 (A/H5N1) segment 4 (HA) 3020.4 0.000000e+00 1679/1701 (98%)
EPI584783 A/Egypt/MOH-NRC-8434/2014 (A/H5N1) segment 4 (HA) 3014.9 0.000000e+00 1680/1704 (98%)
EPI574125 A/Egypt/MOH-NRC-7271/2014 (A/H5N1) segment 4 (HA) 3014.9 0.000000e+00 1680/1704 (98%)
EPI550493 A/duck/Egypt/14VIR784-4-133AD/2013 (A/H5N1) segment 4 (HA) 3003.8 0.000000e+00 1678/1704 (98%)
EPI573322 A/chicken/Egypt/152RS/2015 (A/H5N1) segment 4 (HA) 3000.1 0.000000e+00 1657/1674 (98%)
EPI573315 A/duck/Egypt/BS-146RS-f6/2014 (A/H5N1) segment 4 (HA) 2996.4 0.000000e+00 1656/1673 (98%)
EPI573321 A/chicken/Egypt/153AF/2015 (A/H5N1) segment 4 (HA) 2994.5 0.000000e+00 1656/1674 (98%)
EPI573330 A/chicken/Egypt/1476CA/2014 (A/H5N1) segment 4 (HA) 2987.2 0.000000e+00 1655/1674 (98%)
EPI557194 A/Duck/Egypt/NLQP27SG-AR750/2013 (A/H5N1) segment 4 (HA) 2987.2 0.000000e+00 1673/1701 (98%)
EPI573328 A/chicken/Egypt/14168CA/2014 (A/H5N1) segment 4 (HA) 2983.5 0.000000e+00 1647/1663 (99%)
EPI573318 A/chicken/Egypt/1478CAL/2014 (A/H5N1) segment 4 (HA) 2983.5 0.000000e+00 1647/1663 (99%)
EPI573319 A/chicken/Egypt/152/2015 (A/H5N1) segment 4 (HA) 2981.6 0.000000e+00 1652/1671 (98%)
EPI557178 A/chicken/Egypt/NLQP33SD-AR748/2013 (A/H5N1) segment 4 (HA) 2981.6 0.000000e+00 1673/1702 (98%)
EPI500079 A/goose/Egypt/M7221D/2013 (A/H5N1) segment 4 (HA) 2976.1 0.000000e+00 1673/1704 (98%)
EPI500078 A/chicken/Egypt/M7217A/2013 (A/H5N1) segment 4 (HA) 2976.1 0.000000e+00 1673/1704 (98%)
EPI487342 A/chicken/Egypt/M7217B/2013 (A/H5N1) segment 4 (HA) 2976.1 0.000000e+00 1673/1704 (98%)
EPI500109 A/chicken/Egypt/Q5283C/2012 (A/H5N1) segment 4 (HA) 2972.4 0.000000e+00 1672/1704 (98%)
EPI504991 A/chicken/Egypt/BSU-BS-R24/2012 (A/H5N1) segment 4 (HA) 2970.5 0.000000e+00 1672/1704 (98%)
EPI504990 A/chicken/Egypt/BSU-BS-F27/2012 (A/H5N1) segment 4 (HA) 2970.5 0.000000e+00 1672/1704 (98%)
EPI373013 A/Egypt/N00166/2011 (A/H5N1) segment 4 (HA) 2970.5 0.000000e+00 1673/1705 (98%)
EPI348153 A/chicken/Egypt/11VIR4453-266/2010 (A/H5N1) segment 4 (HA) 2966.8 0.000000e+00 1671/1704 (98%)
EPI597822 A/duck/Egypt/1471SG/2014 (A/H5N1) segment 4 (HA) 2965.0 0.000000e+00 1672/1705 (98%)
EPI557218 A/chicken/Egypt/NLQP139V-AR753/2013 (A/H5N1) segment 4 (HA) 2965.0 0.000000e+00 1669/1701 (98%)
EPI340133 A/goose/Egypt/1117SF/2011 (A/H5N1) segment 4 (HA) 2965.0 0.000000e+00 1671/1704 (98%)
EPI603916 A/duck/Egypt/154FAOFL/2015 (A/H5N1) segment 4 (HA) 2961.3 0.000000e+00 1628/1640 (99%)
EPI597815 A/turkey/Egypt/1438S/2014 (A/H5N1) segment 4 (HA) 2959.5 0.000000e+00 1670/1704 (98%)
EPI500082 A/duck/Egypt/M7218B/2013 (A/H5N1) segment 4 (HA) 2959.5 0.000000e+00 1671/1705 (98%)
EPI340135 A/chicken/Egypt/1113/2011 (A/H5N1) segment 4 (HA) 2959.5 0.000000e+00 1670/1704 (98%)
EPI338733 A/duck/Egypt/M2583B/2010 (A/H5N1) segment 4 (HA) 2959.5 0.000000e+00 1671/1705 (98%)
EPI338732 A/duck/Egypt/M2583C/2010 (A/H5N1) segment 4 (HA) 2959.5 0.000000e+00 1671/1705 (98%)
EPI338616 A/duck/Egypt/M2583D/2010 (A/H5N1) segment 4 (HA) 2959.5 0.000000e+00 1671/1705 (98%)
EPI608783 A/turkey/Israel/188/2015 (A/H5N1) segment 4 (HA) 2953.9 0.000000e+00 1627/1641 (99%)
EPI608778 A/chicken/Israel/88/2015 (A/H5N1) segment 4 (HA) 2953.9 0.000000e+00 1627/1641 (99%)
EPI608777 A/turkey/Israel/107/2015 (A/H5N1) segment 4 (HA) 2953.9 0.000000e+00 1627/1641 (99%)
EPI600754 A/chicken/Egypt/N05832-CLEVB754/2011 (A/H5N1) segment 4 (HA) 2953.9 0.000000e+00 1667/1701 (98%)
EPI597812 A/chicken/Egypt/1422S/2014 (A/H5N1) segment 4 (HA) 2953.9 0.000000e+00 1669/1704 (97%)
EPI372907 A/Egypt/N7562/2011 (A/H5N1) segment 4 (HA) 2953.9 0.000000e+00 1670/1705 (97%)
EPI348152 A/chicken/Egypt/11VIR4453-268/2010 (A/H5N1) segment 4 (HA) 2953.9 0.000000e+00 1669/1704 (97%)
EPI340138 A/duck/Egypt/1125S/2011 (A/H5N1) segment 4 (HA) 2953.9 0.000000e+00 1669/1704 (97%)
EPI340101 A/chicken/Egypt/1112AF/2011 (A/H5N1) segment 4 (HA) 2953.9 0.000000e+00 1669/1704 (97%)
EPI340087 A/duck/Egypt/11193SF/2011 (A/H5N1) segment 4 (HA) 2953.9 0.000000e+00 1669/1704 (97%)
EPI340085 A/chicken/Egypt/1118AF/2011 (A/H5N1) segment 4 (HA) 2953.9 0.000000e+00 1669/1704 (97%)
EPI338615 A/duck/Egypt/Q2645C/2010 (A/H5N1) segment 4 (HA) 2953.9 0.000000e+00 1669/1704 (97%)
EPI608786 A/turkey/Israel/209/2015 (A/H5N1) segment 4 (HA) 2948.4 0.000000e+00 1626/1641 (99%)
EPI608780 A/turkey/Jenin/39/2015 (A/H5N1) segment 4 (HA) 2948.4 0.000000e+00 1626/1641 (99%)
EPI597825 A/turkey/Egypt/1414CAL/2014 (A/H5N1) segment 4 (HA) 2948.4 0.000000e+00 1668/1704 (97%)
EPI597823 A/turkey/Egypt/14125S/2014 (A/H5N1) segment 4 (HA) 2948.4 0.000000e+00 1668/1704 (97%)
EPI597818 A/chicken/Egypt/1461S/2014 (A/H5N1) segment 4 (HA) 2948.4 0.000000e+00 1668/1704 (97%)
EPI597816 A/duck/Egypt/1435CAS/2014 (A/H5N1) segment 4 (HA) 2948.4 0.000000e+00 1669/1705 (97%)
EPI557136 A/Turkey/Egypt/BSU5114-AR2218/2014 (A/H5N1) segment 4 (HA) 2948.4 0.000000e+00 1666/1701 (97%)
EPI373011 A/Egypt/N04288/2011 (A/H5N1) segment 4 (HA) 2948.4 0.000000e+00 1668/1704 (97%)
EPI372963 A/Egypt/N10621/2011 (A/H5N1) segment 4 (HA) 2948.4 0.000000e+00 1668/1704 (97%)
EPI340151 A/chicken/Egypt/10513S/2010 (A/H5N1) segment 4 (HA) 2948.4 0.000000e+00 1668/1704 (97%)
EPI340136 A/chicken/Egypt/1112/2011 (A/H5N1) segment 4 (HA) 2948.4 0.000000e+00 1668/1704 (97%)
EPI340104 A/chicken/Egypt/117AD/2011 (A/H5N1) segment 4 (HA) 2948.4 0.000000e+00 1668/1704 (97%)
EPI550507 A/duck/Egypt/14VIR784-8-1339S/2013 (A/H5N1) segment 4 (HA) 2946.5 0.000000e+00 1667/1703 (97%)
EPI348158 A/chicken/Egypt/11VIR4453-109/VRLCU/2011 (A/H5N1) segment 4 (HA) 2946.5 0.000000e+00 1667/1703 (97%)
EPI608781 A/turkey/Israel/274/2015 (A/H5N1) segment 4 (HA) 2944.7 0.000000e+00 1624/1639 (99%)
EPI373020 A/Egypt/N08932/2010 (A/H5N1) segment 4 (HA) 2944.7 0.000000e+00 1667/1704 (97%)
EPI348160 A/chicken/Egypt/11VIR4453-267/2010 (A/H5N1) segment 4 (HA) 2944.7 0.000000e+00 1666/1702 (97%)
EPI348157 A/chicken/Egypt/11VIR4453-15/VRLCU/2010 (A/H5N1) segment 4 (HA) 2944.7 0.000000e+00 1666/1702 (97%)
EPI348156 A/chicken/Egypt11VIR4453-269/2010 (A/H5N1) segment 4 (HA) 2944.7 0.000000e+00 1666/1703 (97%)
EPI608784 A/chicken/Israel/333/2015 (A/H5N1) segment 4 (HA) 2942.8 0.000000e+00 1625/1641 (99%)
EPI608782 A/turkey/Israel/174/2015 (A/H5N1) segment 4 (HA) 2942.8 0.000000e+00 1625/1641 (99%)
EPI608779 A/chicken/Qalqilya/53/2015 (A/H5N1) segment 4 (HA) 2942.8 0.000000e+00 1625/1641 (99%)
EPI597817 A/chicken/Egypt/1460S/2014 (A/H5N1) segment 4 (HA) 2942.8 0.000000e+00 1667/1704 (97%)
EPI597814 A/chicken/Egypt/1429S/2014 (A/H5N1) segment 4 (HA) 2942.8 0.000000e+00 1667/1704 (97%)
EPI397334 A/duck/Egypt/1111sg/2011 (A/H5N1) segment 4 (HA) 2942.8 0.000000e+00 1667/1704 (97%)
EPI373016 A/Egypt/N10954/2010 (A/H5N1) segment 4 (HA) 2942.8 0.000000e+00 1667/1704 (97%)
EPI340106 A/duck/Egypt/1110AF/2011 (A/H5N1) segment 4 (HA) 2942.8 0.000000e+00 1667/1704 (97%)
EPI340103 A/chicken/Egypt/111766V/2011 (A/H5N1) segment 4 (HA) 2942.8 0.000000e+00 1667/1704 (97%)
EPI340092 A/chicken/Egypt/1155/2011 (A/H5N1) segment 4 (HA) 2942.8 0.000000e+00 1667/1704 (97%)
EPI338618 A/duck/Egypt/M2583A/2010 (A/H5N1) segment 4 (HA) 2942.8 0.000000e+00 1668/1705 (97%)
EPI338610 A/duck/Egypt/M3075B/2011 (A/H5N1) segment 4 (HA) 2942.8 0.000000e+00 1668/1705 (97%)
EPI608787 A/spur-winged lapwing/Israel/101/2015 (A/H5N1) segment 4 (HA) 2937.3 0.000000e+00 1624/1641 (98%)
EPI597813 A/chicken/Egypt/1412SD/2014 (A/H5N1) segment 4 (HA) 2937.3 0.000000e+00 1666/1704 (97%)
EPI550500 A/duck/Egypt/14VIR784-6-1328S/2013 (A/H5N1) segment 4 (HA) 2937.3 0.000000e+00 1666/1704 (97%)
EPI537618 A/Egypt/N01754/2014 (A/H5N1) segment 4 (HA) 2937.3 0.000000e+00 1666/1704 (97%)
EPI373012 A/Egypt/N04286/2011 (A/H5N1) segment 4 (HA) 2937.3 0.000000e+00 1666/1704 (97%)
EPI372875 A/Egypt/N0677/2011 (A/H5N1) segment 4 (HA) 2937.3 0.000000e+00 1667/1705 (97%)
EPI369180 A/duck/Egypt/1120SMF/2011 (A/H5N1) segment 4 (HA) 2937.3 0.000000e+00 1666/1704 (97%)
EPI340165 A/duck/Egypt/10228SF/2010 (A/H5N1) segment 4 (HA) 2937.3 0.000000e+00 1666/1704 (97%)
EPI340154 A/duck/Egypt/10118/2010 (A/H5N1) segment 4 (HA) 2937.3 0.000000e+00 1667/1705 (97%)
EPI340141 A/chicken/Egypt/112SG/2011 (A/H5N1) segment 4 (HA) 2937.3 0.000000e+00 1666/1704 (97%)
EPI340131 A/chicken/Egypt/1117/2011 (A/H5N1) segment 4 (HA) 2937.3 0.000000e+00 1666/1704 (97%)
EPI340122 A/chicken/Egypt/1128/2011 (A/H5N1) segment 4 (HA) 2937.3 0.000000e+00 1666/1704 (97%)
EPI340107 A/chicken/Egypt/11184S/2011 (A/H5N1) segment 4 (HA) 2937.3 0.000000e+00 1667/1705 (97%)
EPI340102 A/chicken/Egypt/1134SD/2011 (A/H5N1) segment 4 (HA) 2937.3 0.000000e+00 1666/1704 (97%)
EPI340091 A/duck/Egypt/11117SS/2011 (A/H5N1) segment 4 (HA) 2937.3 0.000000e+00 1666/1704 (97%)
EPI373017 A/Egypt/N05860/2011 (A/H5N1) segment 4 (HA) 2933.6 0.000000e+00 1665/1704 (97%)
EPI348151 A/chicken/Egypt/11VIR4453-270/2010 (A/H5N1) segment 4 (HA) 2933.6 0.000000e+00 1661/1698 (97%)
EPI340118 A/chicken/Egypt/1158SF/2011 (A/H5N1) segment 4 (HA) 2933.6 0.000000e+00 1668/1707 (97%)
EPI597828 A/goose/Egypt/1439FAOS/2014 (A/H5N1) segment 4 (HA) 2931.8 0.000000e+00 1665/1704 (97%)
EPI597811 A/duck/Egypt/141AI/2014 (A/H5N1) segment 4 (HA) 2931.8 0.000000e+00 1666/1705 (97%)
EPI537617 A/Egypt/N01753/2014 (A/H5N1) segment 4 (HA) 2931.8 0.000000e+00 1664/1703 (97%)
EPI393783 A/Egypt/N00951/2012 (A/H5N1) segment 4 (HA) 2931.8 0.000000e+00 1665/1704 (97%)
EPI373022 A/Egypt/N09407/2010 (A/H5N1) segment 4 (HA) 2931.8 0.000000e+00 1665/1704 (97%)
EPI373015 A/Egypt/N04284/2011 (A/H5N1) segment 4 (HA) 2931.8 0.000000e+00 1665/1704 (97%)
EPI372851 A/Egypt/N0544/2011 (A/H5N1) segment 4 (HA) 2931.8 0.000000e+00 1665/1704 (97%)
EPI340126 A/chicken/Egypt/112AF/2011 (A/H5N1) segment 4 (HA) 2931.8 0.000000e+00 1665/1704 (97%)
EPI340124 A/chicken/Egypt/114AF/2011 (A/H5N1) segment 4 (HA) 2931.8 0.000000e+00 1665/1704 (97%)
EPI340123 A/chicken/Egypt/115AF/2011 (A/H5N1) segment 4 (HA) 2931.8 0.000000e+00 1665/1704 (97%)
EPI340121 A/chicken/Egypt/1146SF/2011 (A/H5N1) segment 4 (HA) 2931.8 0.000000e+00 1665/1704 (97%)
EPI340119 A/duck/Egypt/1148SF/2011 (A/H5N1) segment 4 (HA) 2931.8 0.000000e+00 1665/1704 (97%)
EPI340100 A/duck/Egypt/11211S/2011 (A/H5N1) segment 4 (HA) 2931.8 0.000000e+00 1665/1704 (97%)
EPI340094 A/duck/Egypt/1116AF/2011 (A/H5N1) segment 4 (HA) 2931.8 0.000000e+00 1665/1704 (97%)
EPI338614 A/chicken/Egypt/M2773A/2011 (A/H5N1) segment 4 (HA) 2931.8 0.000000e+00 1665/1704 (97%)
EPI338609 A/chicken/Egypt/S3280B/2011 (A/H5N1) segment 4 (HA) 2931.8 0.000000e+00 1666/1705 (97%)
EPI336862 A/turkey/Jenin/341/2011 (A/H5N1) segment 4 (HA) 2931.8 0.000000e+00 1665/1704 (97%)
EPI628911 A/chicken/F611/Egypt/2015(H5N1) (A/H5N1) segment 4 (HA) 2929.9 0.000000e+00 1623/1642 (98%)
EPI603902 A/chicken/Egypt/1439CAL/2014 (A/H5N1) segment 4 (HA) 2929.9 0.000000e+00 1658/1694 (97%)
EPI538767 A/chicken/Egypt/13VIR-2962-109/2013 (A/H5N1) segment 4 (HA) 2929.9 0.000000e+00 1656/1691 (97%)
EPI372923 A/Egypt/N7724/2011 (A/H5N1) segment 4 (HA) 2928.1 0.000000e+00 1664/1704 (97%)
EPI369189 A/chicken/Egypt/1188/2011 (A/H5N1) segment 4 (HA) 2928.1 0.000000e+00 1665/1705 (97%)
EPI597819 A/duck/Egypt/1468S/2014 (A/H5N1) segment 4 (HA) 2926.2 0.000000e+00 1665/1705 (97%)
EPI557202 A/chicken/Egypt/NLQP20SL-AR751/2013 (A/H5N1) segment 4 (HA) 2926.2 0.000000e+00 1662/1701 (97%)
EPI493430 A/chicken/Egypt/S3280E/2011 (A/H5N1) segment 4 (HA) 2926.2 0.000000e+00 1665/1705 (97%)
EPI393786 A/Egypt/N02137/2012 (A/H5N1) segment 4 (HA) 2926.2 0.000000e+00 1664/1704 (97%)
EPI373019 A/Egypt/N04285/2011 (A/H5N1) segment 4 (HA) 2926.2 0.000000e+00 1664/1704 (97%)
EPI373018 A/Egypt/N00002/2011 (A/H5N1) segment 4 (HA) 2926.2 0.000000e+00 1664/1704 (97%)
EPI372859 A/Egypt/N6322/2011 (A/H5N1) segment 4 (HA) 2926.2 0.000000e+00 1664/1704 (97%)
EPI372715 A/Egypt/9538-NAMRU3/2009 (A/H5N1) segment 4 (HA) 2926.2 0.000000e+00 1664/1704 (97%)
EPI369181 A/chicken/Egypt/1176/2011 (A/H5N1) segment 4 (HA) 2926.2 0.000000e+00 1664/1704 (97%)
EPI340173 A/chicken/Egypt/1021AD/2010 (A/H5N1) segment 4 (HA) 2926.2 0.000000e+00 1664/1704 (97%)
EPI340160 A/chicken/Egypt/10250SF/2010 (A/H5N1) segment 4 (HA) 2926.2 0.000000e+00 1664/1704 (97%)
EPI340127 A/chicken/Egypt/111AF/2011 (A/H5N1) segment 4 (HA) 2926.2 0.000000e+00 1664/1704 (97%)
EPI340109 A/chicken/Egypt/111640V/2011 (A/H5N1) segment 4 (HA) 2926.2 0.000000e+00 1664/1704 (97%)
EPI340082 A/quail/Egypt/1171SG/2011 (A/H5N1) segment 4 (HA) 2926.2 0.000000e+00 1664/1704 (97%)
EPI338731 A/goose/Egypt/M2794E/2011 (A/H5N1) segment 4 (HA) 2926.2 0.000000e+00 1664/1704 (97%)
EPI338613 A/goose/Egypt/M2788A/2011 (A/H5N1) segment 4 (HA) 2926.2 0.000000e+00 1664/1704 (97%)
EPI338612 A/goose/Egypt/M2788E/2011 (A/H5N1) segment 4 (HA) 2926.2 0.000000e+00 1664/1704 (97%)
EPI338611 A/goose/Egypt/M2794A/2011 (A/H5N1) segment 4 (HA) 2926.2 0.000000e+00 1664/1704 (97%)
EPI255398 A/Egypt/N09174/2009 (A/H5N1) segment 4 (HA) 2926.2 0.000000e+00 1664/1704 (97%)
EPI603901 A/chicken/Egypt/1436CAL/2014 (A/H5N1) segment 4 (HA) 2924.4 0.000000e+00 1657/1694 (97%)
EPI460395 A/chicken/Egypt/1094/2010 (A/H5N1) segment 4 (HA) 2924.4 0.000000e+00 1657/1694 (97%)
EPI348155 A/chicken/Egypt/11VIR4453-68/VRLCU/2011 (A/H5N1) segment 4 (HA) 2924.4 0.000000e+00 1655/1691 (97%)
EPI372867 A/Egypt/N6658/2011 (A/H5N1) segment 4 (HA) 2920.7 0.000000e+00 1663/1704 (97%)
EPI340152 A/duck/Egypt/10290SF/2010 (A/H5N1) segment 4 (HA) 2920.7 0.000000e+00 1663/1704 (97%)
EPI340149 A/duck/Egypt/10336SF/2010 (A/H5N1) segment 4 (HA) 2920.7 0.000000e+00 1663/1704 (97%)
EPI340147 A/chicken/Egypt/10132/2010 (A/H5N1) segment 4 (HA) 2920.7 0.000000e+00 1663/1704 (97%)
EPI340134 A/duck/Egypt/1113SD/2011 (A/H5N1) segment 4 (HA) 2920.7 0.000000e+00 1664/1705 (97%)
EPI340129 A/chicken/Egypt/1174S/2011 (A/H5N1) segment 4 (HA) 2920.7 0.000000e+00 1663/1704 (97%)
EPI340116 A/chicken/Egypt/116AF/2011 (A/H5N1) segment 4 (HA) 2920.7 0.000000e+00 1664/1705 (97%)
EPI340115 A/duck/Egypt/1174SF/2011 (A/H5N1) segment 4 (HA) 2920.7 0.000000e+00 1663/1704 (97%)
EPI340099 A/duck/Egypt/1153/2011 (A/H5N1) segment 4 (HA) 2920.7 0.000000e+00 1663/1704 (97%)
EPI340096 A/chicken/Egypt/111945V/2011 (A/H5N1) segment 4 (HA) 2920.7 0.000000e+00 1663/1704 (97%)
EPI338608 A/chicken/Egypt/S3280D/2011 (A/H5N1) segment 4 (HA) 2920.7 0.000000e+00 1664/1705 (97%)
EPI255371 A/Egypt/N02127/2010 (A/H5N1) segment 4 (HA) 2920.7 0.000000e+00 1663/1704 (97%)
EPI603908 A/chicken/Egypt/1456CAL/2014 (A/H5N1) segment 4 (HA) 2918.8 0.000000e+00 1656/1694 (97%)
EPI348154 A/chicken/Egypt/11VIR4453-264/2010 (A/H5N1) segment 4 (HA) 2918.8 0.000000e+00 1662/1704 (97%)
EPI574389 A/Turkey/Egypt/14240FAOS/2014 (A/H5N1) segment 4 (HA) 2917.0 0.000000e+00 1623/1644 (98%)
EPI372915 A/Egypt/N7592/2011 (A/H5N1) segment 4 (HA) 2917.0 0.000000e+00 1662/1704 (97%)
EPI255367 A/Egypt/N01982/2010 (A/H5N1) segment 4 (HA) 2917.0 0.000000e+00 1662/1704 (97%)
EPI608785 A/chicken/Israel/156/2015 (A/H5N1) segment 4 (HA) 2915.1 0.000000e+00 1620/1641 (98%)
EPI597827 A/chicken/Egypt/147CA/2014 (A/H5N1) segment 4 (HA) 2915.1 0.000000e+00 1664/1706 (97%)
EPI597821 A/chicken/Egypt/1411CAL/2014 (A/H5N1) segment 4 (HA) 2915.1 0.000000e+00 1663/1705 (97%)
EPI500117 A/duck/Egypt/S6419C/2012 (A/H5N1) segment 4 (HA) 2915.1 0.000000e+00 1662/1704 (97%)
EPI500080 A/turkey/Egypt/S6405E/2012 (A/H5N1) segment 4 (HA) 2915.1 0.000000e+00 1662/1704 (97%)
EPI373014 A/Egypt/N04287/2011 (A/H5N1) segment 4 (HA) 2915.1 0.000000e+00 1664/1706 (97%)
EPI372883 A/Egypt/N6774/2011 (A/H5N1) segment 4 (HA) 2915.1 0.000000e+00 1662/1704 (97%)
EPI369193 A/chicken/Egypt/121/2012 (A/H5N1) segment 4 (HA) 2915.1 0.000000e+00 1662/1704 (97%)
EPI369190 A/duck/Egypt/11762s/2011 (A/H5N1) segment 4 (HA) 2915.1 0.000000e+00 1662/1704 (97%)
EPI340144 A/chicken/Egypt/10413SF/2010 (A/H5N1) segment 4 (HA) 2915.1 0.000000e+00 1664/1706 (97%)
EPI340097 A/duck/Egypt/11221S/2011 (A/H5N1) segment 4 (HA) 2915.1 0.000000e+00 1662/1704 (97%)
EPI340089 A/duck/Egypt/11312S/2011 (A/H5N1) segment 4 (HA) 2915.1 0.000000e+00 1664/1706 (97%)
EPI603900 A/turkey/Egypt/1419FAOS/2014 (A/H5N1) segment 4 (HA) 2913.3 0.000000e+00 1655/1694 (97%)
EPI348148 A/chicken/Egypt/11VIR4453-59/VRLCU/2011 (A/H5N1) segment 4 (HA) 2913.3 0.000000e+00 1651/1688 (97%)
EPI603915 A/duck/Egypt/153AL/2015 (A/H5N1) segment 4 (HA) 2911.4 0.000000e+00 1610/1627 (98%)
EPI369179 A/chicken/Egypt/11506SF/2011 (A/H5N1) segment 4 (HA) 2911.4 0.000000e+00 1661/1704 (97%)
EPI500085 A/duck/Egypt/S6419E/2012 (A/H5N1) segment 4 (HA) 2909.6 0.000000e+00 1661/1704 (97%)
EPI493497 A/chicken/Egypt/S2938D/2011 (A/H5N1) segment 4 (HA) 2909.6 0.000000e+00 1661/1704 (97%)
EPI372931 A/Egypt/N09966/2011 (A/H5N1) segment 4 (HA) 2909.6 0.000000e+00 1661/1704 (97%)
EPI372891 A/Egypt/N6828/2011 (A/H5N1) segment 4 (HA) 2909.6 0.000000e+00 1662/1705 (97%)
EPI369186 A/duck/Egypt/11685s/2011 (A/H5N1) segment 4 (HA) 2909.6 0.000000e+00 1662/1705 (97%)
EPI369185 A/chicken/Egypt/11667s/2011 (A/H5N1) segment 4 (HA) 2909.6 0.000000e+00 1661/1704 (97%)
EPI369183 A/chicken/Egypt/11672s/2011 (A/H5N1) segment 4 (HA) 2909.6 0.000000e+00 1662/1705 (97%)
EPI340146 A/chicken/Egypt/10347SF/2010 (A/H5N1) segment 4 (HA) 2909.6 0.000000e+00 1661/1704 (97%)
EPI340110 A/goose/Egypt/11162S/2011 (A/H5N1) segment 4 (HA) 2909.6 0.000000e+00 1661/1704 (97%)
EPI338730 A/chicken/Egypt/S2938A/2011 (A/H5N1) segment 4 (HA) 2909.6 0.000000e+00 1661/1704 (97%)
EPI338729 A/chicken/Egypt/S3093A/2011 (A/H5N1) segment 4 (HA) 2909.6 0.000000e+00 1661/1704 (97%)
EPI287352 A/chicken/Egypt/1553-15/2010 (A/H5N1) segment 4 (HA) 2909.6 0.000000e+00 1661/1704 (97%)
EPI283813 A/duck/Egypt/1068s/2010 (A/H5N1) segment 4 (HA) 2909.6 0.000000e+00 1661/1704 (97%)
EPI283811 A/goose/Egypt/1057/2010 (A/H5N1) segment 4 (HA) 2909.6 0.000000e+00 1659/1701 (97%)
EPI283791 A/chicken/Egypt/1034/2010 (A/H5N1) segment 4 (HA) 2909.6 0.000000e+00 1659/1701 (97%)
EPI255400 A/Egypt/N09539/2009 (A/H5N1) segment 4 (HA) 2909.6 0.000000e+00 1661/1704 (97%)
EPI348150 A/chicken/Egypt/11VIR4453-138/VRLCU/2011 (A/H5N1) segment 4 (HA) 2907.7 0.000000e+00 1658/1699 (97%)
EPI557210 A/chicken/Egypt/NLQP639V-AR752/2013 (A/H5N1) segment 4 (HA) 2904.1 0.000000e+00 1659/1702 (97%)
EPI493152 A/duck/Egypt/Q4596B/2012 (A/H5N1) segment 4 (HA) 2904.1 0.000000e+00 1660/1704 (97%)
EPI398575 A/duck/Egypt/Q4596C/2012 (A/H5N1) segment 4 (HA) 2904.1 0.000000e+00 1660/1704 (97%)
EPI373021 A/Egypt/N16789/2010 (A/H5N1) segment 4 (HA) 2904.1 0.000000e+00 1661/1705 (97%)
EPI372955 A/Egypt/N14976/2011 (A/H5N1) segment 4 (HA) 2904.1 0.000000e+00 1660/1704 (97%)
EPI372947 A/Egypt/N11470/2011 (A/H5N1) segment 4 (HA) 2904.1 0.000000e+00 1660/1704 (97%)
EPI369197 A/chicken/Egypt/12186F-9/2012 (A/H5N1) segment 4 (HA) 2904.1 0.000000e+00 1660/1704 (97%)
EPI340098 A/duck/Egypt/11106SF/2011 (A/H5N1) segment 4 (HA) 2904.1 0.000000e+00 1661/1705 (97%)
EPI340093 A/chicken/Egypt/11124SF/2011 (A/H5N1) segment 4 (HA) 2904.1 0.000000e+00 1661/1705 (97%)
EPI338187 A/harrier/Israel/531/2011 (A/H5N1) segment 4 (HA) 2904.1 0.000000e+00 1660/1704 (97%)
EPI597824 A/chicken/Egypt/14126S/2014 (A/H5N1) segment 4 (HA) 2900.4 0.000000e+00 1664/1709 (97%)
EPI573314 A/chicken/Egypt/14148CA/2014 (A/H5N1) segment 4 (HA) 2900.4 0.000000e+00 1610/1630 (98%)
EPI348162 A/chicken/Egypt/11VIR4453-7/VRLCU/2010 (A/H5N1) segment 4 (HA) 2900.4 0.000000e+00 1656/1699 (97%)
EPI597826 A/chicken/Egypt/141VI/2014 (A/H5N1) segment 4 (HA) 2898.5 0.000000e+00 1661/1706 (97%)
EPI573333 A/chicken/Egypt/1427AF/2014 (A/H5N1) segment 4 (HA) 2898.5 0.000000e+00 1649/1689 (97%)
EPI550486 A/chicken/Egypt/14VIR784-5-1318S/2013 (A/H5N1) segment 4 (HA) 2898.5 0.000000e+00 1659/1704 (97%)
EPI538807 A/chicken/Egypt/13VIR-2962-200/2013 (A/H5N1) segment 4 (HA) 2898.5 0.000000e+00 1631/1662 (98%)
EPI538791 A/chicken/Egypt/13VIR-2962-198/2013 (A/H5N1) segment 4 (HA) 2898.5 0.000000e+00 1631/1662 (98%)
EPI372939 A/Egypt/N11126/2011 (A/H5N1) segment 4 (HA) 2898.5 0.000000e+00 1659/1704 (97%)
EPI369198 A/chicken/Egypt/12186F-12/2012 (A/H5N1) segment 4 (HA) 2898.5 0.000000e+00 1659/1704 (97%)
EPI348159 A/chicken/Egypt/11VIR4453-137/VRLCU/2011 (A/H5N1) segment 4 (HA) 2898.5 0.000000e+00 1649/1689 (97%)
EPI340150 A/duck/Egypt/10331SF/2010 (A/H5N1) segment 4 (HA) 2898.5 0.000000e+00 1659/1704 (97%)
EPI340081 A/chicken/Egypt/11529S/2011 (A/H5N1) segment 4 (HA) 2898.5 0.000000e+00 1659/1704 (97%)
EPI283815 A/duck/Egypt/106d/2010 (A/H5N1) segment 4 (HA) 2898.5 0.000000e+00 1657/1701 (97%)
EPI283782 A/chicken/Egypt/091317s/2009 (A/H5N1) segment 4 (HA) 2898.5 0.000000e+00 1659/1704 (97%)
EPI214881 A/chicken/Egypt/0920-NLQP/2009 (A/H5N1) segment 4 (HA) 2898.5 0.000000e+00 1659/1704 (97%)
EPI500113 A/duck/Egypt/Q4596A/2012 (A/H5N1) segment 4 (HA) 2893.0 0.000000e+00 1658/1704 (97%)
EPI340114 A/chicken/Egypt/117AF/2011 (A/H5N1) segment 4 (HA) 2893.0 0.000000e+00 1658/1704 (97%)
EPI340111 A/chicken/Egypt/119AF/2011 (A/H5N1) segment 4 (HA) 2893.0 0.000000e+00 1658/1704 (97%)
EPI340088 A/duck/Egypt/11175SF/2011 (A/H5N1) segment 4 (HA) 2893.0 0.000000e+00 1660/1706 (97%)
EPI283821 A/duck/Egypt/1063s/2010 (A/H5N1) segment 4 (HA) 2893.0 0.000000e+00 1656/1701 (97%)
EPI283789 A/chicken/Egypt/1029/2010 (A/H5N1) segment 4 (HA) 2893.0 0.000000e+00 1658/1704 (97%)
EPI255394 A/Egypt/N08835/2009 (A/H5N1) segment 4 (HA) 2893.0 0.000000e+00 1658/1704 (97%)
EPI255375 A/Egypt/N02770/2010 (A/H5N1) segment 4 (HA) 2893.0 0.000000e+00 1658/1704 (97%)
EPI184804 A/Egypt/N00585/2009 (A/H5N1) segment 4 (HA) 2893.0 0.000000e+00 1658/1704 (97%)
EPI597820 A/chicken/Egypt/1429AD/2014 (A/H5N1) segment 4 (HA) 2889.3 0.000000e+00 1661/1708 (97%)
EPI573334 A/chicken/Egypt/141/2014 (A/H5N1) segment 4 (HA) 2887.4 0.000000e+00 1642/1681 (97%)
EPI573324 A/duck/Egypt/1560S/2015 (A/H5N1) segment 4 (HA) 2887.4 0.000000e+00 1598/1615 (98%)
EPI573317 A/chicken/Egypt/1575S/2015 (A/H5N1) segment 4 (HA) 2887.4 0.000000e+00 1605/1626 (98%)
EPI504989 A/duck/Egypt/BSU-FA-1D/2012 (A/H5N1) segment 4 (HA) 2887.4 0.000000e+00 1657/1704 (97%)
EPI398585 A/chicken/Egypt/S3802D/2011 (A/H5N1) segment 4 (HA) 2887.4 0.000000e+00 1658/1705 (97%)
EPI398582 A/chicken/Egypt/S3806B/2011 (A/H5N1) segment 4 (HA) 2887.4 0.000000e+00 1658/1705 (97%)
EPI398579 A/chicken/Egypt/S3802B/2011 (A/H5N1) segment 4 (HA) 2887.4 0.000000e+00 1658/1705 (97%)
EPI398578 A/chicken/Egypt/S3806D/2011 (A/H5N1) segment 4 (HA) 2887.4 0.000000e+00 1658/1705 (97%)
EPI398573 A/chicken/Egypt/S3806A/2011 (A/H5N1) segment 4 (HA) 2887.4 0.000000e+00 1658/1705 (97%)

_________________
www.twitter.com/hniman


Top
 Profile  
 
Display posts from previous:  Sort by  
Post new topic Reply to topic  [ 3 posts ] 

All times are UTC - 5 hours [ DST ]


Who is online

Users browsing this forum: Yahoo [Bot] and 60 guests


You cannot post new topics in this forum
You cannot reply to topics in this forum
You cannot edit your posts in this forum
You cannot delete your posts in this forum
You cannot post attachments in this forum

Search for:
Jump to:  
cron
Powered by phpBB® Forum Software © phpBB Group