Rhiza Labs FluTracker Forum

The place to discuss the flu
It is currently Fri Sep 22, 2017 2:42 pm

All times are UTC - 5 hours [ DST ]




Post new topic Reply to topic  [ 13 posts ]  Go to page Previous  1, 2
Author Message
PostPosted: Fri Sep 04, 2015 2:25 pm 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
References
FuJ, AiJ, JinM, JiangC, ZhangJ, ShiC, et al. Emergence of a new GII.17 norovirus variant in patients with acute gastroenteritis in Jiangsu, China, September 2014 to March 2015. Euro Surveill. 2015;20(24):21157. DOI: 10.2807/1560-7917.ES2015.20.24.21157 PMID: 26111236

LuJ, SunL, FangL, YangF, MoY, LaoJ, et al. Gastroenteritis Outbreaks Caused by Norovirus GII.17, Guangdong Province, China, 2014-2015. Emerg Infect Dis. 2015;21(7):1240-2. DOI: 10.3201/eid2107.150226 PMID: 26080037

MatsushimaY, IshikawaM, ShimizuT, KomaneA, KasuoS, ShinoharaM, et al. Genetic analyses of GII.17 norovirus strains in diarrheal disease outbreaks from December 2014 to March 2015 in Japan reveal a novel polymerase sequence and amino acid substitutions in the capsid region. Euro Surveill. 2015;20(26):21173. DOI: 10.2807/1560-7917.ES2015.20.26.21173 PMID: 26159307

de GraafM, van BeekJ, VennemaH, PodkolzinAT, HewittJ, BucardoF, et al. Emergence of a novel GII.17 norovirus - End of the GII.4 era? Euro Surveill. 2015;20(26):21178. DOI: 10.2807/1560-7917.ES2015.20.26.21178 PMID: 26159308

ParraGI, GreenKY. Genome of Emerging Norovirus GII.17, United States, 2014.Emerg Infect Dis. 2015;21(8):1477-9. DOI: 10.3201/eid2108.150652 PMID: 26196235

Green KY. 2013. Caliciviridae: the noroviruses. In: Knipe, D.M., Howley, P.M. (Eds.), Fields virology, 6th ed. Wolters Kluwer Health/Lippincott Williams and Wilkins, Philadelphia, pp. 949-9.

KronemanA, VegaE, VennemaH, VinjéJ, WhitePA, HansmanG, et al. Proposal for a unified norovirus nomenclature and genotyping. Arch Virol. 2013;158(10):2059-68. DOI: 10.1007/s00705-013-1708-5 PMID: 23615870

Dutch Ministry of Health. Welfare and Sport. National Institute for Public Health and the Environment (RIVM). Norovirus Genotyping Tool Version 1.0. Bilthoven: RIVM. [Accessed 24 Aug 2015]. Available from: http://www.rivm.nl/mpf/norovirus/typingtool

WangQH, HanMG, CheethamS, SouzaM, FunkJA, SaifLJ. Porcine noroviruses related to human noroviruses.Emerg Infect Dis. 2005;11(12):1874-81. DOI: 10.3201/eid1112.050485 PMID: 16485473

VennemaH, de BruinE, KoopmansM. Rational optimization of generic primers used for Norwalk-like virus detection by reverse transcriptase polymerase chain reaction.J Clin Virol. 2002;25(2):233-5. DOI: 10.1016/S1386-6532(02)00126-9 PMID: 12367660

TamuraK, StecherG, PetersonD, FilipskiA, KumarS. MEGA6: Molecular Evolutionary Genetics Analysis version 6.0.Mol Biol Evol. 2013;30(12):2725-9. DOI: 10.1093/molbev/mst197 PMID: 24132122

Hoa TranTN, TrainorE, NakagomiT, CunliffeNA, NakagomiO. Molecular epidemiology of noroviruses associated with acute sporadic gastroenteritis in children: global distribution of genogroups, genotypes and GII.4 variants.J Clin Virol. 2013;56(3):269-77. DOI: 10.1016/j.jcv.2012.11.011 PMID: 23218993

SiebengaJJ, VennemaH, ZhengDP, VinjéJ, LeeBE, PangXL, et al. Norovirus illness is a global problem: emergence and spread of norovirus GII.4 variants, 2001-2007. J Infect Dis. 2009;200(5):802-12. DOI: 10.1086/605127 PMID: 19627248

BernsteinDI, AtmarRL, LyonGM, TreanorJJ, ChenWH, JiangX, et al. Norovirus vaccine against experimental human GII.4 virus illness: a challenge study in healthy adults. J Infect Dis. 2015;211(6):870-8. DOI: 10.1093/infdis/jiu497 PMID: 25210140

AyukekbongJA, FobisongC, TahF, LindhM, Nkuo-AkenjiT, BergströmT. Pattern of circulation of norovirus GII strains during natural infection.J Clin Microbiol. 2014;52(12):4253-9. DOI: 10.1128/JCM.01896-14 PMID: 25274996

MansJ, MurrayTY, TaylorMB. Novel norovirus recombinants detected in South Africa.Virol J. 2014;11(1):168. DOI: 10.1186/1743-422X-11-168 PMID: 25228444

RackoffLA, BokK, GreenKY, KapikianAZ. Epidemiology and evolution of rotaviruses and noroviruses from an archival WHO Global Study in Children (1976-79) with implications for vaccine design.PLoS ONE. 2013;8(3):e59394. DOI: 10.1371/journal.pone.0059394 PMID: 23536875

WangYH, ZhouDJ, ZhouX, YangT, GhoshS, PangBB, et al. Molecular epidemiology of noroviruses in children and adults with acute gastroenteritis in Wuhan, China, 2007-2010. Arch Virol. 2012;157(12):2417-24. DOI: 10.1007/s00705-012-1437-1 PMID: 22886184

VegaE, BarclayL, GregoricusN, ShirleySH, LeeD, VinjéJ. Genotypic and epidemiologic trends of norovirus outbreaks in the United States, 2009 to 2013.J Clin Microbiol. 2014;52(1):147-55. DOI: 10.1128/JCM.02680-13 PMID: 24172151

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Wed Sep 09, 2015 9:11 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
Norovirus Hu/GII.P17_GII.17/PR668/2015/ITA RNA-dependent RNA polymerase (ORF1) gene, partial cds; and major capsid protein (ORF2) and minor capsid protein (ORF3) genes, complete cds BLAST:

Select seq gb|KR083017.1| Norovirus Hu/GII.17/Gaithersburg/2014/US nonstructural polyprotein (ORF1) gene, partial cds; and major capsid protein VP1 (ORF2) and minor capsid protein VP2 (ORF3) genes, complete cds 5921 5921 100% 0.0 99% KR083017.1
Select seq gb|KP998539.1| Norovirus GII.17 isolate GII/Hu/HKG/2014/GII.17/CUHK-NS-463, complete genome 5875 5875 100% 0.0 99% KP998539.1
Select seq gb|KR020503.1| Norovirus Hu/GII.17/41621/Guangzhou/2014/CHN polyprotein gene, partial cds; and VP1 and VP2 genes, complete cds 5860 5860 100% 0.0 99% KR020503.1
Select seq dbj|LC037415.1| Norovirus Hu/GII/JP/2015/GII.P17_GII.17/Kawasaki308 genomic RNA, nearly complete genome 5836 5836 100% 0.0 99% LC037415.1
Select seq dbj|LC043168.1| Norovirus Hu/GII/JP/2013/GII.P17_GII.17/Saitama5309 genomic RNA, nearly complete genome 5489 5489 100% 0.0 97% LC043168.1
Select seq dbj|AB983218.1| Norovirus Hu/GII/JP/2014/GII.P17_GII.17/Kawasaki323 genomic RNA, nearly complete genome 5489 5489 100% 0.0 97% AB983218.1
Select seq dbj|LC043167.1| Norovirus Hu/GII/JP/2013/GII.P17_GII.17/Saitama5203 genomic RNA, nearly complete genome 5476 5476 100% 0.0 97% LC043167.1
Select seq dbj|LC043139.1| Norovirus Hu/GII/JP/2014/GII.P17_GII.17/Nagano7-1 POL, VP1, VP2 genes for nonstructural polyprotein, capsid protein VP1, capsid protein VP2, complete and partial cds 5472 5472 100% 0.0 97% LC043139.1
Select seq dbj|LC043305.1| Norovirus Hu/GII/JP/2014/GII.P17_GII.17/Nagano8-1 POL, VP1, VP2 genes for nonstructural polyprotein, capsid protein VP1, capsid protein VP2, complete and partial cds 5467 5467 100% 0.0 97% LC043305.1
Select seq gb|KJ156329.1| Norovirus 13-BH-1/2013/GII.17 nonstructural protein gene, partial cds; and capsid protein and minor structural protein genes, complete cds 5457 5457 99% 0.0 97% KJ156329.1
Select seq gb|KP698930.1| Norovirus GII.17 isolate GII/Hu/HKG/2015/GII.17/CUHK-NS-511 viral protein 1 (VP1) gene, complete cds 2959 2959 49% 0.0 99% KP698930.1
Select seq gb|KP698928.1| Norovirus GII.17 isolate GII/Hu/HKG/2014/GII.17/CUHK-NS-491 viral protein 1 (VP1) gene, complete cds 2953 2953 49% 0.0 99% KP698928.1
Select seq gb|KP698929.1| Norovirus GII.17 isolate GII/Hu/HKG/2014/GII.17/CUHK-NS-494 viral protein 1 (VP1) gene, complete cds 2948 2948 49% 0.0 99% KP698929.1
Select seq gb|KP698931.1| Norovirus GII.17 isolate GII/Hu/HKG/2015/GII.17/CUHK-NS-513 viral protein 1 (VP1) gene, complete cds 2942 2942 49% 0.0 99% KP698931.1
Select seq gb|KR858308.1| Norovirus GII.17 isolate Hu/Norovirus/GII.17/Shunyi-18/Beijing/CHN/2015 caspid protein VP1 gene, partial cds 2700 2700 45% 0.0 99% KR858308.1
Select seq gb|KP676383.1| Norovirus Hu/GII/CN/2013/GII.P17_GII.17/Nanjing010141 RNA-dependent RNA polymerase and capsid protein genes, partial cds 1923 1923 33% 0.0 98% KP676383.1
Select seq gb|KC597139.1| Norovirus Hu/GII.17/C142/1978/GUF, partial genome 1727 1727 85% 0.0 78% KC597139.1
Select seq gb|KJ196286.1| Norovirus GII/Hu/JP/2002/GII.P16_GII.17/Saitama/T87, complete genome 1644 1883 92% 0.0 77% KJ196286.1
Select seq gb|EU921354.2| Norovirus Hu/Pune/PC25/2006/India strain PC25 RNA-dependent RNA polymerase gene, partial cds; and capsid protein gene, complete cds 1548 1548 49% 0.0 84% EU921354.2
Select seq gb|EF529741.1| Norovirus Hu/Briancon870/2004/France RNA-dependent RNA polymerase and capsid protein genes, partial cds 1548 1548 41% 0.0 87% EF529741.1
Select seq gb|DQ438972.1| Norovirus genogroup 2 strain Hu/NoV/Katrina-17/2005/US VP1 and VP2 genes, complete cds 1454 1454 73% 0.0 78% DQ438972.1
Select seq dbj|AB809975.1| Norovirus Hu/GII.13/09N3120/2009/NP genes for RNA-dependent RNA polymerase, major capsid protein VP1, partial cds 1430 1430 46% 0.0 84% AB809975.1
Select seq dbj|AB809976.1| Norovirus Hu/GII.13/09N3145/2009/NP genes for RNA-dependent RNA polymerase, major capsid protein VP1, partial and complete cds 1386 1386 45% 0.0 84% AB809976.1
Select seq gb|KJ194504.1| Norovirus Hu/GII/Amsterdam/1994 isolate NV_Amsterdam_1994, partial genome 1363 1363 47% 0.0 83% KJ194504.1
Select seq gb|KJ194500.1| Norovirus Hu/GII/Amsterdam/1/1995 isolate NV_Amsterdam_1_1995, partial genome 1363 1363 47% 0.0 83% KJ194500.1
Select seq dbj|AB039782.1| Norwalk-like virus genomic RNA, complete genome, isolate:Saitama U201 1363 1363 46% 0.0 83% AB039782.1
Select seq dbj|AB039781.1| Norwalk-like virus genomic RNA, complete genome, isolate:Saitama U18 1347 1347 46% 0.0 83% AB039781.1
Select seq gb|AF315812.1|AF315812 Norwalk virus (Hu/NLV/OC98008/1998/JP) capsid protein and polymerase genes, partial cds 1343 1343 37% 0.0 86% AF315812.1
Select seq gb|U02030.1| Minireovirus TV24 polymerase gene, partial cds; capsid protein gene, complete cds; and unknown gene 1341 1341 47% 0.0 82% U02030.1
Select seq gb|L23830.1|NOR89JD Norwalk virus (SRSV-OTH-25/89/J) RNA polymerase mRNA, 3'end and capsid protein mRNA, 5' end 1325 1325 49% 0.0 81% L23830.1
Select seq dbj|AB809979.1| Norovirus Hu/GII.13/09N3223/2009/NP genes for RNA-dependent RNA polymerase, major capsid protein VP1, partial and complete cds 1319 1319 43% 0.0 83% AB809979.1
Select seq gb|JQ751044.1| Norovirus Hu/GII.17/Wuhan/Z776/CHN/2007 RNA-dependent RNA polymerase and capsid protein genes, partial cds 1303 1303 33% 0.0 88% JQ751044.1
Select seq gb|U22498.1|HCU22498 Human calicivirus strain MX polymerase gene, partial cds, and capsid protein gene, complete cds 1280 1280 47% 0.0 82% U22498.1
Select seq gb|EF529742.1| Norovirus Hu/Sommieres1203/2006/France RNA-dependent RNA polymerase and capsid protein genes, partial cds 1269 1269 32% 0.0 89% EF529742.1
Select seq dbj|AB447409.1| Norovirus Hu/V1668/06/IND RdRp, VP1 genes for RNA dependent RNA polymerase, capsid protein, partial cds 1242 1242 31% 0.0 88% AB447409.1
Select seq gb|FJ595900.1| Norovirus Hu/GII.4/Seoul/0205/2007/KOR RNA-dependent RNA polymerase and capsid protein genes, partial cds 1221 1221 32% 0.0 87% FJ595900.1
Select seq gb|JF802507.1| Norovirus Hu/GII.17/C15b/Bonaberi/Cameroon RNA-dependent RNA polymerase and capsid protein genes, partial cds 1219 1219 30% 0.0 88% JF802507.1
Select seq gb|AY502009.1| Norovirus genogroup 2 strain Hu/NoV/CS-E1/2002/USA nonstructural polyprotein gene, partial cds; capsid protein gene, complete cds; and minor structural protein gene, partial cds 1212 1212 60% 0.0 78% AY502009.1
Select seq gb|FJ383845.1| Norovirus Hu/GII/2005/8093/Chelyabinsk/RUS RNA-dependent RNA polymerase and capsid genes, partial cds 1195 1195 30% 0.0 89% FJ383845.1
Select seq gb|FJ383875.1| Norovirus Hu/GII/2005/6336/Moscow/RUS RNA-dependent RNA polymerase and capsid genes, partial cds 1146 1146 30% 0.0 88% FJ383875.1
Select seq gb|KM036380.1| Norovirus Hu/GII.P16/GII.13/New/Taipei/13-BA-1/2013/TW nonstructural protein gene, partial cds; and major capsid protein and minor structural protein genes, complete cds 1138 1138 50% 0.0 79% KM036380.1
Select seq gb|KC832473.1| Norovirus Hu/GII/Luckenwalde1378/2012/DE RNA dependend RNA polymerase and capsid protein genes, partial cds 1103 1103 49% 0.0 79% KC832473.1
Select seq gb|KC832472.1| Norovirus Hu/GII/Berlin1195/2012/DE RNA dependend RNA polymerase and capsid protein genes, partial cds 1103 1103 49% 0.0 79% KC832472.1
Select seq gb|KC832471.1| Norovirus Hu/GII/Oranienburg1190/2012/DE RNA dependend RNA polymerase and capsid protein genes, partial cds 1103 1103 49% 0.0 79% KC832471.1
Select seq gb|DQ379713.1| Norovirus Hu/GII/Goulburn Valley G5175 A/1983/AUS nonstructural polyprotein (ORF1) gene, partial cds; and capsid (ORF2) and basic protein (ORF3) genes, complete cds 1103 1103 45% 0.0 80% DQ379713.1
Select seq gb|KC832470.1| Norovirus Hu/GII/Berlin1162/2012/DE RNA dependend RNA polymerase and capsid protein genes, partial cds 1098 1098 49% 0.0 79% KC832470.1
Select seq gb|JN176920.1| Norovirus Hu/GII.3/Maastricht021/2006/NL polymerase gene, partial cds 1098 1098 25% 0.0 91% JN176920.1
Select seq dbj|AB591831.1| Norovirus Hu/GII/IDH883/2008/IND genes for RNA-dependent RNA polymerase, capsid protein, partial cds 1092 1092 27% 0.0 89% AB591831.1
Select seq gb|EU019230.2| Norovirus Hu/Ahm/PC03/2006/India RNA-dependent RNA polymerase gene, partial cds; and capsid protein gene, complete cds 1083 1083 47% 0.0 79% EU019230.2
Select seq gb|AF414415.1|AF414415 Norwalk-like virus NLV/Brattleboro/321/1995/US RNA polymerase (orf1) gene, partial cds; and capsid protein (orf2) and minor structural protein (orf3) genes, complete cds 1070 1070 40% 0.0 81% AF414415.1
Select seq gb|AF414411.1|AF414411 Norwalk-like virus NLV/Lionville/247/1993/US RNA polymerase (orf1) gene, partial cds; and capsid protein (orf2) and minor structural protein (orf3) genes, complete cds 1070 1070 42% 0.0 81% AF414411.1
Select seq gb|AF414413.1|AF414413 Norwalk-like virus NLV/Montgomery/312/1994/US RNA polymerase (orf1) gene, partial cds; and capsid protein (orf2) and minor structural protein (orf3) genes, complete cds 1064 1064 40% 0.0 81% AF414413.1
Select seq gb|AF414414.1|AF414414 Norwalk-like virus NLV/Towson/313/1994/US RNA polymerase (orf1) gene, partial cds; and capsid protein (orf2) and minor structural protein (orf3) genes, complete cds 1059 1059 39% 0.0 81% AF414414.1
Select seq dbj|AB809973.1| Norovirus Hu/GII.13/08N2045/2008/NP genes for RNA-dependent RNA polymerase, major capsid protein VP1, partial and complete cds 1044 1044 46% 0.0 79% AB809973.1
Select seq gb|KJ196284.1| Norovirus GII/Hu/JP/2007/GII.P21_GII.21/Kawasaki/YO284, complete genome 1044 1044 47% 0.0 79% KJ196284.1
Select seq gb|AF414412.1|AF414412 Norwalk-like virus NLV/New Orleans/279/1994/US RNA polymerase (orf1) gene, partial cds; and capsid protein (orf2) and minor structural protein (orf3) genes, complete cds 1044 1044 30% 0.0 86% AF414412.1
Select seq dbj|AB809998.1| Norovirus Hu/GII.13/09N3816/2009/NP genes for RNA-dependent RNA polymerase, major capsid protein VP1, partial cds 1042 1042 46% 0.0 79% AB809998.1
Select seq gb|JN899245.1| Norovirus Hu/GII.21/Salisbury150/2011/USA RNA-dependent RNA polymerase gene, partial cds; and major capsid protein and minor capsid protein genes, complete cds 1042 1042 49% 0.0 78% JN899245.1
Select seq dbj|AB592958.1| Norovirus Hu/GII/IDH1390/2009/IND genes for RNA-dependent RNA polymerase, capsid protein, partial cds 1042 1042 26% 0.0 88% AB592958.1
Select seq gb|DQ379714.1| Norovirus Hu/GII/Goulburn Valley G5175 B/1983/AUS nonstructural polyprotein (ORF1) gene, partial cds; and capsid (ORF2) and basic protein (ORF3) genes, complete cds 1037 1037 50% 0.0 78% DQ379714.1
Select seq dbj|AB809974.1| Norovirus Hu/GII.13/08N2250/2008/NP genes for RNA-dependent RNA polymerase, major capsid protein VP1, partial and complete cds 1035 1035 45% 0.0 79% AB809974.1
Select seq dbj|AB810005.1| Norovirus Hu/GII.13/10N4439/2010/NP genes for RNA-dependent RNA polymerase, major capsid protein VP1, partial cds 1033 1033 46% 0.0 79% AB810005.1
Select seq dbj|AB810004.1| Norovirus Hu/GII.13/10N4358/2010/NP genes for RNA-dependent RNA polymerase, major capsid protein VP1, partial cds 1033 1033 46% 0.0 79% AB810004.1
Select seq gb|KJ196276.1| Norovirus GII/Hu/JP/2002/GII.P12_GII.13/Saitama/T80, complete genome 1033 1033 50% 0.0 78% KJ196276.1
Select seq dbj|AB542916.1| Norovirus Hu/OC06060/2006/JP genes for RNA polymerase, capsid protein VP1, partial and complete cds 1027 1027 46% 0.0 79% AB542916.1
Select seq dbj|AB809993.1| Norovirus Hu/GII.13/09N3751/2009/NP genes for RNA-dependent RNA polymerase, major capsid protein VP1, partial cds 1026 1026 46% 0.0 79% AB809993.1
Select seq gb|JF802506.1| Norovirus Hu/GII.17/C38/Bonaberi/2009/Cameroon RNA-dependent RNA polymerase and capsid protein genes, partial cds 1026 1026 25% 0.0 89% JF802506.1
Select seq gb|JF802505.1| Norovirus Hu/GII.17/A113/Limbe/2009/Cameroon RNA-dependent RNA polymerase and capsid protein genes, partial cds 1026 1026 25% 0.0 89% JF802505.1
Select seq gb|GQ266697.1| Norovirus Hu/Zuerich/P7d384/2009 capsid protein gene, partial cds 1024 1024 48% 0.0 78% GQ266697.1
Select seq dbj|AB809997.1| Norovirus Hu/GII.13/09N3798/2009/NP genes for RNA-dependent RNA polymerase, major capsid protein VP1, partial cds 1020 1020 46% 0.0 79% AB809997.1
Select seq dbj|AB809990.1| Norovirus Hu/GII.13/09N3688/2009/NP genes for RNA-dependent RNA polymerase, major capsid protein VP1, partial cds 1020 1020 46% 0.0 79% AB809990.1
Select seq dbj|AB810001.1| Norovirus Hu/GII.13/10N3922/2010/NP genes for RNA-dependent RNA polymerase, major capsid protein VP1, partial cds 1014 1014 46% 0.0 79% AB810001.1
Select seq dbj|AB810006.1| Norovirus Hu/GII.13/10N4441/2010/NP genes for RNA-dependent RNA polymerase, major capsid protein VP1, partial cds 1005 1005 45% 0.0 79% AB810006.1
Select seq gb|KC662537.1| Norovirus Hu/GII/Hy-718/KOR, complete genome 1005 1005 50% 0.0 78% KC662537.1
Select seq dbj|AB809994.1| Norovirus Hu/GII.13/09N3758/2009/NP genes for RNA-dependent RNA polymerase, major capsid protein VP1, partial cds 1003 1003 45% 0.0 79% AB809994.1
Select seq dbj|AB809992.1| Norovirus Hu/GII.13/09N3721/2009/NP genes for RNA-dependent RNA polymerase, major capsid protein VP1, partial cds 1003 1003 45% 0.0 79% AB809992.1
Select seq dbj|AB809985.1| Norovirus Hu/GII.13/09N3564/2009/NP genes for RNA-dependent RNA polymerase, major capsid protein VP1, partial cds 1003 1003 44% 0.0 79% AB809985.1
Select seq dbj|AB810007.1| Norovirus Hu/GII.13/10N4487/2010/NP genes for RNA-dependent RNA polymerase, major capsid protein VP1, partial cds 1000 1000 45% 0.0 79% AB810007.1
Select seq dbj|AB809977.1| Norovirus Hu/GII.13/09N3180/2009/NP genes for RNA-dependent RNA polymerase, major capsid protein VP1, partial cds 998 998 45% 0.0 79% AB809977.1
Select seq dbj|AB809978.1| Norovirus Hu/GII.13/09N3206/2009/NP genes for RNA-dependent RNA polymerase, major capsid protein VP1, partial and complete cds 996 996 44% 0.0 79% AB809978.1
Select seq gb|GQ856468.1| Norovirus Hu/GII.4/Beijing/55185/2008/CHN RNA-dependent RNA polymerase gene, partial cds; and capsid and minor structural protein genes, complete cds 996 996 46% 0.0 79% GQ856468.1
Select seq dbj|AB810014.1| Norovirus Hu/GII.13/10N4598/2010/NP genes for RNA-dependent RNA polymerase, major capsid protein VP1, partial cds 992 992 45% 0.0 79% AB810014.1
Select seq dbj|AB809987.1| Norovirus Hu/GII.13/09N3617/2009/NP genes for RNA-dependent RNA polymerase, major capsid protein VP1, partial cds 987 987 44% 0.0 79% AB809987.1
Select seq dbj|AB809986.1| Norovirus Hu/GII.13/09N3609/2009/NP genes for RNA-dependent RNA polymerase, major capsid protein VP1, partial cds 987 987 44% 0.0 79% AB809986.1
Select seq gb|KC464499.1| Norovirus Hu/GII.12/CGMH41/2010/TW, complete genome 987 987 45% 0.0 79% KC464499.1
Select seq gb|KC464497.1| Norovirus Hu/GII.12/CGMH39/2010/TW, complete genome 987 987 45% 0.0 79% KC464497.1
Select seq dbj|AB112326.1| Human norovirus Saitama gene for RNA dependent RNA polymerase, capsid protein, partial cds, strain: NV/Saitama T45aGII/01/JP 985 985 25% 0.0 88% AB112326.1
Select seq dbj|AB809989.1| Norovirus Hu/GII.13/09N3683/2009/NP genes for RNA-dependent RNA polymerase, major capsid protein VP1, partial cds 981 981 44% 0.0 79% AB809989.1
Select seq gb|JQ613568.1| Norovirus Hu/GII.g-GII.12/Wahroonga/NSW004P/2009/AU, complete genome 981 981 45% 0.0 79% JQ613568.1
Select seq gb|HQ664990.1| Norovirus Hu/GII.12/HS206/2010/USA, complete genome 981 981 45% 0.0 79% HQ664990.1
Select seq dbj|AB809996.1| Norovirus Hu/GII.13/09N3796/2009/NP genes for RNA-dependent RNA polymerase, major capsid protein VP1, partial cds 977 977 44% 0.0 79% AB809996.1
Select seq gb|KJ145322.1| Norovirus 13-BA-1/2013/GII.P16/GII.13 nonstructural protein gene, complete cds; and capsid protein gene, partial cds 977 977 39% 0.0 80% KJ145322.1
Select seq dbj|AB809995.1| Norovirus Hu/GII.13/09N3779/2009/NP genes for RNA-dependent RNA polymerase, major capsid protein VP1, partial cds 976 976 43% 0.0 79% AB809995.1
Select seq gb|KM198492.1| Norovirus Hu/GII/30448/2010/VNM nonstructural polyprotein and capsid protein VP1 genes, complete cds; and capsid protein VP2 gene, partial cds 976 976 45% 0.0 79% KM198492.1
Select seq gb|KC464500.1| Norovirus Hu/GII.12/CGMH42/2010/TW, complete genome 976 976 45% 0.0 79% KC464500.1
Select seq gb|KC464498.1| Norovirus Hu/GII.12/CGMH40/2010/TW, complete genome 976 976 45% 0.0 79% KC464498.1
Select seq emb|X81879.1| Human calicivirus strain Melksham cDNA for orf1, orf2 and orf3 972 972 50% 0.0 77% X81879.1
Select seq dbj|AB809988.1| Norovirus Hu/GII.13/09N3645/2009/NP genes for RNA-dependent RNA polymerase, major capsid protein VP1, partial cds 970 970 44% 0.0 79% AB809988.1
Select seq gb|HQ449728.1| Norovirus Hu/GII.12/HS210/2010/USA, complete genome 970 970 45% 0.0 79% HQ449728.1
Select seq gb|AY772730.1| Norovirus Hu/NLV/GII/Neustrelitz260/2000/DE from Germany, complete genome 970 970 45% 0.0 79% AY772730.1

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Wed Sep 09, 2015 2:51 pm 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
LOCUS KT346356 3266 bp RNA linear VRL 08-SEP-2015
DEFINITION Norovirus Hu/GII.P17_GII.17/PR668/2015/ITA RNA-dependent RNA
polymerase (ORF1) gene, partial cds; and major capsid protein
(ORF2) and minor capsid protein (ORF3) genes, complete cds.
ACCESSION KT346356
VERSION KT346356.1 GI:925717767
KEYWORDS .
SOURCE Norovirus Hu/GII.P17_GII.17/PR668/2015/ITA
ORGANISM Norovirus Hu/GII.P17_GII.17/PR668/2015/ITA
Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA
stage; Caliciviridae; Norovirus.
REFERENCE 1 (bases 1 to 3266)
AUTHORS Medici,M.C., Tummolo,F. and Martella,V.
TITLE Genomic analysis of the emerging GII.17 human norovirus, Italy,
2015
JOURNAL Unpublished
REFERENCE 2 (bases 1 to 3266)
AUTHORS Medici,M.C., Tummolo,F. and Martella,V.
TITLE Direct Submission
JOURNAL Submitted (27-JUL-2015) Unit of Microbiology and Virology,
Departement of Clinical and Experimental Medicine, University of
Parma, Viale A. Gramsci, 14, Parma, Parma 43126, Italy
COMMENT ##Assembly-Data-START##
Sequencing Technology :: Sanger dideoxy sequencing
##Assembly-Data-END##
FEATURES Location/Qualifiers
source 1..3266
/organism="Norovirus Hu/GII.P17_GII.17/PR668/2015/ITA"
/mol_type="genomic RNA"
/strain="PR668/2015/ITA"
/isolation_source="stools"
/host="Homo sapiens"
/db_xref="taxon:1711929"
/country="Italy"
/collection_date="2015"
/collected_by="Medici MC"
/note="genotype: GII.P17_GII.17"
gene <1..822
/gene="ORF1"
CDS <1..822
/gene="ORF1"
/codon_start=1
/product="RNA-dependent RNA polymerase"
/protein_id="ALD09617.1"
/db_xref="GI:925717768"
/translation="HYDADYSRWDSTQQRAVLEAALEIMVRFSAEPQLAQIVAEDLLS
PSVVDVGDFKIAINEGLPSGVPCTSQWNSIAHWLLTLCALSEVTGLGPDIIQANSMYS
FYGDDEIVSTDIKLDPEKLTAKLKEYGLKPTRPDKTEGPLVISEDLNGLTFLRRTVTR
DPAGWFGKLDQNSILRQLYWTRGPNHEDPSETMIPHAQRPVQLMALLGESSLHGPSFY
SKVSKLVISELKEGGMDFYVPRQESMFRWMRFSDLSTWEGDRNLAPSFVNEDGVE"
gene 803..2425
/gene="ORF2"
CDS 803..2425
/gene="ORF2"
/codon_start=1
/product="major capsid protein"
/protein_id="ALD09618.1"
/db_xref="GI:925717769"
/translation="MKMASNDAAPSNDGAAGLVPEGNNETLPLEPVAGAAIAAPVTGQ
NNIIDPWIRTNFVQAPNGEFTVSPRNSPGEILLNLELGPDLNPYLAHLSRMYNGYAGG
VEVQVLLAGNAFTAGKILFAAVPPNFPVEFLSPAQITMLPHLIVDVRTLEPIMIPLPD
ARNTFFHYSNQPNSRMRLVAMLYTPLRSNGSGDDVFTVSCRVLTRPTPDFEFTYLVPP
SVESKTKPFSLPILTLSELTNSRFPVPIDSLFTAQNNVLQVQCQNGRCTLDGELQGTT
QLLPSGICAFRGRVTAQINQRDRWHMQLQNLNGTTYDPTDDVPAPLGTPDFKGVVFGM
VSQRNVGNDAPGSTRAQQAWVSTYSPQFVPKLGSVNLRISDNDDFQFQPTKFTPVGVN
DDDDGHPFRQWELPNYSGELTLNMNLAPPVAPNFPGEQLLFFRSFVPCSGGYNQGIID
CLIPQEWIQHFYQESAPSQSDVALIRYVNPDTGRTLFEAKLHRSGYITVAHSGDYPLV
VPANGHFRFDSWVNQFYSLAPMGTGNGRRRAQ"
gene 2425..3204
/gene="ORF3"
CDS 2425..3204
/gene="ORF3"
/codon_start=1
/product="minor capsid protein"
/protein_id="ALD09619.1"
/db_xref="GI:925717770"
/translation="MAGAFIAGLAGDMLTSSVGSLVNAGANAINQKIDFENNKQLQSA
SFQHDKEMLQAQVKATKQLQSEMIALKQGVLAAGGFSPTDAARGAIGAPMTKVLDWSG
TRYWAPNSTKTTGYSGQFTSSPVHMSSPNASQSKPVKPRSLAPSSSSSSVYSTYTQST
HLISGSSSNASSASTKLTNLSSGSSQNRTAEWVNQQRSLSPFMSGALNISHVTPPSSR
ASSSGTVSTVPKEVLDSWTSAFNTHRQPLFAHLRVRGESRV"
ORIGIN
1 cactatgatg cagactactc ccgctgggac tccacacagc agcgggcagt gctggaagcg
61 gcacttgaaa tcatggtgag attttctgct gagccacagc tggcacaaat agtggcagag
121 gacctgctgt caccaagtgt ggttgatgtg ggcgatttca aaatcgctat caatgaaggc
181 ctaccatctg gcgtgccttg cacctcacaa tggaattcta ttgcccactg gttacttacc
241 ttgtgtgccc tttctgaagt gacaggatta ggtcctgaca tcatacaagc taactccatg
301 tactctttct atggtgatga tgagattgtg agcacagaca taaaattgga cccagagaaa
361 ttgaccgcaa agctcaaaga atatggcctt aaacccactc ggcccgacaa aactgagggg
421 ccgttggtga ttagtgaaga cctgaatggg ttgactttcc tccgccgaac agtcacccgt
481 gatccagcag gttggtttgg aaagttggac caaaactcca tcctcaggca gttgtactgg
541 acaagaggac ccaaccatga agaccccagt gagaccatga taccacacgc acaaagacct
601 gtgcagctca tggcactact aggagaatcc tccctacatg gaccctcatt ttacagcaag
661 gttagcaaat tagtcatatc tgaacttaaa gagggaggaa tggattttta tgtgcccaga
721 caagagtcaa tgttcagatg gatgaggttc tcagatctaa gcacatggga gggcgatcgc
781 aatctggctc ccagttttgt gaatgaagat ggcgtcgaat gacgccgctc catctaatga
841 tggtgctgct ggtctcgtac cagagggcaa caacgagacc cttcccctag aaccagttgc
901 gggcgcagct atagccgcac ccgtcactgg ccaaaataac ataattgacc cctggattag
961 aacaaatttt gtgcaagcac caaatggaga gttcacagtg tcacccagaa actctcctgg
1021 agaaatttta ttaaacttag agttgggccc tgatttgaac ccttatttgg ctcatttgtc
1081 aaggatgtac aatgggtatg ctggtggagt ggaagttcag gttctcctgg cagggaacgc
1141 gttcactgcc ggaaagatcc tcttcgccgc cgtcccgcca aatttcccag tggaattctt
1201 aagcccagcc cagatcacaa tgctccctca tttaatagta gatgttagga ctcttgaacc
1261 aattatgatc ccactccctg atgctaggaa tacattcttc cattatagta accagcctaa
1321 cagccgcatg agattagtgg ctatgctcta caccccactc agatctaatg gctcaggtga
1381 tgatgtcttt actgtctctt gcagggtttt gactaggcct actcctgatt ttgagttcac
1441 ttatttagtg ccaccttctg ttgaatctaa aactaagcct ttttctttac ctattttaac
1501 cctttctgag ctcacaaatt cgaggttccc agtccccatc gattcgcttt tcaccgccca
1561 gaataatgtg ttgcaggtgc agtgtcaaaa tggcaggtgt acacttgatg gtgagttaca
1621 aggcacaacc cagttgctcc catctggcat ctgtgcattc agaggacggg tgacagcaca
1681 aattaaccaa cgtgacaggt ggcacatgca actgcaaaac ctcaatggta caacatatga
1741 cccaactgat gatgtgccag ccccgctggg tacacctgac ttcaagggcg tcgtgtttgg
1801 gatggtaagc caaagaaatg tgggtaatga tgcgcctggc tcaaccagag cccaacaggc
1861 gtgggtttca acctatagcc cccaatttgt ccccaaatta ggttctgtca atcttagaat
1921 tagtgataat gatgatttcc aattccagcc gacaaaattc acaccagtgg gcgtcaatga
1981 tgacgatgat ggccacccgt tcagacaatg ggaattacca aactattcag gggagcttac
2041 cttgaatatg aatcttgccc ccccagttgc tccaaatttt cctggtgaac aattgttatt
2101 cttcagatct ttcgtgccat gctcaggagg ttacaaccaa ggtattatag attgtcttat
2161 tccccaagaa tggatccaac acttctatca ggaatcagca ccctcccagt cagacgtggc
2221 cctaatcagg tatgtcaacc ctgatacggg acgtacactg tttgaagcaa aattgcacag
2281 atctggttac attactgtgg ctcactctgg agactatcct cttgttgttc cggctaatgg
2341 acactttaga tttgattctt gggtaaatca gttttactca ctcgccccaa tgggaactgg
2401 gaatgggcga aggagggctc agtaatggct ggggctttca ttgcaggatt ggcaggcgac
2461 atgctcacgt catctgtggg ctcccttgtg aacgcagggg caaacgccat caaccaaaag
2521 atagactttg aaaacaacaa acaactccag tctgcttcct ttcagcatga taaagagatg
2581 ctccaagcgc aggtgaaggc aaccaagcag ctgcaatctg aaatgatagc cctaaaacag
2641 ggggttttgg ccgcaggcgg cttttccccc actgatgcag caaggggagc cattggtgca
2701 cccatgacaa aggtgcttga ctggtctggc actcgatact gggcgcccaa ctccacaaag
2761 acaactggtt attcgggaca attcacctct tcacctgtgc acatgtctag cccaaatgct
2821 tcacaatcaa aacctgtaaa gcctaggtct ctagcccctt cctcttcttc tagcagtgtc
2881 tatagtacgt acactcaatc tactcattta atatctggct cttctagtaa tgcttcttct
2941 gcctctacaa aattgacaaa tttaagctct ggctcctctc aaaacagaac agcagagtgg
3001 gtaaatcaac agagaagtct tagccctttc atgagtggcg cacttaacat ctcacatgtc
3061 acgccaccct caagtagggc ttccagttct gggacggtct cgaccgtgcc caaggaagtt
3121 ttggactcct ggacgtctgc gtttaacaca cacagacaac cgctcttcgc acacctcaga
3181 gtgagggggg agtcacgtgt ttagtgaaaa gaaataattg gctataatgt gatttctttc
3241 taaaatttgg ctaatttgag tctttt

_________________
www.twitter.com/hniman


Top
 Profile  
 
Display posts from previous:  Sort by  
Post new topic Reply to topic  [ 13 posts ]  Go to page Previous  1, 2

All times are UTC - 5 hours [ DST ]


Who is online

Users browsing this forum: Yahoo [Bot] and 61 guests


You cannot post new topics in this forum
You cannot reply to topics in this forum
You cannot edit your posts in this forum
You cannot delete your posts in this forum
You cannot post attachments in this forum

Search for:
Jump to:  
cron
Powered by phpBB® Forum Software © phpBB Group