Rhiza Labs FluTracker Forum

The place to discuss the flu
It is currently Fri Sep 22, 2017 2:51 pm

All times are UTC - 5 hours [ DST ]




Post new topic Reply to topic  [ 6 posts ] 
Author Message
PostPosted: Wed Sep 02, 2015 1:12 pm 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
2015 Iowa Swine Matches Human H1N1v Case

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Wed Sep 02, 2015 1:13 pm 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
LOCUS KT164865 1701 bp cRNA linear VRL 11-JUL-2015
DEFINITION Influenza A virus (A/swine/Iowa/A02077588/2015(H1N1)) segment 4
hemagglutinin (HA) gene, complete cds.
ACCESSION KT164865
VERSION KT164865.1 GI:868890040
KEYWORDS .
SOURCE Influenza A virus (A/swine/Iowa/A02077588/2015(H1N1))
ORGANISM Influenza A virus (A/swine/Iowa/A02077588/2015(H1N1))
Viruses; ssRNA viruses; ssRNA negative-strand viruses;
Orthomyxoviridae; Influenzavirus A.
REFERENCE 1 (bases 1 to 1701)
AUTHORS Lin,K., Olson,W.J. and Zhang,J.
CONSRTM USDA SIV Survelliance
TITLE Direct Submission
JOURNAL Submitted (17-JUN-2015) National Veterinary Services Laboratory,
USDA, 1920 Dayton, Ames, IA 50010, USA
FEATURES Location/Qualifiers
source 1..1701
/organism="Influenza A virus
(A/swine/Iowa/A02077588/2015(H1N1))"
/mol_type="viral cRNA"
/strain="A/swine/Iowa/A02077588/2015"
/serotype="H1N1"
/isolation_source="lung"
/host="swine"
/db_xref="taxon:1671415"
/segment="4"
/country="USA: Iowa"
/collection_date="13-May-2015"
gene 1..1701
/gene="HA"
CDS 1..1701
/gene="HA"
/function="receptor binding and fusion protein"
/codon_start=1
/product="hemagglutinin"
/protein_id="AKP04476.1"
/db_xref="GI:868890041"
/translation="MKAILVVLLYTFTTANADTLCIGYHANNSTDTVDTVLEKNVTVT
HSVNLLENRHNGKLCKLRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETSNS
ENGTCYPGDFINYEELREQLSSVSSFERFEIFPKTSSWPNHDTNKGVTAACPHAGTNS
FYRNLVWLVQKGNSYPKINKSYINNKENEVLVLWAIHHPSTSADQQSLYKNADAYVFV
GSSRYSRKFEPEIATRPKVRDQAGRMNYYWTLVEPGDKITFEATGNLVAPRYAFTLKR
NSGSGIIISDTSVHDCDTTCQTPNGAINTSLPFQNIHPVTIGECPKYVKSTKLRMATG
LRNIPSIQSRGLFGAIAGFIEGGWTGMIDGWYGYHHQNEQGSGYAADLKSTQNAIDGI
TNKVNSVIEKMNTQFTAVGKEFSHLERRIENLNKKVDDGFLDIWTYNAELLVLLENER
TLDYHDSNVKNLYEKVRSQLKNNAKEIGNGCFEFYHKCDDMCMESVKNGTYDYPKYSE
EAKLNREEIDGVKLESTRIYQILAIYSTVASSLVLVVSLGAISFWMCSNGSLQCRICI
"
sig_peptide 1..51
/gene="HA"
mat_peptide 52..1032
/gene="HA"
/product="HA1"
mat_peptide 1033..1698
/gene="HA"
/product="HA2"
misc_feature 1..1701
/db_xref="IRD:IRD-A02077588.4"
ORIGIN
1 atgaaggcaa tactagtagt cctgctatat acatttacaa ccgcaaatgc cgacacatta
61 tgtataggtt atcatgcaaa caattcaact gacaccgtag acacagtact agaaaagaat
121 gtaacagtaa cacactctgt caaccttcta gaaaacaggc ataatgggaa actatgcaaa
181 ctaagagggg tagctccatt gcacttgggt aaatgtaaca ttgctggatg gattctggga
241 aatccagagt gtgaatcact ctccacagca agctcatggt cctacattgt ggaaacatct
301 aattcagaaa atgggacgtg ttacccagga gatttcataa attatgagga gctaagagag
361 cagttgagct cagtgtcatc atttgaaaga tttgagatat tccccaagac aagttcatgg
421 cccaatcatg acacgaacaa aggtgtgacg gcagcatgtc ctcatgctgg gacaaacagc
481 ttctacagaa atttagtatg gctagtacaa aagggaaatt catacccaaa aatcaacaaa
541 tcctacatta acaataaaga gaatgaagtt ctcgtgctat gggccattca ccatccatct
601 accagtgccg accaacagag tctctacaaa aatgcagatg cctatgtgtt tgtggggtca
661 tcaagataca gcaggaagtt cgagccagaa atagcaacaa gacctaaagt gagagaccaa
721 gcagggagaa tgaattatta ctggacacta gtagagcctg gagacaagat aacattcgaa
781 gcaactggaa atctagtggc accgagatat gccttcacat tgaaaagaaa ttctggatct
841 ggtattatca tttcagatac atcagtccac gattgtgata caacttgtca gacacccaat
901 ggtgctataa acaccagcct cccatttcaa aatatacatc cagtcacaat tggagaatgt
961 ccaaaatatg taaaaagtac taaactgaga atggccacag gtttaaggaa tatcccgtct
1021 attcaatcta gaggcctgtt tggtgccatt gctggcttta ttgaaggggg ttggacagga
1081 atgatagatg gatggtacgg ttatcaccat caaaatgagc agggatcagg atatgcagcc
1141 gacctgaaga gcacacaaaa tgccattgat gggatcacta acaaggtgaa ctctgttatt
1201 gaaaagatga acacccaatt cacggcagta ggtaaagagt tcagccactt ggaaagaaga
1261 atagagaatt taaataaaaa ggttgatgat ggttttctag atatttggac ttacaatgcc
1321 gaactgttgg ttctattgga aaatgaacga actttggatt accacgactc aaatgtgaaa
1381 aacttatatg aaaaagtaag aagccaacta aaaaacaatg ccaaggaaat tgggaatggc
1441 tgctttgaat tttaccacaa atgtgatgac atgtgcatgg aaagcgtcaa aaatggaact
1501 tatgattacc ctaaatactc agaggaagca aaactaaaca gagaggaaat agatggggta
1561 aagttggaat caacaaggat ttaccaaatt ttggcgatct attcaacggt cgccagttca
1621 ttggtactgg tagtctccct gggggcaatc agtttctgga tgtgctctaa tgggtcgcta
1681 cagtgcagaa tatgtattta a

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Wed Sep 02, 2015 1:16 pm 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
EPI623632 A/swine/Iowa/A02077588/2015 (A/H1N1) segment 4 (HA) 3142.3 0.000000e+00 1701/1701 (100%)
EPI590763 A/swine/Nebraska/A01489937/2015 (A/H1N1) segment 4 (HA) 3142.3 0.000000e+00 1701/1701 (100%)
EPI590745 A/swine/Nebraska/A01847039/2015 (A/H1N1) segment 4 (HA) 3142.3 0.000000e+00 1701/1701 (100%)
EPI590510 A/swine/Nebraska/A01489936/2015 (A/H1N1) segment 4 (HA) 3142.3 0.000000e+00 1701/1701 (100%)
EPI590507 A/swine/Nebraska/A01847041/2015 (A/H1N1) segment 4 (HA) 3142.3 0.000000e+00 1701/1701 (100%)
EPI584879 A/swine/Nebraska/A01489614/2015 (A/H1N1) segment 4 (HA) 3142.3 0.000000e+00 1701/1701 (100%)
EPI615091 A/swine/Nebraska/A01847898/2015 (A/H1N1) segment 4 (HA) 3138.6 0.000000e+00 1700/1701 (99%)
EPI641552 A/swine/Nebraska/A01822990/2015 (A/H1N1) segment 4 (HA) 3136.7 0.000000e+00 1700/1701 (99%)
EPI620716 A/swine/Kansas/A01377485/2015 (A/H1N1) segment 4 (HA) 3136.7 0.000000e+00 1700/1701 (99%)
EPI584772 A/swine/Nebraska/A01840928/2015 (A/H1N1) segment 4 (HA) 3136.7 0.000000e+00 1700/1701 (99%)
EPI584749 A/swine/Nebraska/A01840930/2015 (A/H1N1) segment 4 (HA) 3136.7 0.000000e+00 1700/1701 (99%)
EPI584837 A/swine/Nebraska/A01489603/2015 (A/H1N1) segment 4 (HA) 3134.9 0.000000e+00 1699/1701 (99%)
EPI638970 A/Iowa/39/2015 (A/H1N1) segment 4 (HA) 3131.2 0.000000e+00 1699/1701 (99%)
EPI621558 A/swine/Nebraska/A01822366/2015 (A/H1N1) segment 4 (HA) 3131.2 0.000000e+00 1699/1701 (99%)
EPI621552 A/swine/Nebraska/A01822363/2015 (A/H1N1) segment 4 (HA) 3131.2 0.000000e+00 1699/1701 (99%)
EPI621549 A/swine/Nebraska/A01822370/2015 (A/H1N1) segment 4 (HA) 3131.2 0.000000e+00 1699/1701 (99%)
EPI620717 A/swine/Kansas/A01377518/2015 (A/H1N1) segment 4 (HA) 3131.2 0.000000e+00 1699/1701 (99%)
EPI612735 A/swine/South Dakota/A01847802/2015 (A/H1N1) segment 4 (HA) 3131.2 0.000000e+00 1699/1701 (99%)
EPI612550 A/swine/South Dakota/A01471016/2015 (A/H1N1) segment 4 (HA) 3131.2 0.000000e+00 1699/1701 (99%)
EPI508855 A/swine/Iowa/A01410104/2014 (A/H1N1) segment 4 (HA) 3099.8 0.000000e+00 1693/1701 (99%)
EPI615102 A/swine/Kansas/A01377560/2015 (A/H1N1) segment 4 (HA) 3098.0 0.000000e+00 1683/1686 (99%)
EPI615099 A/swine/Kansas/A01377531/2015 (A/H1N1) segment 4 (HA) 3098.0 0.000000e+00 1685/1689 (99%)
EPI597685 A/swine/Minnesota/A01566469/2014 (A/H1N1) segment 4 (HA) 3088.7 0.000000e+00 1691/1701 (99%)
EPI510250 A/swine/Iowa/A01480170/2014 (A/H1N1) segment 4 (HA) 3086.9 0.000000e+00 1685/1692 (99%)
EPI489716 A/swine/Minnesota/A01394048/2013 (A/H1N1) segment 4 (HA) 3086.9 0.000000e+00 1691/1701 (99%)
EPI487199 A/swine/Iowa/A01290542/2013 (A/H1N1) segment 4 (HA) 3086.9 0.000000e+00 1691/1701 (99%)
EPI487993 A/swine/Iowa/A01290613/2013 (A/H1N1) segment 4 (HA) 3083.2 0.000000e+00 1690/1701 (99%)
EPI548247 A/swine/Minnesota/A01476503/2014 (A/H1N1) segment 4 (HA) 3081.3 0.000000e+00 1690/1701 (99%)
EPI506611 A/swine/Minnesota/A01490569/2013 (A/H1N1) segment 4 (HA) 3081.3 0.000000e+00 1690/1701 (99%)
EPI573455 A/swine/Iowa/A01478359/2014 (A/H1N1) segment 4 (HA) 3075.8 0.000000e+00 1689/1701 (99%)
EPI600419 A/swine/Iowa/A01476905/2014 (A/H1N1) segment 4 (HA) 3070.3 0.000000e+00 1688/1701 (99%)
EPI586098 A/swine/Minnesota/A01489545/2015 (A/H1N1) segment 4 (HA) 3070.3 0.000000e+00 1688/1701 (99%)
EPI586083 A/swine/Minnesota/A01489544/2015 (A/H1N1) segment 4 (HA) 3070.3 0.000000e+00 1688/1701 (99%)
EPI550302 A/swine/Iowa/A01410969/2014 (A/H1N1) segment 4 (HA) 3070.3 0.000000e+00 1688/1701 (99%)
EPI623606 A/swine/Minnesota/A01471412/2015 (A/H1N1) segment 4 (HA) 3064.7 0.000000e+00 1687/1701 (99%)
EPI574169 A/swine/South Dakota/A01469598/2015 (A/H1N1) segment 4 (HA) 3064.7 0.000000e+00 1687/1701 (99%)
EPI545394 A/swine/Iowa/A01476323/2014 (A/H1N1) segment 4 (HA) 3064.7 0.000000e+00 1687/1701 (99%)
EPI620707 A/swine/South Dakota/A01470837/2015 (A/H1N1) segment 4 (HA) 3059.2 0.000000e+00 1686/1701 (99%)
EPI596351 A/swine/Iowa/A02076005/2015 (A/H1N1) segment 4 (HA) 3059.2 0.000000e+00 1686/1701 (99%)
EPI590671 A/swine/Minnesota/A02076045/2015 (A/H1N1) segment 4 (HA) 3059.2 0.000000e+00 1686/1701 (99%)
EPI559506 A/swine/Iowa/A01476573/2014 (A/H1N1) segment 4 (HA) 3059.2 0.000000e+00 1686/1701 (99%)
EPI506674 A/swine/Minnesota/A01366684/2014 (A/H1N1) segment 4 (HA) 3059.2 0.000000e+00 1680/1692 (99%)
EPI620517 A/swine/Minnesota/A02076858/2015 (A/H1N1) segment 4 (HA) 3053.6 0.000000e+00 1685/1701 (99%)
EPI612544 A/swine/South Dakota/A01470998/2015 (A/H1N1) segment 4 (HA) 3053.6 0.000000e+00 1687/1703 (99%)
EPI558848 A/swine/Iowa/A01477717/2014 (A/H1N1) segment 4 (HA) 3053.6 0.000000e+00 1685/1701 (99%)
EPI510253 A/swine/Iowa/A01480171/2014 (A/H1N1) segment 4 (HA) 3053.6 0.000000e+00 1679/1692 (99%)
EPI623638 A/swine/Minnesota/A02076882/2015 (A/H1N1) segment 4 (HA) 3049.9 0.000000e+00 1684/1701 (99%)
EPI620596 A/swine/Iowa/A02077346/2015 (A/H1N1) segment 4 (HA) 3049.9 0.000000e+00 1684/1701 (99%)
EPI509715 A/swine/Minnesota/A01366929/2014 (A/H1N1) segment 4 (HA) 3049.9 0.000000e+00 1687/1704 (99%)
EPI641423 A/swine/Minnesota/A01822905/2015 (A/H1N1) segment 4 (HA) 3048.1 0.000000e+00 1684/1701 (99%)
EPI620605 A/swine/Illinois/A02077404/2015 (A/H1N1) segment 4 (HA) 3048.1 0.000000e+00 1684/1701 (99%)
EPI615348 A/swine/Minnesota/A01471082/2015 (A/H1N1) segment 4 (HA) 3048.1 0.000000e+00 1684/1701 (99%)
EPI612714 A/swine/Minnesota/A01471032/2015 (A/H1N1) segment 4 (HA) 3048.1 0.000000e+00 1686/1703 (99%)
EPI612541 A/swine/Minnesota/A01470872/2015 (A/H1N1) segment 4 (HA) 3048.1 0.000000e+00 1686/1703 (99%)
EPI590790 A/swine/Missouri/A01554380/2015 (A/H1N1) segment 4 (HA) 3048.1 0.000000e+00 1684/1701 (99%)
EPI590748 A/swine/Iowa/A01489883/2015 (A/H1N1) segment 4 (HA) 3048.1 0.000000e+00 1685/1702 (99%)
EPI590674 A/swine/Minnesota/A01470721/2015 (A/H1N1) segment 4 (HA) 3048.1 0.000000e+00 1684/1701 (99%)
EPI590528 A/swine/Illinois/A01462984/2015 (A/H1N1) segment 4 (HA) 3048.1 0.000000e+00 1684/1701 (99%)
EPI573425 A/swine/Missouri/A01567015/2014 (A/H1N1) segment 4 (HA) 3048.1 0.000000e+00 1684/1701 (99%)
EPI548238 A/swine/Iowa/A01477623/2014 (A/H1N1) segment 4 (HA) 3048.1 0.000000e+00 1684/1701 (99%)
EPI504934 A/swine/Minnesota/A01366468/2013 (A/H1N1) segment 4 (HA) 3048.1 0.000000e+00 1686/1703 (99%)
EPI504925 A/swine/Minnesota/A01366382/2013 (A/H1N1) segment 4 (HA) 3048.1 0.000000e+00 1684/1700 (99%)
EPI530341 A/swine/Minnesota/A01480795/2014 (A/H1N1) segment 4 (HA) 3044.4 0.000000e+00 1686/1704 (98%)
EPI641558 A/swine/Illinois/A01823191/2015 (A/H1N1) segment 4 (HA) 3042.6 0.000000e+00 1683/1701 (98%)
EPI623647 A/swine/Iowa/A02076879/2015 (A/H0) segment 4 (HA) 3042.6 0.000000e+00 1683/1701 (98%)
EPI621573 A/swine/Minnesota/A01847951/2015 (A/H1N1) segment 4 (HA) 3042.6 0.000000e+00 1683/1701 (98%)
EPI615094 A/swine/Minnesota/A01847958/2015 (A/H1N1) segment 4 (HA) 3042.6 0.000000e+00 1683/1701 (98%)
EPI600446 A/swine/Iowa/A01476909/2014 (A/H1N2) segment 4 (HA) 3042.6 0.000000e+00 1683/1701 (98%)
EPI600398 A/swine/Iowa/A01477800/2014 (A/H1N1) segment 4 (HA) 3042.6 0.000000e+00 1683/1701 (98%)
EPI600362 A/swine/Iowa/A01476996/2014 (A/H1N1) segment 4 (HA) 3042.6 0.000000e+00 1683/1701 (98%)
EPI600324 A/swine/Iowa/A01566804/2014 (A/H1N1) segment 4 (HA) 3042.6 0.000000e+00 1683/1701 (98%)
EPI600321 A/swine/Iowa/A01566813/2014 (A/H1N1) segment 4 (HA) 3042.6 0.000000e+00 1683/1701 (98%)
EPI593657 A/swine/Minnesota/A01567678/2015 (A/H1N1) segment 4 (HA) 3042.6 0.000000e+00 1683/1701 (98%)
EPI590782 A/swine/Missouri/A01554320/2015 (A/H0) segment 4 (HA) 3042.6 0.000000e+00 1684/1702 (98%)
EPI586089 A/swine/Minnesota/A01489611/2015 (A/H1N1) segment 4 (HA) 3042.6 0.000000e+00 1683/1701 (98%)
EPI559584 A/swine/Iowa/A01476550/2014 (A/H1N1) segment 4 (HA) 3042.6 0.000000e+00 1683/1701 (98%)
EPI546873 A/swine/Iowa/A01502541/2014 (A/H1N1) segment 4 (HA) 3042.6 0.000000e+00 1683/1701 (98%)
EPI406570 A/swine/Minnesota/A01203885/2012 (A/H1N1) segment 4 (HA) 3042.6 0.000000e+00 1683/1701 (98%)
EPI584817 A/swine/Illinois/A02077009/2015 (A/H1N2) segment 4 (HA) 3038.9 0.000000e+00 1682/1701 (98%)
EPI641538 A/swine/Pennsylvania/A02024933/2015 (A/H1N1) segment 4 (HA) 3037.0 0.000000e+00 1682/1701 (98%)
EPI623666 A/swine/Pennsylvania/A01554941/2015 (A/H1N1) segment 4 (HA) 3037.0 0.000000e+00 1682/1701 (98%)
EPI620626 A/swine/Iowa/A02076598/2015 (A/H1N1) segment 4 (HA) 3037.0 0.000000e+00 1682/1701 (98%)
EPI615351 A/swine/Minnesota/A01471246/2015 (A/H1N1) segment 4 (HA) 3037.0 0.000000e+00 1682/1701 (98%)
EPI612583 A/swine/Iowa/A02076210/2015 (A/H1N1) segment 4 (HA) 3037.0 0.000000e+00 1682/1701 (98%)
EPI612553 A/swine/Minnesota/A01471108/2015 (A/H1N1) segment 4 (HA) 3037.0 0.000000e+00 1682/1701 (98%)
EPI612523 A/swine/Iowa/A02076432/2015 (A/H1N1) segment 4 (HA) 3037.0 0.000000e+00 1682/1701 (98%)
EPI596354 A/swine/Indiana/A01841426/2015 (A/H1N1) segment 4 (HA) 3037.0 0.000000e+00 1682/1701 (98%)
EPI593953 A/swine/Iowa/A01489009/2015 (A/H1N1) segment 4 (HA) 3037.0 0.000000e+00 1682/1701 (98%)
EPI584861 A/swine/Iowa/A01489877/2015 (A/H1N1) segment 4 (HA) 3037.0 0.000000e+00 1683/1702 (98%)
EPI559581 A/swine/Iowa/A01476670/2014 (A/H1N1) segment 4 (HA) 3037.0 0.000000e+00 1682/1701 (98%)
EPI612511 A/swine/Iowa/A02076491/2015 (A/H1N1) segment 4 (HA) 3031.5 0.000000e+00 1681/1701 (98%)
EPI600771 A/swine/Iowa/A01469080/2014 (A/H1N1) segment 4 (HA) 3031.5 0.000000e+00 1681/1701 (98%)
EPI597658 A/swine/Iowa/A01476879/2014 (A/H1N1) segment 4 (HA) 3031.5 0.000000e+00 1681/1701 (98%)
EPI559539 A/swine/Iowa/A01476675/2014 (A/H1N1) segment 4 (HA) 3031.5 0.000000e+00 1681/1701 (98%)
EPI548272 A/swine/Iowa/A01478049/2014 (A/H1N1) segment 4 (HA) 3031.5 0.000000e+00 1681/1701 (98%)
EPI623657 A/swine/Illinois/A02076884/2015 (A/H1N1) segment 4 (HA) 3027.8 0.000000e+00 1681/1702 (98%)
EPI620796 A/swine/Minnesota/A01847567/2015 (A/H1N1) segment 4 (HA) 3025.9 0.000000e+00 1680/1701 (98%)
EPI641623 A/swine/Illinois/A02034081/2015 (A/H1N1) segment 4 (HA) 3022.2 0.000000e+00 1679/1701 (98%)
EPI597664 A/swine/Iowa/A01476808/2014 (A/H1N1) segment 4 (HA) 3020.4 0.000000e+00 1679/1701 (98%)
EPI533922 A/swine/Minnesota/A01481244/2014 (A/H1N1) segment 4 (HA) 3020.4 0.000000e+00 1673/1692 (98%)

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Wed Sep 02, 2015 1:17 pm 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
EPI641553 A/swine/Nebraska/A01822990/2015 (A/H1N1) segment 6 (NA) 2604.9 0.000000e+00 1410/1410 (100%)
EPI623633 A/swine/Iowa/A02077588/2015 (A/H1N1) segment 6 (NA) 2604.9 0.000000e+00 1410/1410 (100%)
EPI590764 A/swine/Nebraska/A01489937/2015 (A/H1N1) segment 6 (NA) 2604.9 0.000000e+00 1410/1410 (100%)
EPI590511 A/swine/Nebraska/A01489936/2015 (A/H1N1) segment 6 (NA) 2604.9 0.000000e+00 1410/1410 (100%)
EPI590508 A/swine/Nebraska/A01847041/2015 (A/H1N1) segment 6 (NA) 2604.9 0.000000e+00 1410/1410 (100%)
EPI584880 A/swine/Nebraska/A01489614/2015 (A/H1N1) segment 6 (NA) 2604.9 0.000000e+00 1410/1410 (100%)
EPI584838 A/swine/Nebraska/A01489603/2015 (A/H1N1) segment 6 (NA) 2604.9 0.000000e+00 1410/1410 (100%)
EPI590746 A/swine/Nebraska/A01847039/2015 (A/H1N1) segment 6 (NA) 2601.2 0.000000e+00 1409/1410 (99%)
EPI638969 A/Iowa/39/2015 (A/H1N1) segment 6 (NA) 2599.4 0.000000e+00 1409/1410 (99%)
EPI620718 A/swine/Kansas/A01377485/2015 (A/H1N1) segment 6 (NA) 2599.4 0.000000e+00 1409/1410 (99%)
EPI584773 A/swine/Nebraska/A01840928/2015 (A/H1N1) segment 6 (NA) 2599.4 0.000000e+00 1409/1410 (99%)
EPI584750 A/swine/Nebraska/A01840930/2015 (A/H1N1) segment 6 (NA) 2599.4 0.000000e+00 1409/1410 (99%)
EPI620719 A/swine/Kansas/A01377518/2015 (A/H1N1) segment 6 (NA) 2593.8 0.000000e+00 1408/1410 (99%)
EPI615092 A/swine/Nebraska/A01847898/2015 (A/H1N1) segment 6 (NA) 2593.8 0.000000e+00 1408/1410 (99%)
EPI621559 A/swine/Nebraska/A01822366/2015 (A/H1N1) segment 6 (NA) 2588.3 0.000000e+00 1407/1410 (99%)
EPI621553 A/swine/Nebraska/A01822363/2015 (A/H1N1) segment 6 (NA) 2588.3 0.000000e+00 1407/1410 (99%)
EPI621550 A/swine/Nebraska/A01822370/2015 (A/H1N1) segment 6 (NA) 2588.3 0.000000e+00 1407/1410 (99%)
EPI612736 A/swine/South Dakota/A01847802/2015 (A/H1N1) segment 6 (NA) 2588.3 0.000000e+00 1407/1410 (99%)
EPI612552 A/swine/South Dakota/A01471016/2015 (A/H1N1) segment 6 (NA) 2566.1 0.000000e+00 1403/1410 (99%)
EPI510252 A/swine/Iowa/A01480170/2014 (A/H1N1) segment 6 (NA) 2555.0 0.000000e+00 1401/1410 (99%)
EPI615101 A/swine/Kansas/A01377560/2015 (A/H1N1) segment 6 (NA) 2547.7 0.000000e+00 1386/1389 (99%)
EPI508856 A/swine/Iowa/A01410104/2014 (A/H1N1) segment 6 (NA) 2544.0 0.000000e+00 1399/1410 (99%)
EPI597686 A/swine/Minnesota/A01566469/2014 (A/H1N1) segment 6 (NA) 2534.7 0.000000e+00 1397/1410 (99%)
EPI615098 A/swine/Kansas/A01377531/2015 (A/H1N1) segment 6 (NA) 2531.0 0.000000e+00 1374/1376 (99%)
EPI484440 A/swine/Iowa/A01364403/2013 (A/H1N1) segment 6 (NA) 2527.3 0.000000e+00 1396/1410 (99%)
EPI548248 A/swine/Minnesota/A01476503/2014 (A/H1N1) segment 6 (NA) 2523.6 0.000000e+00 1395/1410 (98%)
EPI612546 A/swine/South Dakota/A01470998/2015 (A/H1N1) segment 6 (NA) 2521.8 0.000000e+00 1395/1410 (98%)
EPI612543 A/swine/Minnesota/A01470872/2015 (A/H1N1) segment 6 (NA) 2521.8 0.000000e+00 1395/1410 (98%)
EPI586099 A/swine/Minnesota/A01489545/2015 (A/H1N1) segment 6 (NA) 2521.8 0.000000e+00 1395/1410 (98%)
EPI510255 A/swine/Iowa/A01480171/2014 (A/H1N1) segment 6 (NA) 2521.8 0.000000e+00 1395/1410 (98%)
EPI487994 A/swine/Iowa/A01290613/2013 (A/H1N1) segment 6 (NA) 2521.8 0.000000e+00 1395/1410 (98%)
EPI487200 A/swine/Iowa/A01290542/2013 (A/H1N1) segment 6 (NA) 2521.8 0.000000e+00 1395/1410 (98%)
EPI623650 A/swine/Iowa/A02076879/2015 (A/H0) segment 6 (NA) 2516.3 0.000000e+00 1394/1410 (98%)
EPI621574 A/swine/Minnesota/A01847951/2015 (A/H1N1) segment 6 (NA) 2516.3 0.000000e+00 1394/1410 (98%)
EPI615095 A/swine/Minnesota/A01847958/2015 (A/H1N1) segment 6 (NA) 2516.3 0.000000e+00 1394/1410 (98%)
EPI586084 A/swine/Minnesota/A01489544/2015 (A/H1N1) segment 6 (NA) 2516.3 0.000000e+00 1394/1410 (98%)
EPI559507 A/swine/Iowa/A01476573/2014 (A/H1N1) segment 6 (NA) 2516.3 0.000000e+00 1394/1410 (98%)
EPI620518 A/swine/Minnesota/A02076858/2015 (A/H1N1) segment 6 (NA) 2510.7 0.000000e+00 1393/1410 (98%)
EPI615350 A/swine/Minnesota/A01471082/2015 (A/H1N1) segment 6 (NA) 2510.7 0.000000e+00 1393/1410 (98%)
EPI593954 A/swine/Iowa/A01489009/2015 (A/H1N1) segment 6 (NA) 2510.7 0.000000e+00 1393/1410 (98%)
EPI590676 A/swine/Minnesota/A01470721/2015 (A/H1N1) segment 6 (NA) 2510.7 0.000000e+00 1393/1410 (98%)
EPI546874 A/swine/Iowa/A01502541/2014 (A/H1N1) segment 6 (NA) 2510.7 0.000000e+00 1393/1410 (98%)
EPI506676 A/swine/Minnesota/A01366684/2014 (A/H1N1) segment 6 (NA) 2510.7 0.000000e+00 1393/1410 (98%)
EPI504936 A/swine/Minnesota/A01366468/2013 (A/H1N1) segment 6 (NA) 2510.7 0.000000e+00 1393/1410 (98%)
EPI504927 A/swine/Minnesota/A01366382/2013 (A/H1N1) segment 6 (NA) 2510.7 0.000000e+00 1393/1410 (98%)
EPI641424 A/swine/Minnesota/A01822905/2015 (A/H1N1) segment 6 (NA) 2505.2 0.000000e+00 1392/1410 (98%)
EPI623608 A/swine/Minnesota/A01471412/2015 (A/H1N1) segment 6 (NA) 2505.2 0.000000e+00 1392/1410 (98%)
EPI615353 A/swine/Minnesota/A01471246/2015 (A/H1N1) segment 6 (NA) 2505.2 0.000000e+00 1392/1410 (98%)
EPI612716 A/swine/Minnesota/A01471032/2015 (A/H1N1) segment 6 (NA) 2505.2 0.000000e+00 1392/1410 (98%)
EPI612555 A/swine/Minnesota/A01471108/2015 (A/H1N1) segment 6 (NA) 2505.2 0.000000e+00 1392/1410 (98%)
EPI590672 A/swine/Minnesota/A02076045/2015 (A/H1N1) segment 6 (NA) 2505.2 0.000000e+00 1392/1410 (98%)
EPI586090 A/swine/Minnesota/A01489611/2015 (A/H1N1) segment 6 (NA) 2505.2 0.000000e+00 1392/1410 (98%)
EPI489717 A/swine/Minnesota/A01394048/2013 (A/H1N1) segment 6 (NA) 2505.2 0.000000e+00 1392/1410 (98%)
EPI548273 A/swine/Iowa/A01478049/2014 (A/H1N1) segment 6 (NA) 2503.3 0.000000e+00 1391/1410 (98%)
EPI550303 A/swine/Iowa/A01410969/2014 (A/H1N1) segment 6 (NA) 2501.5 0.000000e+00 1391/1410 (98%)
EPI620709 A/swine/South Dakota/A01470837/2015 (A/H1N1) segment 6 (NA) 2499.6 0.000000e+00 1391/1410 (98%)
EPI533924 A/swine/Minnesota/A01481244/2014 (A/H1N1) segment 6 (NA) 2499.6 0.000000e+00 1391/1410 (98%)
EPI509717 A/swine/Minnesota/A01366929/2014 (A/H1N1) segment 6 (NA) 2499.6 0.000000e+00 1391/1410 (98%)
EPI506612 A/swine/Minnesota/A01490569/2013 (A/H1N1) segment 6 (NA) 2499.6 0.000000e+00 1391/1410 (98%)
EPI600420 A/swine/Iowa/A01476905/2014 (A/H1N1) segment 6 (NA) 2495.9 0.000000e+00 1390/1410 (98%)
EPI620779 A/swine/Iowa/A01847330/2015 (A/H1N1) segment 6 (NA) 2494.1 0.000000e+00 1390/1410 (98%)
EPI530343 A/swine/Minnesota/A01480795/2014 (A/H1N1) segment 6 (NA) 2494.1 0.000000e+00 1390/1410 (98%)
EPI612505 A/swine/Illinois/A01554521/2015 (A/H1N1) segment 6 (NA) 2488.6 0.000000e+00 1389/1410 (98%)
EPI574171 A/swine/South Dakota/A01469598/2015 (A/H1N1) segment 6 (NA) 2483.0 0.000000e+00 1389/1411 (98%)
EPI559585 A/swine/Iowa/A01476550/2014 (A/H1N1) segment 6 (NA) 2483.0 0.000000e+00 1388/1410 (98%)
EPI406569 A/swine/Minnesota/A01203885/2012 (A/H1N1) segment 6 (NA) 2483.0 0.000000e+00 1388/1410 (98%)
EPI399104 A/swine/Iowa/A01328941/2012 (A/H1N1) segment 6 (NA) 2483.0 0.000000e+00 1388/1410 (98%)
EPI612512 A/swine/Iowa/A02076491/2015 (A/H1N1) segment 6 (NA) 2477.5 0.000000e+00 1388/1411 (98%)
EPI600325 A/swine/Iowa/A01566804/2014 (A/H1N1) segment 6 (NA) 2477.5 0.000000e+00 1387/1410 (98%)
EPI600322 A/swine/Iowa/A01566813/2014 (A/H1N1) segment 6 (NA) 2477.5 0.000000e+00 1387/1410 (98%)
EPI597665 A/swine/Iowa/A01476808/2014 (A/H1N1) segment 6 (NA) 2477.5 0.000000e+00 1387/1410 (98%)
EPI559540 A/swine/Iowa/A01476675/2014 (A/H1N1) segment 6 (NA) 2477.5 0.000000e+00 1387/1410 (98%)
EPI472527 A/swine/South Dakota/A01364180/2013 (A/H1N1) segment 6 (NA) 2477.5 0.000000e+00 1387/1410 (98%)
EPI459453 A/swine/Minnesota/A01350085/2013 (A/H1N1) segment 6 (NA) 2477.5 0.000000e+00 1387/1410 (98%)
EPI406500 A/swine/SouthDakota/A01267922/2012 (A/H1N1) segment 6 (NA) 2477.5 0.000000e+00 1387/1410 (98%)
EPI399506 A/swine/Minnesota/A01240292/2011 (A/H1N1) segment 6 (NA) 2477.5 0.000000e+00 1387/1410 (98%)
EPI399398 A/swine/Minnesota/A01301275/2012 (A/H1N1) segment 6 (NA) 2477.5 0.000000e+00 1387/1410 (98%)
EPI390856 A/swine/Iowa/A01203352/2012 (A/H1N1) segment 6 (NA) 2477.5 0.000000e+00 1387/1410 (98%)
EPI383904 A/swine/South Dakota/11/2012 (A/H1N1) segment 6 (NA) 2477.5 0.000000e+00 1387/1410 (98%)
EPI383781 A/swine/Iowa/A01203577/2012 (A/H1N1) segment 6 (NA) 2477.5 0.000000e+00 1387/1410 (98%)
EPI383532 A/swine/Iowa/A01203481/2012 (A/H1N1) segment 6 (NA) 2477.5 0.000000e+00 1387/1410 (98%)
EPI620627 A/swine/Iowa/A02076598/2015 (A/H1N1) segment 6 (NA) 2471.9 0.000000e+00 1387/1411 (98%)
EPI573426 A/swine/Missouri/A01567015/2014 (A/H1N1) segment 6 (NA) 2471.9 0.000000e+00 1386/1410 (98%)
EPI558849 A/swine/Iowa/A01477717/2014 (A/H1N1) segment 6 (NA) 2471.9 0.000000e+00 1386/1410 (98%)
EPI545395 A/swine/Iowa/A01476323/2014 (A/H1N1) segment 6 (NA) 2471.9 0.000000e+00 1386/1410 (98%)
EPI440786 A/swine/Minnesota/A01349018/2013 (A/H1N1) segment 6 (NA) 2471.9 0.000000e+00 1386/1410 (98%)
EPI439852 A/swine/Mississippi/A01432467/2013 (A/H1N1) segment 6 (NA) 2471.9 0.000000e+00 1386/1410 (98%)
EPI407033 A/swine/Minnesota/A01279114/2012 (A/H1N1) segment 6 (NA) 2471.9 0.000000e+00 1386/1410 (98%)
EPI406477 A/swine/SouthDakota/A01267781/2012 (A/H1N1) segment 6 (NA) 2471.9 0.000000e+00 1386/1410 (98%)
EPI399428 A/swine/Minnesota/A01301432/2012 (A/H1N1) segment 6 (NA) 2471.9 0.000000e+00 1386/1410 (98%)
EPI399095 A/swine/Iowa/A01327884/2012 (A/H1N1) segment 6 (NA) 2471.9 0.000000e+00 1386/1410 (98%)
EPI391435 A/swine/Iowa/A01203212/2012 (A/H1N1) segment 6 (NA) 2471.9 0.000000e+00 1386/1410 (98%)
EPI391206 A/swine/Illinois/A01202780/2011 (A/H1N1) segment 6 (NA) 2471.9 0.000000e+00 1386/1410 (98%)
EPI390891 A/swine/Iowa/A01203440/2012 (A/H1N1) segment 6 (NA) 2471.9 0.000000e+00 1386/1410 (98%)
EPI390862 A/swine/Iowa/A01203395/2012 (A/H1N1) segment 6 (NA) 2471.9 0.000000e+00 1386/1410 (98%)
EPI381431 A/swine/South Dakota/8/2012 (A/H1N1) segment 6 (NA) 2471.9 0.000000e+00 1386/1410 (98%)
EPI600363 A/swine/Iowa/A01476996/2014 (A/H1N1) segment 6 (NA) 2466.4 0.000000e+00 1385/1410 (98%)
EPI573456 A/swine/Iowa/A01478359/2014 (A/H1N1) segment 6 (NA) 2466.4 0.000000e+00 1386/1411 (98%)
EPI499703 A/swine/Iowa/A01409121/2013 (A/H1N1) segment 6 (NA) 2466.4 0.000000e+00 1385/1410 (98%)
EPI440783 A/swine/Iowa/A01280963/2013 (A/H1N1) segment 6 (NA) 2466.4 0.000000e+00 1385/1410 (98%)

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Wed Sep 02, 2015 1:18 pm 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
EPI623634 A/swine/Iowa/A02077588/2015 (A/H1N1) segment 7 (MP) 1814.5 0.000000e+00 982/982 (100%)
EPI621554 A/swine/Nebraska/A01822363/2015 (A/H1N1) segment 7 (MP) 1814.5 0.000000e+00 982/982 (100%)
EPI621551 A/swine/Nebraska/A01822370/2015 (A/H1N1) segment 7 (MP) 1814.5 0.000000e+00 982/982 (100%)
EPI620721 A/swine/Kansas/A01377518/2015 (A/H1N1) segment 7 (MP) 1814.5 0.000000e+00 982/982 (100%)
EPI620720 A/swine/Kansas/A01377485/2015 (A/H1N1) segment 7 (MP) 1814.5 0.000000e+00 982/982 (100%)
EPI615097 A/swine/Kansas/A01377531/2015 (A/H1N1) segment 7 (MP) 1814.5 0.000000e+00 982/982 (100%)
EPI612737 A/swine/South Dakota/A01847802/2015 (A/H1N1) segment 7 (MP) 1814.5 0.000000e+00 982/982 (100%)
EPI612551 A/swine/South Dakota/A01471016/2015 (A/H1N1) segment 7 (MP) 1814.5 0.000000e+00 982/982 (100%)
EPI590765 A/swine/Nebraska/A01489937/2015 (A/H1N1) segment 7 (MP) 1814.5 0.000000e+00 982/982 (100%)
EPI590747 A/swine/Nebraska/A01847039/2015 (A/H1N1) segment 7 (MP) 1814.5 0.000000e+00 982/982 (100%)
EPI590512 A/swine/Nebraska/A01489936/2015 (A/H1N1) segment 7 (MP) 1814.5 0.000000e+00 982/982 (100%)
EPI590509 A/swine/Nebraska/A01847041/2015 (A/H1N1) segment 7 (MP) 1814.5 0.000000e+00 982/982 (100%)
EPI584881 A/swine/Nebraska/A01489614/2015 (A/H1N1) segment 7 (MP) 1814.5 0.000000e+00 982/982 (100%)
EPI584839 A/swine/Nebraska/A01489603/2015 (A/H1N1) segment 7 (MP) 1814.5 0.000000e+00 982/982 (100%)
EPI584774 A/swine/Nebraska/A01840928/2015 (A/H1N1) segment 7 (MP) 1814.5 0.000000e+00 982/982 (100%)
EPI584765 A/swine/Nebraska/A01840930/2015 (A/H1N1) segment 7 (MP) 1814.5 0.000000e+00 982/982 (100%)
EPI641554 A/swine/Nebraska/A01822990/2015 (A/H1N1) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI621560 A/swine/Nebraska/A01822366/2015 (A/H1N1) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI615100 A/swine/Kansas/A01377560/2015 (A/H1N1) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI510251 A/swine/Iowa/A01480170/2014 (A/H1N1) segment 7 (MP) 1792.4 0.000000e+00 978/982 (99%)
EPI508857 A/swine/Iowa/A01410104/2014 (A/H1N1) segment 7 (MP) 1792.4 0.000000e+00 978/982 (99%)
EPI641425 A/swine/Minnesota/A01822905/2015 (A/H1N1) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
EPI623607 A/swine/Minnesota/A01471412/2015 (A/H1N1) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
EPI612715 A/swine/Minnesota/A01471032/2015 (A/H1N1) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
EPI612545 A/swine/South Dakota/A01470998/2015 (A/H1N1) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
EPI612542 A/swine/Minnesota/A01470872/2015 (A/H1N1) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
EPI597687 A/swine/Minnesota/A01566469/2014 (A/H1N1) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
EPI548274 A/swine/Iowa/A01478049/2014 (A/H1N1) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
EPI548249 A/swine/Minnesota/A01476503/2014 (A/H1N1) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
EPI546875 A/swine/Iowa/A01502541/2014 (A/H1N1) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
EPI484439 A/swine/Iowa/A01364403/2013 (A/H1N1) segment 7 (MP) 1786.8 0.000000e+00 977/982 (99%)
EPI615349 A/swine/Minnesota/A01471082/2015 (A/H1N1) segment 7 (MP) 1781.3 0.000000e+00 976/982 (99%)
EPI590673 A/swine/Minnesota/A02076045/2015 (A/H1N1) segment 7 (MP) 1781.3 0.000000e+00 976/982 (99%)
EPI586100 A/swine/Minnesota/A01489545/2015 (A/H1N1) segment 7 (MP) 1781.3 0.000000e+00 976/982 (99%)
EPI586085 A/swine/Minnesota/A01489544/2015 (A/H1N1) segment 7 (MP) 1781.3 0.000000e+00 976/982 (99%)
EPI568719 A/swine/Iowa/A01478359/2014 (A/H1N1) segment 7 (MP) 1781.3 0.000000e+00 976/982 (99%)
EPI559508 A/swine/Iowa/A01476573/2014 (A/H1N1) segment 7 (MP) 1781.3 0.000000e+00 976/982 (99%)
EPI550304 A/swine/Iowa/A01410969/2014 (A/H1N1) segment 7 (MP) 1781.3 0.000000e+00 976/982 (99%)
EPI467627 A/swine/Minnesota/A01432889/2013 (A/H1N2) segment 7 (MP) 1781.3 0.000000e+00 976/982 (99%)
EPI463701 A/swine/Iowa/A01432780/2013 (A/H1N1) segment 7 (MP) 1781.3 0.000000e+00 976/982 (99%)
EPI416877 A/swine/Iowa/A01432233/2012 (A/H1N1) segment 7 (MP) 1781.3 0.000000e+00 976/982 (99%)
EPI414151 A/swine/Iowa/A01432105/2012 (A/H1N2) segment 7 (MP) 1781.3 0.000000e+00 976/982 (99%)
EPI408359 A/swine/South Dakota/A01267825/2012 (A/H1N1) segment 7 (MP) 1781.3 0.000000e+00 976/982 (99%)
EPI406519 A/swine/Texas/A01432097/2012 (A/H1N1) segment 7 (MP) 1781.3 0.000000e+00 976/982 (99%)
EPI399397 A/swine/Minnesota/A01301275/2012 (A/H1N1) segment 7 (MP) 1781.3 0.000000e+00 976/982 (99%)
EPI638965 A/Iowa/39/2015 (A/H1N1) segment 7 (MP) 1779.4 0.000000e+00 967/969 (99%)
EPI620708 A/swine/South Dakota/A01470837/2015 (A/H1N1) segment 7 (MP) 1775.8 0.000000e+00 975/982 (99%)
EPI620519 A/swine/Minnesota/A02076858/2015 (A/H1N1) segment 7 (MP) 1775.8 0.000000e+00 975/982 (99%)
EPI590675 A/swine/Minnesota/A01470721/2015 (A/H1N1) segment 7 (MP) 1775.8 0.000000e+00 975/982 (99%)
EPI568696 A/swine/Iowa/A01469493/2015 (A/H1N2) segment 7 (MP) 1775.8 0.000000e+00 975/982 (99%)
EPI558873 A/swine/Illinois/A01477750/2014 (A/H0) segment 7 (MP) 1775.8 0.000000e+00 975/982 (99%)
EPI530342 A/swine/Minnesota/A01480795/2014 (A/H1N1) segment 7 (MP) 1775.8 0.000000e+00 975/982 (99%)
EPI510254 A/swine/Iowa/A01480171/2014 (A/H1N1) segment 7 (MP) 1775.8 0.000000e+00 975/982 (99%)
EPI506613 A/swine/Minnesota/A01490569/2013 (A/H1N1) segment 7 (MP) 1775.8 0.000000e+00 975/982 (99%)
EPI504926 A/swine/Minnesota/A01366382/2013 (A/H1N1) segment 7 (MP) 1775.8 0.000000e+00 975/982 (99%)
EPI489718 A/swine/Minnesota/A01394048/2013 (A/H1N1) segment 7 (MP) 1775.8 0.000000e+00 975/982 (99%)
EPI487995 A/swine/Iowa/A01290613/2013 (A/H1N1) segment 7 (MP) 1775.8 0.000000e+00 975/982 (99%)
EPI487201 A/swine/Iowa/A01290542/2013 (A/H1N1) segment 7 (MP) 1775.8 0.000000e+00 975/982 (99%)
EPI467622 A/swine/Iowa/A01432819/2013 (A/H1N2) segment 7 (MP) 1775.8 0.000000e+00 975/982 (99%)
EPI467610 A/swine/Iowa/A01432854/2013 (A/H1N2) segment 7 (MP) 1775.8 0.000000e+00 975/982 (99%)
EPI439851 A/swine/Mississippi/A01432467/2013 (A/H1N1) segment 7 (MP) 1775.8 0.000000e+00 975/982 (99%)
EPI408327 A/swine/Minnesota/A01244318/2012 (H1N2) (A/H1N2) segment 7 (MP) 1775.8 0.000000e+00 975/982 (99%)
EPI406653 A/swine/Iowa/A01203944/2012 (A/H1N1) segment 7 (MP) 1775.8 0.000000e+00 975/982 (99%)
EPI406556 A/swine/Iowa/A01203953/2012 (A/H1N1) segment 7 (MP) 1775.8 0.000000e+00 975/982 (99%)
EPI406531 A/swine/Iowa/A01432085/2012 (A/H1N1) segment 7 (MP) 1775.8 0.000000e+00 975/982 (99%)
EPI399505 A/swine/Minnesota/A01240292/2011 (A/H1N1) segment 7 (MP) 1775.8 0.000000e+00 975/982 (99%)
EPI391455 A/swine/Iowa/A01203116/2012 (A/H1N1) segment 7 (MP) 1775.8 0.000000e+00 975/982 (99%)
EPI399103 A/swine/Iowa/A01328941/2012 (A/H1N1) segment 7 (MP) 1773.9 0.000000e+00 974/981 (99%)
EPI615096 A/swine/Minnesota/A01847958/2015 (A/H1N1) segment 7 (MP) 1770.2 0.000000e+00 974/982 (99%)
EPI600421 A/swine/Iowa/A01476905/2014 (A/H1N1) segment 7 (MP) 1770.2 0.000000e+00 974/982 (99%)
EPI558894 A/swine/Minnesota/A01566468/2014 (A/H1N1) segment 7 (MP) 1770.2 0.000000e+00 974/982 (99%)
EPI528484 A/swine/Ohio/13TOSU0735/2013 (A/H1N1) segment 7 (MP) 1770.2 0.000000e+00 974/982 (99%)
EPI504935 A/swine/Minnesota/A01366468/2013 (A/H1N1) segment 7 (MP) 1770.2 0.000000e+00 974/982 (99%)
EPI504917 A/swine/Iowa/A01366350/2013 (A/H1N1) segment 7 (MP) 1770.2 0.000000e+00 974/982 (99%)
EPI504911 A/swine/South Dakota/SJ1319788/2013 (A/H1N1) segment 7 (MP) 1770.2 0.000000e+00 974/982 (99%)
EPI472526 A/swine/South Dakota/A01364180/2013 (A/H1N1) segment 7 (MP) 1770.2 0.000000e+00 974/982 (99%)
EPI464493 A/swine/South Dakota/A01351105/2013 (A/H1N1) segment 7 (MP) 1770.2 0.000000e+00 974/982 (99%)
EPI463725 A/swine/Iowa/A01432785/2013 (A/H1N1) segment 7 (MP) 1770.2 0.000000e+00 974/982 (99%)
EPI459452 A/swine/Minnesota/A01350085/2013 (A/H1N1) segment 7 (MP) 1770.2 0.000000e+00 974/982 (99%)
EPI446727 A/swine/Nebraska/A01349435/2013 (A/H1N1) segment 7 (MP) 1770.2 0.000000e+00 974/982 (99%)
EPI441646 A/swine/Minnesota/A01445818/2013 (A/H1N1) segment 7 (MP) 1770.2 0.000000e+00 974/982 (99%)
EPI441160 A/swine/California/A00968789/2013 (A/H1N1) segment 7 (MP) 1770.2 0.000000e+00 974/982 (99%)
EPI439893 A/swine/Wyoming/A01445305/2013 (A/H3N2) segment 7 (MP) 1770.2 0.000000e+00 974/982 (99%)
EPI416871 A/swine/Colorado/A01432240/2012 (A/H1N1) segment 7 (MP) 1770.2 0.000000e+00 974/982 (99%)
EPI414157 A/swine/Iowa/A01432141/2012 (A/H1N1) segment 7 (MP) 1770.2 0.000000e+00 974/982 (99%)
EPI414058 A/swine/Iowa/A01277915/2012 (A/H3N2) segment 7 (MP) 1770.2 0.000000e+00 974/982 (99%)
EPI408303 A/swine/Minnesota/A01277996/2012 (A/H1N1) segment 7 (MP) 1770.2 0.000000e+00 974/982 (99%)
EPI406641 A/swine/Iowa/A01432034/2012 (A/H1N2) segment 7 (MP) 1770.2 0.000000e+00 974/982 (99%)
EPI406502 A/swine/SouthDakota/A01267928/2012 (A/H1N1) segment 7 (MP) 1770.2 0.000000e+00 974/982 (99%)
EPI406496 A/swine/SouthDakota/A01267921/2012 (A/H1N1) segment 7 (MP) 1770.2 0.000000e+00 974/982 (99%)
EPI406476 A/swine/SouthDakota/A01267781/2012 (A/H1N1) segment 7 (MP) 1770.2 0.000000e+00 974/982 (99%)
EPI401163 A/swine/Minnesota/A01270515/2012 (A/H1N1) segment 7 (MP) 1770.2 0.000000e+00 974/982 (99%)
EPI401142 A/swine/Minnesota/A01270516/2012 (A/H1N1) segment 7 (MP) 1770.2 0.000000e+00 974/982 (99%)
EPI401139 A/swine/Minnesota/A01270667/2012 (A/H1N1) segment 7 (MP) 1770.2 0.000000e+00 974/982 (99%)
EPI399427 A/swine/Minnesota/A01301432/2012 (A/H1N1) segment 7 (MP) 1770.2 0.000000e+00 974/982 (99%)
EPI399403 A/swine/Minnesota/A01300441/2012 (A/H1N1) segment 7 (MP) 1770.2 0.000000e+00 974/982 (99%)
EPI390909 A/swine/Iowa/A01203441/2012 (A/H1N1) segment 7 (MP) 1770.2 0.000000e+00 974/982 (99%)
EPI390880 A/swine/Iowa/A01203371/2012 (A/H1N1) segment 7 (MP) 1770.2 0.000000e+00 974/982 (99%)
EPI390879 A/swine/Iowa/A01203352/2012 (A/H1N1) segment 7 (MP) 1770.2 0.000000e+00 974/982 (99%)
EPI383903 A/swine/South Dakota/11/2012 (A/H1N1) segment 7 (MP) 1770.2 0.000000e+00 974/982 (99%)

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Thu Sep 03, 2015 9:03 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
Novel influenza A infection virus ยงยงยง 1 4 11 3 21 313 14 4 IA (1 )

http://wonder.cdc.gov/mmwr/mmwr_2015.as ... _location=

_________________
www.twitter.com/hniman


Top
 Profile  
 
Display posts from previous:  Sort by  
Post new topic Reply to topic  [ 6 posts ] 

All times are UTC - 5 hours [ DST ]


Who is online

Users browsing this forum: Yahoo [Bot] and 62 guests


You cannot post new topics in this forum
You cannot reply to topics in this forum
You cannot edit your posts in this forum
You cannot delete your posts in this forum
You cannot post attachments in this forum

Search for:
Jump to:  
cron
Powered by phpBB® Forum Software © phpBB Group