Rhiza Labs FluTracker Forum
http://fluboard.rhizalabs.com/forum/

2015 Poultry H5N1 In Israel Matches Egypt
http://fluboard.rhizalabs.com/forum/viewtopic.php?f=5&t=14143
Page 1 of 1

Author:  niman [ Wed Jul 15, 2015 6:45 am ]
Post subject:  2015 Poultry H5N1 In Israel Matches Egypt

Kimron Veterinari Institute in Israel has released 2015 H5N1 poultry H5 and N1 sequences which match human and poultry sequences in Egypt.

Author:  niman [ Wed Jul 15, 2015 6:46 am ]
Post subject:  Re: 2015 Poultry H5N1 In Israel Matches Egypt

LOCUS KR701618 1641 bp cRNA linear VRL 10-JUN-2015
DEFINITION Influenza A virus (A/turkey/Israel/174/2015(H5N1)) segment 4
hemagglutinin (HA) gene, partial cds.
ACCESSION KR701618
VERSION KR701618.1 GI:827500810
KEYWORDS .
SOURCE Influenza A virus (A/turkey/Israel/174/2015(H5N1))
ORGANISM Influenza A virus (A/turkey/Israel/174/2015(H5N1))
Viruses; ssRNA viruses; ssRNA negative-strand viruses;
Orthomyxoviridae; Influenzavirus A.
REFERENCE 1 (bases 1 to 1641)
AUTHORS Shkoda,I., Lapin,K., Simanov,L. and Lublin,A.
TITLE Highly pathogenic avian influenza A virus H5N1 isolated in Israel
2015
JOURNAL Unpublished
REFERENCE 2 (bases 1 to 1641)
AUTHORS Shkoda,I., Lapin,K., Simanov,L. and Lublin,A.
TITLE Direct Submission
JOURNAL Submitted (12-MAY-2015) Division of Avian Diseases, Kimron
Veterinari Institute, P.O.Box 12, Bet Dagan 50250, Israel
COMMENT ##Assembly-Data-START##
Assembly Method :: SeqMan DNAStar v. DNASTAR Lasergene 8
Sequencing Technology :: IonTorrent
##Assembly-Data-END##
FEATURES Location/Qualifiers
source 1..1641
/organism="Influenza A virus
(A/turkey/Israel/174/2015(H5N1))"
/mol_type="viral cRNA"
/strain="A/turkey/Israel/174/2015"
/serotype="H5N1"
/isolation_source="trachea swab"
/host="turkey"
/db_xref="taxon:1653491"
/segment="4"
/country="Israel"
/collection_date="29-Jan-2015"
/note="passage details: E1"
gene <1..>1641
/gene="HA"
CDS <1..>1641
/gene="HA"
/note="receptor binding and fusion protein"
/codon_start=1
/product="hemagglutinin"
/protein_id="AKJ83269.1"
/db_xref="GI:827500811"
/translation="QICIGYHANNSTEQVDTIMEKNVTVTHAQDILEKTHNGKLCNLD
GVKPLILRDCSVAGWLLGNPMCDEFLNVPEWSYIVEKINPANDLCYPGNFNDYEELKH
LLSRINHFEKIQIIPKDSWSDHEASGVSSACPYQGRSSFFRSVVWLTKKNDAYPTIKK
SYYNTNQEDLLVLWGIHHPNDAAEQTRLYQNPTTYISVGTSTLNQRLVPKIATRSKVN
GQSGRMEFFWTILKSNDAINFESNGNFIAPENAYKIVKKGDSTIMKSELEYSNCNTKC
QTPIGAINSSMPFHNIHPLTIGECPKYVKSNRLVLATGLRNSPQGEKRRKKRGLFGAI
AGFIEGGWQGMVDGWYGYHHSNEQGSGYAADKESTQRAIDGVTNKVNSIIDKMNTQFE
AVGREFNNLERRIENLNKKMEDGFLDVWTYNAELLVLMENERTLDFHDSNVKNLYDKV
RLQLRDNAKELGNGCFEFYHRCDNECMESVRNGTYDYPQYSEEARLKREEISGVKLES
IGTYQILSIYSTVASSLALAIMVAGLSLWMCSNGSLQCR"
ORIGIN
1 cagatttgca ttggttacca tgcaaacaac tcgacagagc aggttgacac aataatggaa
61 aagaacgtca ctgttacaca cgcccaagac atactggaaa agacacacaa cgggaaactc
121 tgcaatctag atggagtgaa gcctctcatt ttaagagatt gtagtgtagc tggatggctc
181 ctcgggaacc caatgtgcga tgaattcctc aatgtgccgg aatggtctta catagtggag
241 aaaatcaatc cagccaatga cctctgttat ccagggaatt tcaacgacta tgaagaactg
301 aaacacttat tgagcagaat aaaccatttt gagaaaattc agatcattcc caaagattct
361 tggtcagatc atgaagcctc aggagtgagc tcagcatgcc cataccaagg aagatcctcc
421 ttttttagaa gtgttgtatg gcttaccaaa aagaacgatg catacccaac aataaagaaa
481 agttactata atactaacca agaagatctt ttggtactat gggggattca ccatccaaat
541 gatgctgcag agcagacaag gctttatcaa aacccaacta cctatatctc cgttgggaca
601 tcaacactaa accagagatt ggtacccaaa atagctacta gatctaaggt aaacgggcaa
661 agtggaagga tggagttctt ttggacaatt ttaaaatcga atgatgcaat aaactttgag
721 agcaatggaa acttcattgc tccagaaaat gcatacaaaa ttgtcaagaa aggagattca
781 acaattatga aaagtgagtt ggaatatagt aactgcaaca ccaagtgtca gactccaata
841 ggggcgataa actccagtat gccattccac aacatccacc ctctcaccat cggggaatgc
901 cccaaatatg tgaaatcaaa cagattagtt cttgctactg ggctcaggaa tagccctcaa
961 ggagagaaaa gaagaaaaaa gagaggacta ttcggagcca tagcaggctt tatagaggga
1021 ggatggcagg gaatggtaga tggttggtat gggtaccacc atagcaacga gcaggggagt
1081 gggtacgctg cagacaaaga atccactcaa agggctatag atggagtcac caataaggtc
1141 aattcgatca ttgacaaaat gaacactcag tttgaggctg ttggaaggga atttaataac
1201 ttagaaagga gaatagaaaa tttaaacaag aagatggaag acggattcct agatgtctgg
1261 acttataatg ctgaacttct ggttctcatg gaaaatgaga gaactctaga ctttcatgac
1321 tcaaatgtca agaatcttta tgacaaggtc cgactacagc ttagggataa tgcaaaggag
1381 cttggtaacg gttgtttcga gttctatcac agatgtgata atgaatgtat ggaaagtgta
1441 agaaacggaa cgtatgacta ccctcaatat tcagaagaag caagattaaa aagagaggaa
1501 ataagtggag taaaattgga gtcaatagga acttaccaaa tactgtcaat ttattcaaca
1561 gtggcgagct ccctagcact ggcaatcatg gtggctggtc tatctttatg gatgtgctcc
1621 aatggatcgc tacaatgcag a

Author:  niman [ Wed Jul 15, 2015 6:47 am ]
Post subject:  Re: 2015 Poultry H5N1 In Israel Matches Egypt

EPI608782 A/turkey/Israel/174/2015 (A/H5N1) segment 4 (HA) 3031.5 0.000000e+00 1641/1641 (100%)
EPI608783 A/turkey/Israel/188/2015 (A/H5N1) segment 4 (HA) 3020.4 0.000000e+00 1639/1641 (99%)
EPI608777 A/turkey/Israel/107/2015 (A/H5N1) segment 4 (HA) 3020.4 0.000000e+00 1639/1641 (99%)
EPI608786 A/turkey/Israel/209/2015 (A/H5N1) segment 4 (HA) 3014.9 0.000000e+00 1638/1641 (99%)
EPI608781 A/turkey/Israel/274/2015 (A/H5N1) segment 4 (HA) 3011.2 0.000000e+00 1636/1639 (99%)
EPI608778 A/chicken/Israel/88/2015 (A/H5N1) segment 4 (HA) 3009.3 0.000000e+00 1637/1641 (99%)
EPI584778 A/chicken/Egypt/A10351A/2014 (A/H5N1) segment 4 (HA) 2998.2 0.000000e+00 1635/1641 (99%)
EPI608787 A/spur-winged lapwing/Israel/101/2015 (A/H5N1) segment 4 (HA) 2992.7 0.000000e+00 1634/1641 (99%)
EPI608780 A/turkey/Jenin/39/2015 (A/H5N1) segment 4 (HA) 2992.7 0.000000e+00 1634/1641 (99%)
EPI579781 A/duck/Egypt/CLEVB-25_N00239/2015 (A/H5N1) segment 4 (HA) 2992.7 0.000000e+00 1634/1641 (99%)
EPI579780 A/duck/Egypt/CLEVB-24_N00238/2015 (A/H5N1) segment 4 (HA) 2992.7 0.000000e+00 1634/1641 (99%)
EPI573252 A/Turkey/Egypt/AR235-S240NLQP/2014 (A/H5N1) segment 4 (HA) 2992.7 0.000000e+00 1634/1641 (99%)
EPI573244 A/chicken/Egypt/AR231-CA113NLQP/2014 (A/H5N1) segment 4 (HA) 2992.7 0.000000e+00 1634/1641 (99%)
EPI579006 A/chicken/Egypt/CLEVB-1_N00215/2014 (A/H5N1) segment 4 (HA) 2989.0 0.000000e+00 1633/1641 (99%)
EPI608784 A/chicken/Israel/333/2015 (A/H5N1) segment 4 (HA) 2987.2 0.000000e+00 1633/1641 (99%)
EPI608779 A/chicken/Qalqilya/53/2015 (A/H5N1) segment 4 (HA) 2987.2 0.000000e+00 1633/1641 (99%)
EPI574132 A/Egypt/MOH-NRC-7305/2014 (A/H5N1) segment 4 (HA) 2987.2 0.000000e+00 1633/1641 (99%)
EPI573268 A/Turkey/Egypt/AR238-SD177NLQP/2014 (A/H5N1) segment 4 (HA) 2987.2 0.000000e+00 1633/1641 (99%)
EPI573250 A/chicken/Egypt/AR234-FAOF8NLQP/2014 (A/H5N1) segment 4 (HA) 2987.2 0.000000e+00 1633/1641 (99%)
EPI573248 A/chicken/Egypt/AR233-S283NLQP/2014 (A/H5N1) segment 4 (HA) 2987.2 0.000000e+00 1633/1641 (99%)
EPI557138 A/Quail/Egypt/BSU5514-AR2219/2014 (A/H5N1) segment 4 (HA) 2987.2 0.000000e+00 1633/1641 (99%)
EPI579784 A/chicken/Egypt/CLEVB-18_N00232/2015 (A/H5N1) segment 4 (HA) 2981.6 0.000000e+00 1632/1641 (99%)
EPI579783 A/chicken/Egypt/CLEVB-21_N00235/2015 (A/H5N1) segment 4 (HA) 2981.6 0.000000e+00 1632/1641 (99%)
EPI579782 A/chicken/Egypt/CLEVB-20_N00234/2015 (A/H5N1) segment 4 (HA) 2981.6 0.000000e+00 1632/1641 (99%)
EPI579520 A/chicken/Egypt/CLEVB-17_N00231/2015 (A/H5N1) segment 4 (HA) 2981.6 0.000000e+00 1632/1641 (99%)
EPI579325 A/chicken/Egypt/CLEVB-16_N00230/2014 (A/H5N1) segment 4 (HA) 2981.6 0.000000e+00 1632/1641 (99%)
EPI579324 A/chicken/Egypt/CLEVB-19_N00233/2015 (A/H5N1) segment 4 (HA) 2981.6 0.000000e+00 1632/1641 (99%)
EPI608785 A/chicken/Israel/156/2015 (A/H5N1) segment 4 (HA) 2976.1 0.000000e+00 1631/1641 (99%)
EPI573260 A/Duck/Egypt/AR236-A3NLQP/2015 (A/H5N1) segment 4 (HA) 2976.1 0.000000e+00 1631/1641 (99%)
EPI573321 A/chicken/Egypt/153AF/2015 (A/H5N1) segment 4 (HA) 2968.7 0.000000e+00 1621/1628 (99%)
EPI574125 A/Egypt/MOH-NRC-7271/2014 (A/H5N1) segment 4 (HA) 2965.0 0.000000e+00 1629/1641 (99%)
EPI573246 A/Duck/Egypt/AR232-A13NLQP/2014 (A/H5N1) segment 4 (HA) 2965.0 0.000000e+00 1629/1641 (99%)
EPI573328 A/chicken/Egypt/14168CA/2014 (A/H5N1) segment 4 (HA) 2961.3 0.000000e+00 1615/1621 (99%)
EPI573315 A/duck/Egypt/BS-146RS-f6/2014 (A/H5N1) segment 4 (HA) 2957.6 0.000000e+00 1615/1622 (99%)
EPI584783 A/Egypt/MOH-NRC-8434/2014 (A/H5N1) segment 4 (HA) 2953.9 0.000000e+00 1627/1641 (99%)
EPI573330 A/chicken/Egypt/1476CA/2014 (A/H5N1) segment 4 (HA) 2948.4 0.000000e+00 1614/1623 (99%)
EPI573322 A/chicken/Egypt/152RS/2015 (A/H5N1) segment 4 (HA) 2944.7 0.000000e+00 1613/1623 (99%)
EPI573318 A/chicken/Egypt/1478CAL/2014 (A/H5N1) segment 4 (HA) 2944.7 0.000000e+00 1606/1612 (99%)
EPI550493 A/duck/Egypt/14VIR784-4-133AD/2013 (A/H5N1) segment 4 (HA) 2942.8 0.000000e+00 1625/1641 (99%)
EPI573319 A/chicken/Egypt/152/2015 (A/H5N1) segment 4 (HA) 2931.8 0.000000e+00 1609/1620 (99%)
EPI557194 A/Duck/Egypt/NLQP27SG-AR750/2013 (A/H5N1) segment 4 (HA) 2931.8 0.000000e+00 1623/1641 (98%)
EPI557178 A/chicken/Egypt/NLQP33SD-AR748/2013 (A/H5N1) segment 4 (HA) 2926.2 0.000000e+00 1623/1642 (98%)
EPI500079 A/goose/Egypt/M7221D/2013 (A/H5N1) segment 4 (HA) 2920.7 0.000000e+00 1621/1641 (98%)
EPI500078 A/chicken/Egypt/M7217A/2013 (A/H5N1) segment 4 (HA) 2920.7 0.000000e+00 1621/1641 (98%)
EPI487342 A/chicken/Egypt/M7217B/2013 (A/H5N1) segment 4 (HA) 2920.7 0.000000e+00 1621/1641 (98%)
EPI557218 A/chicken/Egypt/NLQP139V-AR753/2013 (A/H5N1) segment 4 (HA) 2915.1 0.000000e+00 1620/1641 (98%)
EPI574389 A/Turkey/Egypt/14240FAOS/2014 (A/H5N1) segment 4 (HA) 2911.4 0.000000e+00 1600/1611 (99%)
EPI500109 A/chicken/Egypt/Q5283C/2012 (A/H5N1) segment 4 (HA) 2911.4 0.000000e+00 1619/1641 (98%)
EPI504991 A/chicken/Egypt/BSU-BS-R24/2012 (A/H5N1) segment 4 (HA) 2909.6 0.000000e+00 1619/1641 (98%)
EPI504990 A/chicken/Egypt/BSU-BS-F27/2012 (A/H5N1) segment 4 (HA) 2909.6 0.000000e+00 1619/1641 (98%)
EPI348153 A/chicken/Egypt/11VIR4453-266/2010 (A/H5N1) segment 4 (HA) 2905.9 0.000000e+00 1618/1641 (98%)
EPI597822 A/duck/Egypt/1471SG/2014 (A/H5N1) segment 4 (HA) 2904.1 0.000000e+00 1619/1642 (98%)
EPI500082 A/duck/Egypt/M7218B/2013 (A/H5N1) segment 4 (HA) 2904.1 0.000000e+00 1619/1642 (98%)
EPI340133 A/goose/Egypt/1117SF/2011 (A/H5N1) segment 4 (HA) 2904.1 0.000000e+00 1618/1641 (98%)
EPI600754 A/chicken/Egypt/N05832-CLEVB754/2011 (A/H5N1) segment 4 (HA) 2898.5 0.000000e+00 1617/1641 (98%)
EPI597815 A/turkey/Egypt/1438S/2014 (A/H5N1) segment 4 (HA) 2898.5 0.000000e+00 1617/1641 (98%)
EPI348158 A/chicken/Egypt/11VIR4453-109/VRLCU/2011 (A/H5N1) segment 4 (HA) 2898.5 0.000000e+00 1617/1641 (98%)
EPI348157 A/chicken/Egypt/11VIR4453-15/VRLCU/2010 (A/H5N1) segment 4 (HA) 2898.5 0.000000e+00 1617/1641 (98%)
EPI340135 A/chicken/Egypt/1113/2011 (A/H5N1) segment 4 (HA) 2898.5 0.000000e+00 1617/1641 (98%)
EPI340104 A/chicken/Egypt/117AD/2011 (A/H5N1) segment 4 (HA) 2898.5 0.000000e+00 1617/1641 (98%)
EPI338733 A/duck/Egypt/M2583B/2010 (A/H5N1) segment 4 (HA) 2898.5 0.000000e+00 1618/1642 (98%)
EPI338732 A/duck/Egypt/M2583C/2010 (A/H5N1) segment 4 (HA) 2898.5 0.000000e+00 1618/1642 (98%)
EPI338616 A/duck/Egypt/M2583D/2010 (A/H5N1) segment 4 (HA) 2898.5 0.000000e+00 1618/1642 (98%)
EPI597818 A/chicken/Egypt/1461S/2014 (A/H5N1) segment 4 (HA) 2893.0 0.000000e+00 1616/1641 (98%)
EPI597812 A/chicken/Egypt/1422S/2014 (A/H5N1) segment 4 (HA) 2893.0 0.000000e+00 1616/1641 (98%)
EPI557136 A/Turkey/Egypt/BSU5114-AR2218/2014 (A/H5N1) segment 4 (HA) 2893.0 0.000000e+00 1616/1641 (98%)
EPI372907 A/Egypt/N7562/2011 (A/H5N1) segment 4 (HA) 2893.0 0.000000e+00 1617/1642 (98%)
EPI348152 A/chicken/Egypt/11VIR4453-268/2010 (A/H5N1) segment 4 (HA) 2893.0 0.000000e+00 1616/1641 (98%)
EPI348148 A/chicken/Egypt/11VIR4453-59/VRLCU/2011 (A/H5N1) segment 4 (HA) 2893.0 0.000000e+00 1616/1641 (98%)
EPI340138 A/duck/Egypt/1125S/2011 (A/H5N1) segment 4 (HA) 2893.0 0.000000e+00 1616/1641 (98%)
EPI340101 A/chicken/Egypt/1112AF/2011 (A/H5N1) segment 4 (HA) 2893.0 0.000000e+00 1616/1641 (98%)
EPI340087 A/duck/Egypt/11193SF/2011 (A/H5N1) segment 4 (HA) 2893.0 0.000000e+00 1616/1641 (98%)
EPI340085 A/chicken/Egypt/1118AF/2011 (A/H5N1) segment 4 (HA) 2893.0 0.000000e+00 1616/1641 (98%)
EPI338615 A/duck/Egypt/Q2645C/2010 (A/H5N1) segment 4 (HA) 2893.0 0.000000e+00 1616/1641 (98%)
EPI538767 A/chicken/Egypt/13VIR-2962-109/2013 (A/H5N1) segment 4 (HA) 2891.1 0.000000e+00 1615/1640 (98%)
EPI603902 A/chicken/Egypt/1439CAL/2014 (A/H5N1) segment 4 (HA) 2887.4 0.000000e+00 1616/1642 (98%)
EPI603901 A/chicken/Egypt/1436CAL/2014 (A/H5N1) segment 4 (HA) 2887.4 0.000000e+00 1616/1642 (98%)
EPI597825 A/turkey/Egypt/1414CAL/2014 (A/H5N1) segment 4 (HA) 2887.4 0.000000e+00 1615/1641 (98%)
EPI597823 A/turkey/Egypt/14125S/2014 (A/H5N1) segment 4 (HA) 2887.4 0.000000e+00 1616/1642 (98%)
EPI597816 A/duck/Egypt/1435CAS/2014 (A/H5N1) segment 4 (HA) 2887.4 0.000000e+00 1616/1642 (98%)
EPI550507 A/duck/Egypt/14VIR784-8-1339S/2013 (A/H5N1) segment 4 (HA) 2887.4 0.000000e+00 1615/1641 (98%)
EPI537618 A/Egypt/N01754/2014 (A/H5N1) segment 4 (HA) 2887.4 0.000000e+00 1615/1641 (98%)
EPI373013 A/Egypt/N00166/2011 (A/H5N1) segment 4 (HA) 2887.4 0.000000e+00 1616/1642 (98%)
EPI348160 A/chicken/Egypt/11VIR4453-267/2010 (A/H5N1) segment 4 (HA) 2887.4 0.000000e+00 1615/1641 (98%)
EPI348155 A/chicken/Egypt/11VIR4453-68/VRLCU/2011 (A/H5N1) segment 4 (HA) 2887.4 0.000000e+00 1615/1641 (98%)
EPI340151 A/chicken/Egypt/10513S/2010 (A/H5N1) segment 4 (HA) 2887.4 0.000000e+00 1615/1641 (98%)
EPI340106 A/duck/Egypt/1110AF/2011 (A/H5N1) segment 4 (HA) 2887.4 0.000000e+00 1615/1641 (98%)
EPI340103 A/chicken/Egypt/111766V/2011 (A/H5N1) segment 4 (HA) 2887.4 0.000000e+00 1615/1641 (98%)
EPI340102 A/chicken/Egypt/1134SD/2011 (A/H5N1) segment 4 (HA) 2887.4 0.000000e+00 1615/1641 (98%)
EPI348156 A/chicken/Egypt11VIR4453-269/2010 (A/H5N1) segment 4 (HA) 2885.6 0.000000e+00 1614/1641 (98%)
EPI603916 A/duck/Egypt/154FAOFL/2015 (A/H5N1) segment 4 (HA) 2883.7 0.000000e+00 1580/1589 (99%)
EPI373020 A/Egypt/N08932/2010 (A/H5N1) segment 4 (HA) 2883.7 0.000000e+00 1614/1641 (98%)
EPI348151 A/chicken/Egypt/11VIR4453-270/2010 (A/H5N1) segment 4 (HA) 2883.7 0.000000e+00 1614/1641 (98%)
EPI603900 A/turkey/Egypt/1419FAOS/2014 (A/H5N1) segment 4 (HA) 2881.9 0.000000e+00 1614/1641 (98%)
EPI597817 A/chicken/Egypt/1460S/2014 (A/H5N1) segment 4 (HA) 2881.9 0.000000e+00 1615/1642 (98%)
EPI597814 A/chicken/Egypt/1429S/2014 (A/H5N1) segment 4 (HA) 2881.9 0.000000e+00 1615/1642 (98%)
EPI460395 A/chicken/Egypt/1094/2010 (A/H5N1) segment 4 (HA) 2881.9 0.000000e+00 1614/1641 (98%)
EPI373016 A/Egypt/N10954/2010 (A/H5N1) segment 4 (HA) 2881.9 0.000000e+00 1614/1641 (98%)
EPI373012 A/Egypt/N04286/2011 (A/H5N1) segment 4 (HA) 2881.9 0.000000e+00 1614/1641 (98%)
EPI373011 A/Egypt/N04288/2011 (A/H5N1) segment 4 (HA) 2881.9 0.000000e+00 1614/1641 (98%)

Author:  niman [ Wed Jul 15, 2015 6:56 am ]
Post subject:  Re: 2015 Poultry H5N1 In Israel Matches Egypt

EPI584780 A/chicken/Egypt/A10351A/2014 (A/H5N1) segment 6 (NA) 2488.6 0.000000e+00 1384/1401 (98%)
EPI574134 A/Egypt/MOH-NRC-7305/2014 (A/H5N1) segment 6 (NA) 2483.0 0.000000e+00 1383/1401 (98%)
EPI574127 A/Egypt/MOH-NRC-7271/2014 (A/H5N1) segment 6 (NA) 2477.5 0.000000e+00 1382/1401 (98%)
EPI493506 A/chicken/Egypt/Q5283C/2012 (A/H5N1) segment 6 (NA) 2438.7 0.000000e+00 1375/1401 (98%)
EPI493446 A/chicken/Egypt/M7217B/2013 (A/H5N1) segment 6 (NA) 2416.5 0.000000e+00 1372/1402 (97%)
EPI493559 A/chicken/Egypt/M2773A/2011 (A/H5N1) segment 6 (NA) 2412.8 0.000000e+00 1369/1399 (97%)
EPI493499 A/chicken/Egypt/S2938D/2011 (A/H5N1) segment 6 (NA) 2411.0 0.000000e+00 1370/1401 (97%)
EPI336859 A/turkey/Jenin/341/2011 (A/H5N1) segment 6 (NA) 2409.2 0.000000e+00 1371/1403 (97%)
EPI493398 A/chicken/Egypt/S3280D/2011 (A/H5N1) segment 6 (NA) 2401.8 0.000000e+00 1367/1399 (97%)
EPI493279 A/duck/Egypt/M2583A/2010 (A/H5N1) segment 6 (NA) 2399.9 0.000000e+00 1368/1401 (97%)
EPI493207 A/goose/Egypt/M2788A/2011 (A/H5N1) segment 6 (NA) 2399.9 0.000000e+00 1368/1401 (97%)
EPI493356 A/duck/Egypt/M2583D/2010 (A/H5N1) segment 6 (NA) 2396.2 0.000000e+00 1366/1399 (97%)
EPI493056 A/duck/Egypt/M2583C/2010 (A/H5N1) segment 6 (NA) 2396.2 0.000000e+00 1366/1399 (97%)
EPI557137 A/Quail/Egypt/BSU5514-AR2219/2014 (A/H5N1) segment 6 (NA) 2394.4 0.000000e+00 1333/1350 (98%)
EPI493194 A/duck/Egypt/M2583B/2010 (A/H5N1) segment 6 (NA) 2390.7 0.000000e+00 1363/1396 (97%)
EPI493127 A/duck/Egypt/M3075B/2011 (A/H5N1) segment 6 (NA) 2390.7 0.000000e+00 1365/1399 (97%)
EPI573259 A/Duck/Egypt/AR236-A3NLQP/2015 (A/H5N1) segment 6 (NA) 2388.8 0.000000e+00 1332/1350 (98%)
EPI573249 A/chicken/Egypt/AR234-FAOF8NLQP/2014 (A/H5N1) segment 6 (NA) 2388.8 0.000000e+00 1332/1350 (98%)
EPI573267 A/Turkey/Egypt/AR238-SD177NLQP/2014 (A/H5N1) segment 6 (NA) 2383.3 0.000000e+00 1331/1350 (98%)
EPI573251 A/Turkey/Egypt/AR235-S240NLQP/2014 (A/H5N1) segment 6 (NA) 2383.3 0.000000e+00 1331/1350 (98%)
EPI573247 A/chicken/Egypt/AR233-S283NLQP/2014 (A/H5N1) segment 6 (NA) 2377.8 0.000000e+00 1330/1350 (98%)
EPI573245 A/Duck/Egypt/AR232-A13NLQP/2014 (A/H5N1) segment 6 (NA) 2377.8 0.000000e+00 1330/1350 (98%)
EPI573243 A/chicken/Egypt/AR231-CA113NLQP/2014 (A/H5N1) segment 6 (NA) 2377.8 0.000000e+00 1330/1350 (98%)
EPI493348 A/chicken/Egypt/S3280B/2011 (A/H5N1) segment 6 (NA) 2374.1 0.000000e+00 1352/1384 (97%)
EPI574388 A/Turkey/Egypt/14240FAOS/2014 (A/H5N1) segment 6 (NA) 2372.2 0.000000e+00 1329/1350 (98%)
EPI493067 A/chicken/Egypt/S3093A/2011 (A/H5N1) segment 6 (NA) 2363.0 0.000000e+00 1360/1399 (97%)
EPI493363 A/goose/Egypt/M2788E/2011 (A/H5N1) segment 6 (NA) 2361.1 0.000000e+00 1349/1383 (97%)
EPI493169 A/duck/Egypt/Q4596A/2012 (A/H5N1) segment 6 (NA) 2357.4 0.000000e+00 1359/1399 (97%)
EPI493342 A/goose/Egypt/M2794A/2011 (A/H5N1) segment 6 (NA) 2353.8 0.000000e+00 1343/1376 (97%)
EPI557177 A/chicken/Egypt/NLQP33SD-AR748/2013 (A/H5N1) segment 6 (NA) 2350.1 0.000000e+00 1325/1350 (98%)
EPI538814 A/chicken/Egypt/13VIR-2962-203/2013 (A/H5N1) segment 6 (NA) 2350.1 0.000000e+00 1326/1352 (98%)
EPI538798 A/chicken/Egypt/13VIR-2962-199/2013 (A/H5N1) segment 6 (NA) 2350.1 0.000000e+00 1326/1352 (98%)
EPI493432 A/chicken/Egypt/S3280E/2011 (A/H5N1) segment 6 (NA) 2350.1 0.000000e+00 1339/1371 (97%)
EPI538790 A/chicken/Egypt/13VIR-2962-198/2013 (A/H5N1) segment 6 (NA) 2348.2 0.000000e+00 1326/1352 (98%)
EPI557193 A/Duck/Egypt/NLQP27SG-AR750/2013 (A/H5N1) segment 6 (NA) 2344.5 0.000000e+00 1324/1350 (98%)
EPI550502 A/duck/Egypt/14VIR784-6-1328S/2013 (A/H5N1) segment 6 (NA) 2344.5 0.000000e+00 1325/1352 (98%)
EPI537619 A/Egypt/N01754/2014 (A/H5N1) segment 6 (NA) 2339.0 0.000000e+00 1325/1353 (97%)
EPI493404 A/chicken/Egypt/S3802B/2011 (A/H5N1) segment 6 (NA) 2339.0 0.000000e+00 1355/1398 (96%)
EPI493080 A/chicken/Egypt/S3806D/2011 (A/H5N1) segment 6 (NA) 2339.0 0.000000e+00 1355/1398 (96%)
EPI504999 A/chicken/Egypt/BSU-BS-R24/2012 (A/H5N1) segment 6 (NA) 2337.1 0.000000e+00 1324/1352 (97%)
EPI504998 A/chicken/Egypt/BSU-BS-F27/2012 (A/H5N1) segment 6 (NA) 2337.1 0.000000e+00 1324/1352 (97%)
EPI504997 A/chicken/Egypt/BSU-FA-M28/2012 (H5N1) (A/H5N1) segment 6 (NA) 2337.1 0.000000e+00 1324/1352 (97%)
EPI536596 A/Egypt/N01753/2014 (A/H5N1) segment 6 (NA) 2333.4 0.000000e+00 1324/1353 (97%)
EPI550508 A/duck/Egypt/14VIR784-8-1339S/2013 (A/H5N1) segment 6 (NA) 2331.6 0.000000e+00 1323/1352 (97%)
EPI338186 A/harrier/Israel/531/2011 (A/H5N1) segment 6 (NA) 2331.6 0.000000e+00 1335/1370 (97%)
EPI557135 A/Turkey/Egypt/BSU5114-AR2218/2014 (A/H5N1) segment 6 (NA) 2327.9 0.000000e+00 1321/1350 (97%)
EPI538774 A/duck/Egypt/13VIR-2962-195/2013 (A/H5N1) segment 6 (NA) 2327.9 0.000000e+00 1322/1352 (97%)
EPI538782 A/duck/Egypt/13VIR-2962-196/2013 (A/H5N1) segment 6 (NA) 2326.1 0.000000e+00 1322/1352 (97%)
EPI372890 A/Egypt/N6828/2011 (A/H5N1) segment 6 (NA) 2324.2 0.000000e+00 1322/1353 (97%)
EPI550495 A/duck/Egypt/14VIR784-4-133AD/2013 (A/H5N1) segment 6 (NA) 2320.5 0.000000e+00 1295/1314 (98%)
EPI538806 A/chicken/Egypt/13VIR-2962-200/2013 (A/H5N1) segment 6 (NA) 2320.5 0.000000e+00 1302/1325 (98%)
EPI493471 A/goose/Egypt/M2794E/2011 (A/H5N1) segment 6 (NA) 2320.5 0.000000e+00 1337/1376 (97%)
EPI574380 A/Turkey/Egypt/14139FAOS/2014 (A/H5N1) segment 6 (NA) 2316.8 0.000000e+00 1319/1350 (97%)
EPI557217 A/chicken/Egypt/NLQP139V-AR753/2013 (A/H5N1) segment 6 (NA) 2316.8 0.000000e+00 1320/1351 (97%)
EPI557201 A/chicken/Egypt/NLQP20SL-AR751/2013 (A/H5N1) segment 6 (NA) 2316.8 0.000000e+00 1319/1350 (97%)
EPI372850 A/Egypt/N0544/2011 (A/H5N1) segment 6 (NA) 2316.8 0.000000e+00 1321/1353 (97%)
EPI387566 A/duck/Egypt/1113SD/2011 (A/H5N1) segment 6 (NA) 2315.0 0.000000e+00 1320/1352 (97%)
EPI538822 A/chicken/Egypt/13VIR-2962-204/2013 (A/H5N1) segment 6 (NA) 2311.3 0.000000e+00 1317/1349 (97%)
EPI493154 A/duck/Egypt/Q4596B/2012 (A/H5N1) segment 6 (NA) 2311.3 0.000000e+00 1334/1374 (97%)
EPI372882 A/Egypt/N6774/2011 (A/H5N1) segment 6 (NA) 2307.6 0.000000e+00 1319/1353 (97%)
EPI493531 A/duck/Egypt/Q2645C/2010 (A/H5N1) segment 6 (NA) 2305.7 0.000000e+00 1333/1373 (97%)
EPI493424 A/chicken/Egypt/S3806B/2011 (A/H5N1) segment 6 (NA) 2305.7 0.000000e+00 1337/1380 (96%)
EPI372866 A/Egypt/N6658/2011 (A/H5N1) segment 6 (NA) 2305.7 0.000000e+00 1319/1353 (97%)
EPI538766 A/chicken/Egypt/13VIR-2962-109/2013 (A/H5N1) segment 6 (NA) 2303.9 0.000000e+00 1318/1352 (97%)
EPI372874 A/Egypt/N0677/2011 (A/H5N1) segment 6 (NA) 2300.2 0.000000e+00 1318/1353 (97%)
EPI255419 A/Egypt/N14604/2009 (A/H5N1) segment 6 (NA) 2300.2 0.000000e+00 1319/1354 (97%)
EPI460396 A/chicken/Egypt/1094/2010 (A/H5N1) segment 6 (NA) 2296.5 0.000000e+00 1304/1334 (97%)
EPI372922 A/Egypt/N7724/2011 (A/H5N1) segment 6 (NA) 2296.5 0.000000e+00 1317/1353 (97%)
EPI398580 A/duck/Egypt/Q4596D/2012 (A/H5N1) segment 6 (NA) 2294.7 0.000000e+00 1325/1365 (97%)
EPI393784 A/Egypt/N00951/2012 (A/H5N1) segment 6 (NA) 2294.7 0.000000e+00 1317/1353 (97%)
EPI372962 A/Egypt/N10621/2011 (A/H5N1) segment 6 (NA) 2294.7 0.000000e+00 1317/1353 (97%)
EPI387571 A/chicken/Egypt/1158SF/2011 (A/H5N1) segment 6 (NA) 2292.8 0.000000e+00 1316/1352 (97%)
EPI393787 A/Egypt/N02137/2012 (A/H5N1) segment 6 (NA) 2289.1 0.000000e+00 1316/1353 (97%)
EPI372914 A/Egypt/N7592/2011 (A/H5N1) segment 6 (NA) 2289.1 0.000000e+00 1316/1353 (97%)
EPI372858 A/Egypt/N6322/2011 (A/H5N1) segment 6 (NA) 2289.1 0.000000e+00 1316/1353 (97%)
EPI255372 A/Egypt/N02127/2010 (A/H5N1) segment 6 (NA) 2289.1 0.000000e+00 1317/1354 (97%)
EPI372938 A/Egypt/N11126/2011 (A/H5N1) segment 6 (NA) 2283.6 0.000000e+00 1315/1353 (97%)
EPI372930 A/Egypt/N09966/2011 (A/H5N1) segment 6 (NA) 2283.6 0.000000e+00 1315/1353 (97%)
EPI372906 A/Egypt/N7562/2011 (A/H5N1) segment 6 (NA) 2283.6 0.000000e+00 1315/1353 (97%)
EPI255399 A/Egypt/N09174/2009 (A/H5N1) segment 6 (NA) 2283.6 0.000000e+00 1316/1354 (97%)
EPI255368 A/Egypt/N01982/2010 (A/H5N1) segment 6 (NA) 2283.6 0.000000e+00 1316/1354 (97%)
EPI115009 A/Egypt/0636-NAMRU3/2007 (A/H5N1) segment 6 (NA) 2281.7 0.000000e+00 1350/1405 (96%)
EPI573331 A/duck/Egypt/14154FAOS/2014 (A/H5N1) segment 6 (NA) 2279.9 0.000000e+00 1271/1288 (98%)
EPI557209 A/chicken/Egypt/NLQP639V-AR752/2013 (A/H5N1) segment 6 (NA) 2278.0 0.000000e+00 1313/1351 (97%)
EPI372954 A/Egypt/N14976/2011 (A/H5N1) segment 6 (NA) 2278.0 0.000000e+00 1315/1354 (97%)
EPI372946 A/Egypt/N11470/2011 (A/H5N1) segment 6 (NA) 2278.0 0.000000e+00 1315/1354 (97%)
EPI294611 A/chicken/Egypt/3982-20/2010 (A/H5N1) segment 6 (NA) 2276.2 0.000000e+00 1314/1353 (97%)
EPI294490 A/chicken/Egypt/1553-15/2010 (A/H5N1) segment 6 (NA) 2276.2 0.000000e+00 1314/1353 (97%)
EPI255387 A/Egypt/N05049/2009 (A/H5N1) segment 6 (NA) 2272.5 0.000000e+00 1314/1354 (97%)
EPI255376 A/Egypt/N02770/2010 (A/H5N1) segment 6 (NA) 2272.5 0.000000e+00 1314/1354 (97%)
EPI387567 A/goose/Egypt/1117SF/2011 (A/H5N1) segment 6 (NA) 2268.8 0.000000e+00 1289/1318 (97%)
EPI372714 A/Egypt/9538-NAMRU3/2009 (A/H5N1) segment 6 (NA) 2268.8 0.000000e+00 1313/1354 (96%)
EPI387570 A/duck/Egypt/1148SF/2011 (A/H5N1) segment 6 (NA) 2267.0 0.000000e+00 1294/1326 (97%)
EPI550488 A/chicken/Egypt/14VIR784-5-1318S/2013 (A/H5N1) segment 6 (NA) 2265.1 0.000000e+00 1312/1353 (96%)
EPI398574 A/duck/Egypt/Q4596C/2012 (A/H5N1) segment 6 (NA) 2265.1 0.000000e+00 1313/1355 (96%)
EPI294576 A/chicken/Egypt/3982-9/2010 (A/H5N1) segment 6 (NA) 2265.1 0.000000e+00 1312/1353 (96%)
EPI557185 A/chicken/Egypt/NLQP2AL-AR749/2013 (A/H5N1) segment 6 (NA) 2263.3 0.000000e+00 1309/1349 (97%)
EPI557169 A/chicken/Egypt/NLQP7FL-AR747/2013 (A/H5N1) segment 6 (NA) 2263.3 0.000000e+00 1309/1349 (97%)
EPI294569 A/chicken/Egypt/3982-5/2010 (A/H5N1) segment 6 (NA) 2257.7 0.000000e+00 1306/1346 (97%)
EPI622520 A/chicken/Egypt/07118-NLQP/2007 (A/H5N1) segment 6 (NA) 2255.9 0.000000e+00 1343/1402 (95%)

Page 1 of 1 All times are UTC - 5 hours [ DST ]
Powered by phpBB® Forum Software © phpBB Group
http://www.phpbb.com/