Rhiza Labs FluTracker Forum

The place to discuss the flu
It is currently Wed Oct 18, 2017 4:20 pm

All times are UTC - 5 hours [ DST ]




Post new topic Reply to topic  [ 9 posts ] 
Author Message
PostPosted: Fri Jul 24, 2015 8:15 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
A/chicken/Iowa/21981/2015 Fujian H5N2 sequences From Kossuth County

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Fri Jul 24, 2015 8:16 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
LOCUS KT280932 1744 bp cRNA linear VRL 21-JUL-2015
DEFINITION Influenza A virus (A/chicken/Iowa/21981/2015(H5N2)) segment 4
hemagglutinin (HA) gene, complete cds.
ACCESSION KT280932
VERSION KT280932.1 GI:890948541
KEYWORDS .
SOURCE Influenza A virus (A/chicken/Iowa/21981/2015(H5N2))
ORGANISM Influenza A virus (A/chicken/Iowa/21981/2015(H5N2))
Viruses; ssRNA viruses; ssRNA negative-strand viruses;
Orthomyxoviridae; Influenzavirus A.
REFERENCE 1 (bases 1 to 1744)
AUTHORS Arruda,P.H.E., Stevenson,G.W., Killian,M.L., Burrough,E.R.,
Gauger,P.C., Harmon,K.M., Magstadt,D.R., Yoon,K.-J., Zhang,J.,
Madison,D.M., Pineyro,P., Derscheid,R.J., Schwartz,K.J.,
Cooper,V.L., Halbur,P.G., Main,R.G., Sato,Y. and Arruda,B.L.
TITLE Natural outbreak of H5N2 highly pathogenic avian influenza virus in
2015 in two commercial layer facilities in Iowa: Lesions and viral
antigen distribution
JOURNAL Unpublished
REFERENCE 2 (bases 1 to 1744)
AUTHORS Killian,M.L., Gauger,P.C. and Yoon,K.-J.
TITLE Direct Submission
JOURNAL Submitted (14-JUL-2015) Diagnostic Virology Laboratory, National
Veterinary Services Laboratories (NVSL), USDA APHIS VS, 1920 Dayton
Avenue, Ames, IA 50010, USA
COMMENT GenBank Accession Numbers KT280929-KT280936 represent sequences
from the 8 segments of Influenza A virus
(A/chicken/Iowa/21981/2015(H5N2)).

##Assembly-Data-START##
Assembly Method :: SeqMan NGen v. v4
Sequencing Technology :: IonTorrent
##Assembly-Data-END##
FEATURES Location/Qualifiers
source 1..1744
/organism="Influenza A virus
(A/chicken/Iowa/21981/2015(H5N2))"
/mol_type="viral cRNA"
/strain="A/chicken/Iowa/21981/2015"
/serotype="H5N2"
/isolation_source="OP swab; pooled sample"
/host="chicken; commercial"
/db_xref="taxon:1683477"
/segment="4"
/country="USA: Kossuth County, Iowa"
/collection_date="27-Apr-2015"
/note="NVSL 15-013775-5; EP1; Eurasian origin (EA-H5N8
clade 2.3.4.4)-North American reassortant"
gene 17..1720
/gene="HA"
CDS 17..1720
/gene="HA"
/function="receptor binding and fusion protein"
/codon_start=1
/product="hemagglutinin"
/protein_id="AKQ62713.1"
/db_xref="GI:890948542"
/translation="MEKIVLPFAVISLVKSDQICIGYHANNSTKQVDTIMEKNVTVTH
AQDILEKTHNGKLCDLNGVKPLILKDCSVAGWLLGNPICDEFIRVPEWSYIVERANPA
NDLCYPGTLNDYEELKHLLSRINHFEKTLIIPRSSWPNHETSLGVSAACPYQGAPSFF
RNVVWLIKKNDAYPTIKISYNNTNREDLLILWGIHHSNNAAEQTNLYKNPDTYVSVGT
STLNQRLVPKIATRSQVNGQSGRMDFFWTILKPNDAIHFESNGNFIAPEYAYKIVKKG
DSTIMKSEMEYGHCNTKCQTPIGAINSSMPFHNIHPLTIGECPKYVKSNKLVLATGLR
NSPQRERRRKRGLFGAIAGFIEGGWQGMVDGWYGYHHSNEQGSGYAADKESTQKAIDG
VTNKVNSIIDKMNTQFEAVGREFNNLERRIENLNKKMEDGFLDVWTYNAELLVLMENE
RTLDFHDSNVKNLYDKVRLQLRDNAKELGNGCFEFYHKCDNECMESVRNGTYDYPKYS
EEAILKREEISGVKLESIGTYQILSIYSTVASSLALAIIVAGLSLWMCSNGSLQCRIC
I"
mat_peptide 65..1051
/gene="HA"
/product="HA1"
mat_peptide 1052..1717
/gene="HA"
/product="HA2"
ORIGIN
1 ggttcaatct gtcaaaatgg agaaaatagt gcttcctttt gcagtgatta gccttgttaa
61 aagtgatcag atttgcattg gttaccatgc aaacaactca acaaagcagg ttgacacgat
121 aatggagaaa aacgtcactg ttacacatgc ccaagacata ctggaaaaga cacacaacgg
181 gaagctctgc gatcttaatg gagtgaagcc cctgattcta aaggattgta gcgtagctgg
241 gtggctcctt ggaaatccaa tatgcgacga gttcatcagg gtaccggaat ggtcttacat
301 cgtggagagg gctaacccag ccaacgacct ctgttaccca gggaccctca atgactacga
361 ggaactgaaa cacctattga gcagaataaa tcattttgag aaaactctga tcatccccag
421 gagttcttgg cccaatcatg aaacatcatt aggggtgagc gcagcatgtc cataccaggg
481 agcaccctca tttttcagaa atgtggtatg gctcatcaaa aagaacgatg catacccgac
541 aataaagata agctacaata ataccaatcg ggaagatctt ttgatactgt gggggattca
601 tcattccaac aatgcagcag agcagacaaa tctctataag aacccagaca cttatgtttc
661 cgttgggaca tcaacattaa accagagatt ggtgccaaaa atagctacta gatcccaagt
721 aaacgggcag agtggaagaa tggatttctt ctggacaatt ttaaaaccga atgatgcaat
781 ccactttgag agtaatggaa atttcattgc tccagaatat gcatacaaaa ttgtcaagaa
841 aggggactca acaattatga aaagtgaaat ggagtatggc cactgcaaca ccaaatgtca
901 aactccaata ggggcgataa actctagcat gccattccac aatatacacc ctctcaccat
961 cggggaatgc cccaaatacg tgaagtcaaa caaattagtc cttgcgactg ggctcagaaa
1021 tagtcctcaa agagaaagaa gaagaaaaag aggactattt ggagctatag cagggtttat
1081 agagggagga tggcagggaa tggtagacgg ttggtatggg tatcatcata gcaatgagca
1141 ggggagtggg tacgctgcag acaaagaatc aacccaaaag gcaatagatg gagttaccaa
1201 taaggtcaac tcaatcattg acaaaatgaa cactcaattt gaggccgttg gaagggaatt
1261 taataactta gaaaggagaa tagagaattt aaacaagaaa atggaagacg gattcctaga
1321 tgtctggact tataatgctg aacttttagt tctcatggaa aatgagagaa ctctagattt
1381 ccatgactca aatgtcaaga acctttacga caaagtccga ctacagctta gggataatgc
1441 aaaggagctg ggtaatggtt gtttcgagtt ctatcacaaa tgtgataacg aatgtatgga
1501 gagcgtaaga aatgggacgt atgactaccc taagtattca gaagaagcaa tattaaaaag
1561 agaagaaata agcggagtga aattagaatc aataggaact taccaaatac tgtcaattta
1621 ttcaacagtg gcgagttccc tagcactggc aatcatagtg gctggtctat ctttatggat
1681 gtgctctaat gggtcgttac aatgcagaat ttgcatctaa atttgtgagc tcagattgta
1741 atta

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Fri Jul 24, 2015 8:20 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
Align Segment-ID Name Score E-Value Identity
EPI620436 A/turkey/Iowa/14319-1/2015 (A/H5N2) segment 4 (HA) 3147.8 0.000000e+00 1704/1704 (100%)
EPI620457 A/chicken/Iowa/14589-1/2015 (A/H5N2) segment 4 (HA) 3142.3 0.000000e+00 1703/1704 (99%)
EPI620450 A/chicken/Iowa/14399-4/2015 (A/H5N2) segment 4 (HA) 3142.3 0.000000e+00 1703/1704 (99%)
EPI620443 A/chicken/Iowa/14322-6/2015 (A/H5N2) segment 4 (HA) 3142.3 0.000000e+00 1703/1704 (99%)
EPI620422 A/chicken/Iowa/13542-2/2015 (A/H5N2) segment 4 (HA) 3142.3 0.000000e+00 1703/1704 (99%)
EPI620415 A/turkey/Iowa/13541-1/2015 (A/H5N2) segment 4 (HA) 3142.3 0.000000e+00 1703/1704 (99%)
EPI620429 A/turkey/Iowa/14318-1/2015 (A/H5N2) segment 4 (HA) 3136.7 0.000000e+00 1702/1704 (99%)
EPI590740 A/turkey/Minnesota/9845-4/2015 (A/H5N2) segment 4 (HA) 3114.6 0.000000e+00 1698/1704 (99%)
EPI620408 A/turkey/Iowa/11762-1/2015 (A/H5N2) segment 4 (HA) 3109.0 0.000000e+00 1697/1704 (99%)
EPI590726 A/turkey/Arkansas/7791-1/2015 (A/H5N2) segment 4 (HA) 3109.0 0.000000e+00 1697/1704 (99%)
EPI586550 A/chicken/BC/FAV24/2014 (A/H5N2) segment 4 (HA) 3109.0 0.000000e+00 1697/1704 (99%)
EPI586518 A/chicken/BC/FAV20/2014 (A/H5N2) segment 4 (HA) 3109.0 0.000000e+00 1697/1704 (99%)
EPI586509 A/poultry/BC/FAV19/2014 (A/H5N2) segment 4 (HA) 3109.0 0.000000e+00 1697/1704 (99%)
EPI584079 A/turkey/BC/FAV14/2014 (A/H5N2) segment 4 (HA) 3109.0 0.000000e+00 1697/1704 (99%)
EPI573298 A/turkey/BC/FAV10/2014 (A/H5N2) segment 4 (HA) 3109.0 0.000000e+00 1697/1704 (99%)
EPI590733 A/chicken/Kansas/8395-3/2015 (A/H5N2) segment 4 (HA) 3103.5 0.000000e+00 1696/1704 (99%)
EPI590719 A/turkey/Missouri/7458-1/2015 (A/H5N2) segment 4 (HA) 3103.5 0.000000e+00 1696/1704 (99%)
EPI590685 A/turkey/Minnesota/9892-2/2015 (A/H5N2) segment 4 (HA) 3103.5 0.000000e+00 1696/1704 (99%)
EPI586542 A/chicken/BC/FAV23/2014 (A/H5N2) segment 4 (HA) 3103.5 0.000000e+00 1696/1704 (99%)
EPI586534 A/chicken/BC/FAV22/2014 (A/H5N2) segment 4 (HA) 3103.5 0.000000e+00 1697/1705 (99%)
EPI586526 A/chicken/BC/FAV21/2014 (A/H5N2) segment 4 (HA) 3103.5 0.000000e+00 1696/1704 (99%)
EPI586493 A/poultry/BC/FAV15/2014 (A/H5N2) segment 4 (HA) 3103.5 0.000000e+00 1696/1704 (99%)
EPI585092 A/pheasant/Washington/3147-2/2015 (A/H5N2) segment 4 (HA) 3103.5 0.000000e+00 1696/1704 (99%)
EPI576470 A/chicken/BC/FAV8/2014 (A/H5N2) segment 4 (HA) 3103.5 0.000000e+00 1696/1704 (99%)
EPI590712 A/turkey/Minnesota/7172-1/2015 (A/H5N2) segment 4 (HA) 3098.0 0.000000e+00 1695/1704 (99%)
EPI590699 A/chicken/Oregon/A01819044/2015 (A/H5N2) segment 4 (HA) 3098.0 0.000000e+00 1695/1704 (99%)
EPI590692 A/chicken/Washington/3490-18/2015 (A/H5N2) segment 4 (HA) 3098.0 0.000000e+00 1695/1704 (99%)
EPI587633 A/chicken/Iowa/04-20/2015 (A/H5N2) segment 4 (HA) 3098.0 0.000000e+00 1695/1704 (99%)
EPI586501 A/poultry/BC/FAV17/2014 (A/H5N2) segment 4 (HA) 3098.0 0.000000e+00 1695/1704 (99%)
EPI576477 A/chicken/BC/FAV9/2014 (A/H5N2) segment 4 (HA) 3098.0 0.000000e+00 1695/1704 (99%)
EPI573281 A/turkey/Washington/61-22/2014 (A/H5N2) segment 4 (HA) 3098.0 0.000000e+00 1695/1704 (99%)
EPI569383 A/Northern pintail/Washington/40964/2014 (A/H5N2) segment 4 (HA) 3098.0 0.000000e+00 1696/1705 (99%)
EPI586558 A/chicken/BC/FAV25/2014 (A/H5N2) segment 4 (HA) 3092.4 0.000000e+00 1694/1704 (99%)
EPI573271 A/chicken/Washington/61-9/2014 (A/H5N2) segment 4 (HA) 3092.4 0.000000e+00 1694/1704 (99%)
EPI573276 A/domestic duck/Washington/61-16/2014 (A/H5N2) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%)
EPI569390 A/gyrfalcon/Washington/41088-6/2014 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1693/1705 (99%)
EPI569376 A/guinea fowl/Oregon/41613-1/2014 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1693/1705 (99%)
EPI569372 A/chicken/Oregon/41613-2/2014 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1693/1705 (99%)
EPI588968 A/chicken/Taiwan/a174/2015 (A/H5N3) segment 4 (HA) 3075.8 0.000000e+00 1692/1705 (99%)
EPI587521 A/American wigeon/BC/050-31/2015 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1692/1705 (99%)
EPI585084 A/turkey/California/K1500169-1.2/2015 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1692/1705 (99%)
EPI573638 A/crane/Kagoshima/KU13/2014(H5N8) (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1692/1705 (99%)
EPI588960 A/duck/Taiwan/a043/2015 (A/H5N2) segment 4 (HA) 3070.3 0.000000e+00 1691/1705 (99%)
EPI588976 A/duck/Taiwan/a068/2015 (A/H5N8) segment 4 (HA) 3059.2 0.000000e+00 1689/1705 (99%)
EPI573286 A/American green-winged teal/Washington/195750/2014 (A/H5N1) segment 4 (HA) 3059.2 0.000000e+00 1689/1705 (99%)
EPI553208 A/crane/Kagoshima/KU1/2014 (A/H5N8) segment 4 (HA) 3049.9 0.000000e+00 1686/1703 (99%)
EPI573208 A/gadwall/Korea/H1351/2014 (A/H5N8) segment 4 (HA) 3048.1 0.000000e+00 1688/1706 (98%)
EPI561570 A/Baikal teal/Korea/H96/2014 (A/H5N8) segment 4 (HA) 3048.1 0.000000e+00 1687/1705 (98%)
EPI588952 A/goose/Taiwan/a015/2015 (A/H5N8) segment 4 (HA) 3042.6 0.000000e+00 1686/1705 (98%)
EPI585595 A/baikal teal/Korea/2417/2014 (A/H5N8) segment 4 (HA) 3042.6 0.000000e+00 1687/1706 (98%)
EPI585589 A/baikal teal/Korea/2399/2014 (A/H5N8) segment 4 (HA) 3042.6 0.000000e+00 1687/1706 (98%)
EPI585586 A/baikal teal/Korea/1456/2014 (A/H5N8) segment 4 (HA) 3042.6 0.000000e+00 1687/1706 (98%)
EPI573242 A/Common Teal/Korea/H844/2014 (A/H5N8) segment 4 (HA) 3042.6 0.000000e+00 1687/1706 (98%)
EPI561646 A/breeder duck/Korea/H249/2014 (A/H5N8) segment 4 (HA) 3042.6 0.000000e+00 1687/1706 (98%)
EPI561626 A/mallard/Korea/H207/2014 (A/H5N8) segment 4 (HA) 3042.6 0.000000e+00 1687/1706 (98%)
EPI561605 A/broiler duck/Korea/H145/2014 (A/H5N8) segment 4 (HA) 3042.6 0.000000e+00 1687/1706 (98%)
EPI561591 A/breeder duck/Korea/H128/2014 (A/H5N8) segment 4 (HA) 3042.6 0.000000e+00 1687/1706 (98%)
EPI561529 A/Baikal teal/Korea/H66/2014 (A/H5N8) segment 4 (HA) 3042.6 0.000000e+00 1687/1706 (98%)
EPI561508 A/bean goose/Korea/H53/2014 (A/H5N8) segment 4 (HA) 3042.6 0.000000e+00 1687/1706 (98%)
EPI561341 A/Baikal teal/Korea/H41/2014 (A/H5N8) segment 4 (HA) 3042.6 0.000000e+00 1687/1706 (98%)
EPI585594 A/baikal teal/Korea/2416/2014 (A/H5N8) segment 4 (HA) 3037.0 0.000000e+00 1686/1706 (98%)
EPI585592 A/baikal teal/Korea/2406/2014 (A/H5N8) segment 4 (HA) 3037.0 0.000000e+00 1686/1706 (98%)
EPI585591 A/baikal teal/Korea/2403/2014 (A/H5N8) segment 4 (HA) 3037.0 0.000000e+00 1686/1706 (98%)
EPI585590 A/baikal teal/Korea/2402/2014 (A/H5N8) segment 4 (HA) 3037.0 0.000000e+00 1686/1706 (98%)
EPI585582 A/baikal teal/Korea/1448/2014 (A/H5N8) segment 4 (HA) 3037.0 0.000000e+00 1686/1706 (98%)
EPI585581 A/baikal teal/Korea/1447/2014 (A/H5N8) segment 4 (HA) 3037.0 0.000000e+00 1686/1706 (98%)
EPI585579 A/baikal teal/Korea/1445/2014 (A/H5N8) segment 4 (HA) 3037.0 0.000000e+00 1686/1706 (98%)
EPI585577 A/baikal teal/Korea/1437/2014 (A/H5N8) segment 4 (HA) 3037.0 0.000000e+00 1686/1706 (98%)
EPI573199 A/breeder chicken/Korea/H1068/2014 (A/H5N8) segment 4 (HA) 3037.0 0.000000e+00 1686/1706 (98%)
EPI573197 A/chicken/Korea/H881/2014 (A/H5N8) segment 4 (HA) 3037.0 0.000000e+00 1686/1706 (98%)
EPI561674 A/bean goose/Korea/H328/2014 (A/H5N8) segment 4 (HA) 3037.0 0.000000e+00 1686/1706 (98%)
EPI561612 A/breeder duck/Korea/H158/2014 (A/H5N8) segment 4 (HA) 3037.0 0.000000e+00 1686/1706 (98%)
EPI561577 A/breeder chicken/Korea/H122/2014 (A/H5N8) segment 4 (HA) 3037.0 0.000000e+00 1686/1706 (98%)
EPI561563 A/Baikal teal/Korea/H84/2014 (A/H5N8) segment 4 (HA) 3037.0 0.000000e+00 1686/1706 (98%)
EPI561542 A/Baikal teal/Korea/H68/2014 (A/H5N8) segment 4 (HA) 3037.0 0.000000e+00 1686/1706 (98%)
EPI561522 A/broiler duck/Korea/H65/2014 (A/H5N8) segment 4 (HA) 3037.0 0.000000e+00 1686/1706 (98%)
EPI585593 A/baikal teal/Korea/2414/2014 (A/H5N8) segment 4 (HA) 3031.5 0.000000e+00 1685/1706 (98%)
EPI585587 A/baikal teal/Korea/1457/2014 (A/H5N8) segment 4 (HA) 3031.5 0.000000e+00 1685/1706 (98%)
EPI585584 A/baikal teal/Korea/1452/2014 (A/H5N8) segment 4 (HA) 3031.5 0.000000e+00 1685/1706 (98%)
EPI585583 A/baikal teal/Korea/1449/2014 (A/H5N8) segment 4 (HA) 3031.5 0.000000e+00 1685/1706 (98%)
EPI561705 A/bean goose/Korea/H40/2014 (A/H5N8) segment 4 (HA) 3031.5 0.000000e+00 1685/1706 (98%)
EPI561667 A/mallard/Korea/H297/2014 (A/H5N8) segment 4 (HA) 3031.5 0.000000e+00 1686/1707 (98%)
EPI561653 A/breeder chicken/Korea/H250/2014 (A/H5N8) segment 4 (HA) 3031.5 0.000000e+00 1685/1706 (98%)
EPI561633 A/white-fronted goose/Korea/H231/2014 (A/H5N8) segment 4 (HA) 3031.5 0.000000e+00 1685/1706 (98%)
EPI509704 A/broiler duck/Korea/Buan2/2014 (A/H5N8) segment 4 (HA) 3031.5 0.000000e+00 1685/1706 (98%)
EPI585580 A/baikal teal/Korea/1446/2014 (A/H5N8) segment 4 (HA) 3025.9 0.000000e+00 1684/1706 (98%)
EPI573200 A/Korean native chicken/Korea/H1139/2014 (A/H5N8) segment 4 (HA) 3025.9 0.000000e+00 1684/1706 (98%)
EPI573196 A/broiler duck/Korea/H651/2014 (A/H5N8) segment 4 (HA) 3025.9 0.000000e+00 1684/1706 (98%)
EPI573194 A/breeder chicken/Korea/H818/2014 (A/H5N8) segment 4 (HA) 3025.9 0.000000e+00 1684/1706 (98%)
EPI561697 A/spot-billed duck/Korea/H455-42/2014 (A/H5N8) segment 4 (HA) 3025.9 0.000000e+00 1684/1706 (98%)
EPI561681 A/tundra swan/Korea/H411/2014 (A/H5N8) segment 4 (HA) 3025.9 0.000000e+00 1684/1706 (98%)
EPI561660 A/Korean native chicken/Korea/H257/2014 (A/H5N8) segment 4 (HA) 3025.9 0.000000e+00 1684/1706 (98%)
EPI561598 A/broiler duck/Korea/H133/2014 (A/H5N8) segment 4 (HA) 3025.9 0.000000e+00 1684/1706 (98%)
EPI561360 A/broiler duck/Korea/H49/2014 (A/H5N8) segment 4 (HA) 3025.9 0.000000e+00 1684/1706 (98%)
EPI561348 A/broiler duck/Korea/H47/2014 (A/H5N8) segment 4 (HA) 3025.9 0.000000e+00 1684/1706 (98%)
EPI561336 A/broiler duck/Korea/H48/2014 (A/H5N8) segment 4 (HA) 3025.9 0.000000e+00 1684/1706 (98%)
EPI561204 A/broiler duck/Korea/H31/2014 (A/H5N8) segment 4 (HA) 3025.9 0.000000e+00 1684/1706 (98%)
EPI561196 A/broiler duck/Korea/H29/2014 (A/H5N8) segment 4 (HA) 3025.9 0.000000e+00 1684/1706 (98%)
EPI561187 A/waterfowl/Korea/S005/2014 (A/H5N8) segment 4 (HA) 3025.9 0.000000e+00 1684/1706 (98%)
EPI517161 A/Chicken/Kumamoto/1-7/2014 (A/H5N8) segment 4 (HA) 3025.9 0.000000e+00 1684/1706 (98%)

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Fri Jul 24, 2015 8:22 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
Align Segment-ID Name Score E-Value Identity
EPI620459 A/chicken/Iowa/14589-1/2015 (A/H5N2) segment 6 (NA) 2604.9 0.000000e+00 1410/1410 (100%)
EPI620452 A/chicken/Iowa/14399-4/2015 (A/H5N2) segment 6 (NA) 2604.9 0.000000e+00 1410/1410 (100%)
EPI620445 A/chicken/Iowa/14322-6/2015 (A/H5N2) segment 6 (NA) 2604.9 0.000000e+00 1410/1410 (100%)
EPI620438 A/turkey/Iowa/14319-1/2015 (A/H5N2) segment 6 (NA) 2604.9 0.000000e+00 1410/1410 (100%)
EPI620431 A/turkey/Iowa/14318-1/2015 (A/H5N2) segment 6 (NA) 2604.9 0.000000e+00 1410/1410 (100%)
EPI620424 A/chicken/Iowa/13542-2/2015 (A/H5N2) segment 6 (NA) 2604.9 0.000000e+00 1410/1410 (100%)
EPI620417 A/turkey/Iowa/13541-1/2015 (A/H5N2) segment 6 (NA) 2604.9 0.000000e+00 1410/1410 (100%)
EPI587635 A/chicken/Iowa/04-20/2015 (A/H5N2) segment 6 (NA) 2604.9 0.000000e+00 1410/1410 (100%)
EPI620410 A/turkey/Iowa/11762-1/2015 (A/H5N2) segment 6 (NA) 2588.3 0.000000e+00 1407/1410 (99%)
EPI590742 A/turkey/Minnesota/9845-4/2015 (A/H5N2) segment 6 (NA) 2588.3 0.000000e+00 1407/1410 (99%)
EPI590687 A/turkey/Minnesota/9892-2/2015 (A/H5N2) segment 6 (NA) 2588.3 0.000000e+00 1407/1410 (99%)
EPI590721 A/turkey/Missouri/7458-1/2015 (A/H5N2) segment 6 (NA) 2582.7 0.000000e+00 1406/1410 (99%)
EPI590714 A/turkey/Minnesota/7172-1/2015 (A/H5N2) segment 6 (NA) 2577.2 0.000000e+00 1405/1410 (99%)
EPI586544 A/chicken/BC/FAV23/2014 (A/H5N2) segment 6 (NA) 2577.2 0.000000e+00 1405/1410 (99%)
EPI586511 A/poultry/BC/FAV19/2014 (A/H5N2) segment 6 (NA) 2577.2 0.000000e+00 1405/1410 (99%)
EPI584081 A/turkey/BC/FAV14/2014 (A/H5N2) segment 6 (NA) 2577.2 0.000000e+00 1405/1410 (99%)
EPI590735 A/chicken/Kansas/8395-3/2015 (A/H5N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI590728 A/turkey/Arkansas/7791-1/2015 (A/H5N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI590701 A/chicken/Oregon/A01819044/2015 (A/H5N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI586520 A/chicken/BC/FAV20/2014 (A/H5N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI585094 A/pheasant/Washington/3147-2/2015 (A/H5N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI573282 A/turkey/Washington/61-22/2014 (A/H5N2) segment 6 (NA) 2571.7 0.000000e+00 1404/1410 (99%)
EPI586552 A/chicken/BC/FAV24/2014 (A/H5N2) segment 6 (NA) 2566.1 0.000000e+00 1403/1410 (99%)
EPI586528 A/chicken/BC/FAV21/2014 (A/H5N2) segment 6 (NA) 2566.1 0.000000e+00 1403/1410 (99%)
EPI586495 A/poultry/BC/FAV15/2014 (A/H5N2) segment 6 (NA) 2566.1 0.000000e+00 1403/1410 (99%)
EPI573278 A/domestic duck/Washington/61-16/2014 (A/H5N2) segment 6 (NA) 2566.1 0.000000e+00 1403/1410 (99%)
EPI573273 A/chicken/Washington/61-9/2014 (A/H5N2) segment 6 (NA) 2566.1 0.000000e+00 1403/1410 (99%)
EPI569385 A/Northern pintail/Washington/40964/2014 (A/H5N2) segment 6 (NA) 2566.1 0.000000e+00 1403/1410 (99%)
EPI586536 A/chicken/BC/FAV22/2014 (A/H5N2) segment 6 (NA) 2562.4 0.000000e+00 1402/1410 (99%)
EPI586560 A/chicken/BC/FAV25/2014 (A/H5N2) segment 6 (NA) 2560.6 0.000000e+00 1402/1410 (99%)
EPI586503 A/poultry/BC/FAV17/2014 (A/H5N2) segment 6 (NA) 2560.6 0.000000e+00 1402/1410 (99%)
EPI576479 A/chicken/BC/FAV9/2014 (A/H5N2) segment 6 (NA) 2560.6 0.000000e+00 1402/1410 (99%)
EPI576472 A/chicken/BC/FAV8/2014 (A/H5N2) segment 6 (NA) 2560.6 0.000000e+00 1402/1410 (99%)
EPI573300 A/turkey/BC/FAV10/2014 (A/H5N2) segment 6 (NA) 2560.6 0.000000e+00 1402/1410 (99%)
EPI590694 A/chicken/Washington/3490-18/2015 (A/H5N2) segment 6 (NA) 2555.0 0.000000e+00 1401/1410 (99%)
EPI418959 A/American green-winged teal/Wisconsin/10OS3127/2010 (A/H5N2) segment 6 (NA) 2483.0 0.000000e+00 1388/1410 (98%)
EPI512135 A/northern pintail/Mississippi/12OS420/2012 (A/H0) segment 6 (NA) 2477.5 0.000000e+00 1387/1410 (98%)
EPI450007 A/blue-winged teal/Louisiana/AI09-5234/2009 (A/H11N2) segment 6 (NA) 2477.5 0.000000e+00 1387/1410 (98%)
EPI418609 A/American green-winged teal/Mississippi/11OS98/2011 (A/H0) segment 6 (NA) 2466.4 0.000000e+00 1385/1410 (98%)
EPI332004 A/blue-winged teal/Guatemala/CIP049-10/2009 (A/H11N2) segment 6 (NA) 2466.4 0.000000e+00 1385/1410 (98%)
EPI331988 A/blue-winged teal/Guatemala/CIP049-03/2009 (A/H11N2) segment 6 (NA) 2466.4 0.000000e+00 1385/1410 (98%)
EPI512150 A/northern shoveler/Mississippi/12OS456/2012 (A/H14N2) segment 6 (NA) 2460.9 0.000000e+00 1384/1410 (98%)
EPI420145 A/northern shoveler/California/3676/2010 (A/H8N2) segment 6 (NA) 2460.9 0.000000e+00 1384/1410 (98%)
EPI419288 A/American wigeon/Iowa/10OS2748/2010 (A/H2N2) segment 6 (NA) 2460.9 0.000000e+00 1384/1410 (98%)
EPI418807 A/American green-winged teal/Illinois/10OS3589/2010 (A/H6N2) segment 6 (NA) 2460.9 0.000000e+00 1384/1410 (98%)
EPI418497 A/blue-winged teal/Illinois/10OS3610/2010 (A/H6N2) segment 6 (NA) 2460.9 0.000000e+00 1384/1410 (98%)
EPI418472 A/mallard/Illinois/10OS3245/2010 (A/H0) segment 6 (NA) 2460.9 0.000000e+00 1384/1410 (98%)
EPI387177 A/mallard/California/2396/2010 (A/H5N2) segment 6 (NA) 2460.9 0.000000e+00 1384/1410 (98%)
EPI333605 A/American green-winged teal/Mississippi/404/2010 (A/H0) segment 6 (NA) 2460.9 0.000000e+00 1384/1410 (98%)
EPI331996 A/blue-winged teal/Guatemala/CIP049-11/2009 (A/H11N2) segment 6 (NA) 2460.9 0.000000e+00 1384/1410 (98%)
EPI512531 A/gadwall/Mississippi/11OS6084/2011 (A/H11N2) segment 6 (NA) 2444.2 0.000000e+00 1381/1410 (97%)
EPI512524 A/northern shoveler/Mississippi/11OS6077/2011 (A/H11N2) segment 6 (NA) 2444.2 0.000000e+00 1381/1410 (97%)
EPI418721 A/mallard/Wisconsin/10OS2538/2010 (A/H3N2) segment 6 (NA) 2444.2 0.000000e+00 1381/1410 (97%)
EPI512591 A/northern shoveler/Mississippi/11OS5875/2011 (A/H5N2) segment 6 (NA) 2438.7 0.000000e+00 1380/1410 (97%)
EPI419077 A/mallard/Wisconsin/10OS3066/2010 (A/H6N2) segment 6 (NA) 2433.2 0.000000e+00 1379/1410 (97%)
EPI616345 A/American green-winged teal/Mississippi/12OS5061/2012 (A/H5N2) segment 6 (NA) 2427.6 0.000000e+00 1378/1410 (97%)
EPI419118 A/mallard/Mississippi/10OS4593/2010 (A/H1N2) segment 6 (NA) 2427.6 0.000000e+00 1378/1410 (97%)
EPI280744 A/avian/Missouri/466554-6/2006 (A/H5N2) segment 6 (NA) 2427.6 0.000000e+00 1378/1410 (97%)
EPI221406 A/American green-winged teal/California/HKWF609/2007 (A/H5N2) segment 6 (NA) 2427.6 0.000000e+00 1378/1410 (97%)
EPI419654 A/gadwall/Missouri/10MO0280/2010 (A/H5N2) segment 6 (NA) 2422.1 0.000000e+00 1378/1411 (97%)
EPI419647 A/mallard/Missouri/10MO0253/2010 (A/H1N2) segment 6 (NA) 2422.1 0.000000e+00 1377/1410 (97%)
EPI419111 A/gadwall/Mississippi/10OS4531/2010 (A/H6N2) segment 6 (NA) 2422.1 0.000000e+00 1377/1410 (97%)
EPI419138 A/northern shoveler/Mississippi/10OS4526/2010 (A/H6N2) segment 6 (NA) 2416.5 0.000000e+00 1376/1410 (97%)
EPI413459 A/mallard/Ohio/11OS2213/2011 (A/H11N2) segment 6 (NA) 2416.5 0.000000e+00 1376/1410 (97%)
EPI328608 A/northern shoveler/California/8855/2008 (A/H5N2) segment 6 (NA) 2416.5 0.000000e+00 1376/1410 (97%)
EPI513011 A/northern pintail/Wisconsin/11OS4111/2011 (A/H6N2) segment 6 (NA) 2411.0 0.000000e+00 1376/1411 (97%)
EPI328639 A/mallard/California/11100/2008 (A/H11N2) segment 6 (NA) 2411.0 0.000000e+00 1375/1410 (97%)
EPI328582 A/northern shoveler/California/9680/2008 (A/H6N2) segment 6 (NA) 2411.0 0.000000e+00 1375/1410 (97%)
EPI328476 A/green-winged teal/California/11285/2008 (A/H0) segment 6 (NA) 2411.0 0.000000e+00 1375/1410 (97%)
EPI328156 A/mallard/California/11353/2008 (A/H10N2) segment 6 (NA) 2411.0 0.000000e+00 1375/1410 (97%)
EPI328489 A/green-winged teal/California/7972/2008 (A/H6N2) segment 6 (NA) 2405.5 0.000000e+00 1374/1410 (97%)
EPI328108 A/northern shoveler/California/9017/2008 (A/H11N2) segment 6 (NA) 2405.5 0.000000e+00 1374/1410 (97%)
EPI419755 A/northern shoveler/California/2815/2011 (A/H5N2) segment 6 (NA) 2399.9 0.000000e+00 1373/1410 (97%)
EPI327900 A/northern pintail/California/6791/2008 (A/H11N2) segment 6 (NA) 2399.9 0.000000e+00 1373/1410 (97%)
EPI285601 A/wild bird/Wisconsin/433163-1/2006 (A/H5N2) segment 6 (NA) 2399.9 0.000000e+00 1373/1410 (97%)
EPI420032 A/mallard/California/2571V/2011 (A/H0) segment 6 (NA) 2394.4 0.000000e+00 1372/1410 (97%)
EPI420024 A/mallard/California/2571P/2011 (A/H11N2) segment 6 (NA) 2394.4 0.000000e+00 1372/1410 (97%)
EPI418643 A/mallard/Illinois/10OS3249/2010 (A/H11N2) segment 6 (NA) 2394.4 0.000000e+00 1372/1410 (97%)
EPI334262 A/mallard/Iowa/3195/2009 (A/H0) segment 6 (NA) 2394.4 0.000000e+00 1373/1411 (97%)
EPI442430 A/brant/Alaska/44332-426/2007 (A/H10N2) segment 6 (NA) 2383.3 0.000000e+00 1370/1410 (97%)
EPI285602 A/wild bird/Wisconsin/439436-2/2006 (A/H5N2) segment 6 (NA) 2383.3 0.000000e+00 1370/1410 (97%)
EPI285592 A/wild bird/Wisconsin/439436/2006 (A/H5N2) segment 6 (NA) 2383.3 0.000000e+00 1370/1410 (97%)
EPI328316 A/mallard/California/6420/2008 (A/H6N2) segment 6 (NA) 2377.8 0.000000e+00 1370/1411 (97%)
EPI299469 A/American green-winged teal/Wisconsin/08OS2291/2008 (A/H3N2) segment 6 (NA) 2377.8 0.000000e+00 1369/1410 (97%)
EPI299389 A/gadwall/Wisconsin/08OS2293/2008 (A/H3N2) segment 6 (NA) 2377.8 0.000000e+00 1369/1410 (97%)
EPI299381 A/American green-winged teal/Wisconsin/08OS2292/2008 (A/H3N2) segment 6 (NA) 2377.8 0.000000e+00 1369/1410 (97%)
EPI280848 A/wild bird/Minnesota/460613-12/2006 (A/H5N2) segment 6 (NA) 2377.8 0.000000e+00 1369/1410 (97%)
EPI449517 A/mallard/Minnesota/Sg-00847/2008 (A/H0) segment 6 (NA) 2372.2 0.000000e+00 1368/1410 (97%)
EPI413390 A/mallard/Ohio/10OS1470/2010 (A/H3N2) segment 6 (NA) 2372.2 0.000000e+00 1368/1410 (97%)
EPI413383 A/mallard/Ohio/10OS1469/2010 (A/H3N2) segment 6 (NA) 2372.2 0.000000e+00 1368/1410 (97%)
EPI413369 A/mallard/Ohio/10OS1467/2010 (A/H3N2) segment 6 (NA) 2372.2 0.000000e+00 1368/1410 (97%)
EPI285597 A/mallard/NV/450206/2006 (A/H5N2) segment 6 (NA) 2372.2 0.000000e+00 1368/1410 (97%)
EPI285595 A/mallard/NV/449567-4/2006 (A/H5N2) segment 6 (NA) 2372.2 0.000000e+00 1368/1410 (97%)
EPI285594 A/mallard/NV/449567-2/2006 (A/H5N2) segment 6 (NA) 2372.2 0.000000e+00 1368/1410 (97%)
EPI280656 A/mallard/Arkansas/473507-9/2006 (A/H5N2) segment 6 (NA) 2372.2 0.000000e+00 1368/1410 (97%)
EPI280544 A/mallard/Nevada/450206-4/2006 (A/H5N2) segment 6 (NA) 2372.2 0.000000e+00 1368/1410 (97%)
EPI222394 A/northern pintail/Saskatchewan/22910/2007 (A/H3N2) segment 6 (NA) 2372.2 0.000000e+00 1368/1410 (97%)
EPI187901 A/mallard/Minnesota/Sg-00129/2007 (A/H6N2) segment 6 (NA) 2368.5 0.000000e+00 1360/1399 (97%)
EPI449695 A/green-winged teal/Minnesota/Sg-01073/2008 (A/H6N2) segment 6 (NA) 2366.7 0.000000e+00 1367/1410 (96%)
EPI449653 A/mallard/Minnesota/Sg-01040/2008 (A/H3N2) segment 6 (NA) 2366.7 0.000000e+00 1367/1410 (96%)

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Fri Jul 24, 2015 8:23 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
Align Segment-ID Name Score E-Value Identity
EPI620460 A/chicken/Iowa/14589-1/2015 (A/H5N2) segment 7 (MP) 1814.5 0.000000e+00 982/982 (100%)
EPI620453 A/chicken/Iowa/14399-4/2015 (A/H5N2) segment 7 (MP) 1814.5 0.000000e+00 982/982 (100%)
EPI620446 A/chicken/Iowa/14322-6/2015 (A/H5N2) segment 7 (MP) 1814.5 0.000000e+00 982/982 (100%)
EPI620439 A/turkey/Iowa/14319-1/2015 (A/H5N2) segment 7 (MP) 1814.5 0.000000e+00 982/982 (100%)
EPI620432 A/turkey/Iowa/14318-1/2015 (A/H5N2) segment 7 (MP) 1814.5 0.000000e+00 982/982 (100%)
EPI620425 A/chicken/Iowa/13542-2/2015 (A/H5N2) segment 7 (MP) 1814.5 0.000000e+00 982/982 (100%)
EPI620418 A/turkey/Iowa/13541-1/2015 (A/H5N2) segment 7 (MP) 1814.5 0.000000e+00 982/982 (100%)
EPI587636 A/chicken/Iowa/04-20/2015 (A/H5N2) segment 7 (MP) 1814.5 0.000000e+00 982/982 (100%)
EPI620411 A/turkey/Iowa/11762-1/2015 (A/H5N2) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI590743 A/turkey/Minnesota/9845-4/2015 (A/H5N2) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI590736 A/chicken/Kansas/8395-3/2015 (A/H5N2) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI590729 A/turkey/Arkansas/7791-1/2015 (A/H5N2) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI590722 A/turkey/Missouri/7458-1/2015 (A/H5N2) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI590708 A/chicken/Oregon/A01819044/2015 (A/H5N2) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI590688 A/turkey/Minnesota/9892-2/2015 (A/H5N2) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI568701 A/domestic duck/Washington/61-16/2014 (A/H5N2) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI568698 A/turkey/Washington/61-22/2014 (A/H5N2) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI568697 A/chicken/Washington/61-9/2014 (A/H5N2) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI590715 A/turkey/Minnesota/7172-1/2015 (A/H5N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI586561 A/chicken/BC/FAV25/2014 (A/H5N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI586553 A/chicken/BC/FAV24/2014 (A/H5N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI586521 A/chicken/BC/FAV20/2014 (A/H5N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI586504 A/poultry/BC/FAV17/2014 (A/H5N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI585651 A/baikal teal/Korea/2416/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI585650 A/baikal teal/Korea/2414/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI585649 A/baikal teal/Korea/2406/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI585647 A/baikal teal/Korea/2402/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI585646 A/baikal teal/Korea/2399/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI585645 A/baikal teal/Korea/1458/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI585644 A/baikal teal/Korea/1457/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI585643 A/baikal teal/Korea/1456/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI585642 A/baikal teal/Korea/1454/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI585641 A/baikal teal/Korea/1452/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI585639 A/baikal teal/Korea/1448/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI585638 A/baikal teal/Korea/1447/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI585637 A/baikal teal/Korea/1446/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI585635 A/baikal teal/Korea/1441/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI585634 A/baikal teal/Korea/1437/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI585087 A/turkey/California/K1500169-1.2/2015 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI584082 A/turkey/BC/FAV14/2014 (A/H5N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI576480 A/chicken/BC/FAV9/2014 (A/H5N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI576473 A/chicken/BC/FAV8/2014 (A/H5N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI573301 A/turkey/BC/FAV10/2014 (A/H5N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI569386 A/Northern pintail/Washington/40964/2014 (A/H5N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI561700 A/spot-billed duck/Korea/H455-42/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI561693 A/common teal/Korea/H455-30/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI561684 A/tundra swan/Korea/H411/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI561677 A/bean goose/Korea/H328/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI561670 A/mallard/Korea/H297/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI561656 A/breeder chicken/Korea/H250/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI561649 A/breeder duck/Korea/H249/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI561636 A/white-fronted goose/Korea/H231/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI561629 A/mallard/Korea/H207/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI561622 A/breeder duck/Korea/H200/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI561601 A/broiler duck/Korea/H133/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI561594 A/breeder duck/Korea/H128/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI561580 A/breeder chicken/Korea/H122/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI561573 A/Baikal teal/Korea/H96/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI561566 A/Baikal teal/Korea/H84/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI561559 A/Coot/Korea/H81/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI561552 A/Baikal teal/Korea/H80/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI561532 A/Baikal teal/Korea/H66/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI561525 A/broiler duck/Korea/H65/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI561511 A/bean goose/Korea/H53/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI561351 A/broiler duck/Korea/H47/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI561344 A/Baikal teal/Korea/H41/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI561211 A/broiler duck/Korea/H31/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI561199 A/broiler duck/Korea/H29/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI561190 A/waterfowl/Korea/S005/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI553211 A/crane/Kagoshima/KU1/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI542633 A/mallard/Korea/W452/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI517164 A/Chicken/Kumamoto/1-7/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI509756 A/baikal teal/Korea/Donglim3/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI509711 A/broiler duck/Korea/Buan2/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI590695 A/chicken/Washington/3490-18/2015 (A/H5N2) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI587524 A/American wigeon/BC/050-31/2015 (A/H5N8) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI586545 A/chicken/BC/FAV23/2014 (A/H5N2) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI586537 A/chicken/BC/FAV22/2014 (A/H5N2) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI586529 A/chicken/BC/FAV21/2014 (A/H5N2) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI586513 A/poultry/BC/FAV19/2014 (A/H5N2) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI586496 A/poultry/BC/FAV15/2014 (A/H5N2) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI585652 A/baikal teal/Korea/2417/2014 (A/H5N8) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI585648 A/baikal teal/Korea/2403/2014 (A/H5N8) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI585640 A/baikal teal/Korea/1449/2014 (A/H5N8) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI585636 A/baikal teal/Korea/1445/2014 (A/H5N8) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI585095 A/pheasant/Washington/3147-2/2015 (A/H5N2) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI573289 A/American green-winged teal/Washington/195750/2014 (A/H5N1) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI569393 A/gyrfalcon/Washington/41088-6/2014 (A/H5N8) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI568702 A/guinea fowl/Oregon/41613-1/2014 (A/H5N8) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI568699 A/chicken/Oregon/41613-2/2014 (A/H5N8) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI561708 A/bean goose/Korea/H40/2014 (A/H5N8) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI561663 A/Korean native chicken/Korea/H257/2014 (A/H5N8) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI561615 A/breeder duck/Korea/H158/2014 (A/H5N8) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI561608 A/broiler duck/Korea/H145/2014 (A/H5N8) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI561545 A/Baikal teal/Korea/H68/2014 (A/H5N8) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI561518 A/Baikal teal/Korea/H62/2014 (A/H5N8) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI561363 A/broiler duck/Korea/H49/2014 (A/H5N8) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI561356 A/broiler duck/Korea/H48/2014 (A/H5N8) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI554603 A/turkey/Germany-NI/R3372/2014 (A/H5N8) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI553346 A/chicken/Miyazaki/7/2014 (A/H5N8) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Fri Jul 24, 2015 8:25 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
EPI620455 A/chicken/Iowa/14589-1/2015 (A/H5N2) segment 1 (PB2) 4211.5 0.000000e+00 2280/2280 (100%)
EPI620427 A/turkey/Iowa/14318-1/2015 (A/H5N2) segment 1 (PB2) 4211.5 0.000000e+00 2280/2280 (100%)
EPI620420 A/chicken/Iowa/13542-2/2015 (A/H5N2) segment 1 (PB2) 4211.5 0.000000e+00 2280/2280 (100%)
EPI620413 A/turkey/Iowa/13541-1/2015 (A/H5N2) segment 1 (PB2) 4211.5 0.000000e+00 2280/2280 (100%)
EPI587630 A/chicken/Iowa/04-20/2015 (A/H5N2) segment 1 (PB2) 4211.5 0.000000e+00 2280/2280 (100%)
EPI620448 A/chicken/Iowa/14399-4/2015 (A/H5N2) segment 1 (PB2) 4205.9 0.000000e+00 2279/2280 (99%)
EPI620441 A/chicken/Iowa/14322-6/2015 (A/H5N2) segment 1 (PB2) 4205.9 0.000000e+00 2279/2280 (99%)
EPI620434 A/turkey/Iowa/14319-1/2015 (A/H5N2) segment 1 (PB2) 4205.9 0.000000e+00 2279/2280 (99%)
EPI590738 A/turkey/Minnesota/9845-4/2015 (A/H5N2) segment 1 (PB2) 4205.9 0.000000e+00 2279/2280 (99%)
EPI620406 A/turkey/Iowa/11762-1/2015 (A/H5N2) segment 1 (PB2) 4194.9 0.000000e+00 2277/2280 (99%)
EPI590724 A/turkey/Arkansas/7791-1/2015 (A/H5N2) segment 1 (PB2) 4194.9 0.000000e+00 2277/2280 (99%)
EPI590683 A/turkey/Minnesota/9892-2/2015 (A/H5N2) segment 1 (PB2) 4194.9 0.000000e+00 2277/2280 (99%)
EPI586531 A/chicken/BC/FAV22/2014 (A/H5N2) segment 1 (PB2) 4194.9 0.000000e+00 2277/2280 (99%)
EPI586498 A/poultry/BC/FAV17/2014 (A/H5N2) segment 1 (PB2) 4194.9 0.000000e+00 2277/2280 (99%)
EPI586490 A/poultry/BC/FAV15/2014 (A/H5N2) segment 1 (PB2) 4194.9 0.000000e+00 2277/2280 (99%)
EPI573296 A/turkey/BC/FAV10/2014 (A/H5N2) segment 1 (PB2) 4194.9 0.000000e+00 2277/2280 (99%)
EPI573279 A/turkey/Washington/61-22/2014 (A/H5N2) segment 1 (PB2) 4194.9 0.000000e+00 2277/2280 (99%)
EPI573274 A/domestic duck/Washington/61-16/2014 (A/H5N2) segment 1 (PB2) 4194.9 0.000000e+00 2277/2280 (99%)
EPI590731 A/chicken/Kansas/8395-3/2015 (A/H5N2) segment 1 (PB2) 4189.3 0.000000e+00 2276/2280 (99%)
EPI590717 A/turkey/Missouri/7458-1/2015 (A/H5N2) segment 1 (PB2) 4189.3 0.000000e+00 2276/2280 (99%)
EPI586555 A/chicken/BC/FAV25/2014 (A/H5N2) segment 1 (PB2) 4189.3 0.000000e+00 2276/2280 (99%)
EPI586547 A/chicken/BC/FAV24/2014 (A/H5N2) segment 1 (PB2) 4189.3 0.000000e+00 2276/2280 (99%)
EPI586539 A/chicken/BC/FAV23/2014 (A/H5N2) segment 1 (PB2) 4189.3 0.000000e+00 2276/2280 (99%)
EPI586523 A/chicken/BC/FAV21/2014 (A/H5N2) segment 1 (PB2) 4189.3 0.000000e+00 2276/2280 (99%)
EPI585089 A/pheasant/Washington/3147-2/2015 (A/H5N2) segment 1 (PB2) 4189.3 0.000000e+00 2276/2280 (99%)
EPI584076 A/turkey/BC/FAV14/2014 (A/H5N2) segment 1 (PB2) 4189.3 0.000000e+00 2276/2280 (99%)
EPI576475 A/chicken/BC/FAV9/2014 (A/H5N2) segment 1 (PB2) 4189.3 0.000000e+00 2276/2280 (99%)
EPI576468 A/chicken/BC/FAV8/2014 (A/H5N2) segment 1 (PB2) 4189.3 0.000000e+00 2276/2280 (99%)
EPI573269 A/chicken/Washington/61-9/2014 (A/H5N2) segment 1 (PB2) 4189.3 0.000000e+00 2276/2280 (99%)
EPI569380 A/gyrfalcon/Washington/41088-6/2014 (A/H5N8) segment 1 (PB2) 4189.3 0.000000e+00 2276/2280 (99%)
EPI569379 A/Northern pintail/Washington/40964/2014 (A/H5N2) segment 1 (PB2) 4189.3 0.000000e+00 2276/2280 (99%)
EPI590710 A/turkey/Minnesota/7172-1/2015 (A/H5N2) segment 1 (PB2) 4183.8 0.000000e+00 2275/2280 (99%)
EPI590697 A/chicken/Oregon/A01819044/2015 (A/H5N2) segment 1 (PB2) 4183.8 0.000000e+00 2275/2280 (99%)
EPI586515 A/chicken/BC/FAV20/2014 (A/H5N2) segment 1 (PB2) 4183.8 0.000000e+00 2275/2280 (99%)
EPI585081 A/turkey/California/K1500169-1.2/2015 (A/H5N8) segment 1 (PB2) 4183.8 0.000000e+00 2275/2280 (99%)
EPI569369 A/guinea fowl/Oregon/41613-1/2014 (A/H5N8) segment 1 (PB2) 4183.8 0.000000e+00 2275/2280 (99%)
EPI569367 A/chicken/Oregon/41613-2/2014 (A/H5N8) segment 1 (PB2) 4183.8 0.000000e+00 2275/2280 (99%)
EPI586506 A/poultry/BC/FAV19/2014 (A/H5N2) segment 1 (PB2) 4180.1 0.000000e+00 2274/2280 (99%)
EPI590690 A/chicken/Washington/3490-18/2015 (A/H5N2) segment 1 (PB2) 4178.2 0.000000e+00 2274/2280 (99%)
EPI587519 A/American wigeon/BC/050-31/2015 (A/H5N8) segment 1 (PB2) 4178.2 0.000000e+00 2274/2280 (99%)
EPI573283 A/American green-winged teal/Washington/195750/2014 (A/H5N1) segment 1 (PB2) 4172.7 0.000000e+00 2273/2280 (99%)
EPI588949 A/goose/Taiwan/a015/2015 (A/H5N8) segment 1 (PB2) 4145.0 0.000000e+00 2268/2280 (99%)
EPI553205 A/crane/Kagoshima/KU1/2014 (A/H5N8) segment 1 (PB2) 4145.0 0.000000e+00 2268/2280 (99%)
EPI585557 A/baikal teal/Korea/2417/2014 (A/H5N8) segment 1 (PB2) 4139.5 0.000000e+00 2267/2280 (99%)
EPI585556 A/baikal teal/Korea/2416/2014 (A/H5N8) segment 1 (PB2) 4139.5 0.000000e+00 2267/2280 (99%)
EPI585553 A/baikal teal/Korea/2403/2014 (A/H5N8) segment 1 (PB2) 4139.5 0.000000e+00 2267/2280 (99%)
EPI585543 A/baikal teal/Korea/1447/2014 (A/H5N8) segment 1 (PB2) 4139.5 0.000000e+00 2267/2280 (99%)
EPI585541 A/baikal teal/Korea/1445/2014 (A/H5N8) segment 1 (PB2) 4139.5 0.000000e+00 2267/2280 (99%)
EPI561702 A/bean goose/Korea/H40/2014 (A/H5N8) segment 1 (PB2) 4139.5 0.000000e+00 2267/2280 (99%)
EPI561672 A/bean goose/Korea/H328/2014 (A/H5N8) segment 1 (PB2) 4139.5 0.000000e+00 2267/2280 (99%)
EPI561631 A/white-fronted goose/Korea/H231/2014 (A/H5N8) segment 1 (PB2) 4139.5 0.000000e+00 2267/2280 (99%)
EPI561624 A/mallard/Korea/H207/2014 (A/H5N8) segment 1 (PB2) 4139.5 0.000000e+00 2267/2280 (99%)
EPI561568 A/Baikal teal/Korea/H96/2014 (A/H5N8) segment 1 (PB2) 4139.5 0.000000e+00 2267/2280 (99%)
EPI561540 A/Baikal teal/Korea/H68/2014 (A/H5N8) segment 1 (PB2) 4139.5 0.000000e+00 2267/2280 (99%)
EPI561527 A/Baikal teal/Korea/H66/2014 (A/H5N8) segment 1 (PB2) 4139.5 0.000000e+00 2267/2280 (99%)
EPI561506 A/bean goose/Korea/H53/2014 (A/H5N8) segment 1 (PB2) 4139.5 0.000000e+00 2267/2280 (99%)
EPI561358 A/broiler duck/Korea/H49/2014 (A/H5N8) segment 1 (PB2) 4139.5 0.000000e+00 2267/2280 (99%)
EPI585554 A/baikal teal/Korea/2406/2014 (A/H5N8) segment 1 (PB2) 4133.9 0.000000e+00 2266/2280 (99%)
EPI585551 A/baikal teal/Korea/2399/2014 (A/H5N8) segment 1 (PB2) 4133.9 0.000000e+00 2266/2280 (99%)
EPI585550 A/baikal teal/Korea/1458/2014 (A/H5N8) segment 1 (PB2) 4133.9 0.000000e+00 2266/2280 (99%)
EPI585548 A/baikal teal/Korea/1456/2014 (A/H5N8) segment 1 (PB2) 4133.9 0.000000e+00 2266/2280 (99%)
EPI585546 A/baikal teal/Korea/1452/2014 (A/H5N8) segment 1 (PB2) 4133.9 0.000000e+00 2266/2280 (99%)
EPI585545 A/baikal teal/Korea/1449/2014 (A/H5N8) segment 1 (PB2) 4133.9 0.000000e+00 2266/2280 (99%)
EPI585544 A/baikal teal/Korea/1448/2014 (A/H5N8) segment 1 (PB2) 4133.9 0.000000e+00 2266/2280 (99%)
EPI585539 A/baikal teal/Korea/1437/2014 (A/H5N8) segment 1 (PB2) 4133.9 0.000000e+00 2266/2280 (99%)
EPI561610 A/breeder duck/Korea/H158/2014 (A/H5N8) segment 1 (PB2) 4133.9 0.000000e+00 2266/2280 (99%)
EPI561603 A/broiler duck/Korea/H145/2014 (A/H5N8) segment 1 (PB2) 4133.9 0.000000e+00 2266/2280 (99%)
EPI561575 A/breeder chicken/Korea/H122/2014 (A/H5N8) segment 1 (PB2) 4133.9 0.000000e+00 2266/2280 (99%)
EPI561561 A/Baikal teal/Korea/H84/2014 (A/H5N8) segment 1 (PB2) 4133.9 0.000000e+00 2266/2280 (99%)
EPI561513 A/Baikal teal/Korea/H62/2014 (A/H5N8) segment 1 (PB2) 4133.9 0.000000e+00 2266/2280 (99%)
EPI561353 A/broiler duck/Korea/H48/2014 (A/H5N8) segment 1 (PB2) 4133.9 0.000000e+00 2266/2280 (99%)
EPI561339 A/Baikal teal/Korea/H41/2014 (A/H5N8) segment 1 (PB2) 4133.9 0.000000e+00 2266/2280 (99%)
EPI585555 A/baikal teal/Korea/2414/2014 (A/H5N8) segment 1 (PB2) 4128.4 0.000000e+00 2265/2280 (99%)
EPI585549 A/baikal teal/Korea/1457/2014 (A/H5N8) segment 1 (PB2) 4128.4 0.000000e+00 2265/2280 (99%)
EPI585542 A/baikal teal/Korea/1446/2014 (A/H5N8) segment 1 (PB2) 4128.4 0.000000e+00 2265/2280 (99%)
EPI585540 A/baikal teal/Korea/1441/2014 (A/H5N8) segment 1 (PB2) 4128.4 0.000000e+00 2265/2280 (99%)
EPI573635 A/crane/Kagoshima/KU13/2014(H5N8) (A/H5N8) segment 1 (PB2) 4128.4 0.000000e+00 2265/2280 (99%)
EPI561679 A/tundra swan/Korea/H411/2014 (A/H5N8) segment 1 (PB2) 4128.4 0.000000e+00 2265/2280 (99%)
EPI561665 A/mallard/Korea/H297/2014 (A/H5N8) segment 1 (PB2) 4128.4 0.000000e+00 2265/2280 (99%)
EPI561651 A/breeder chicken/Korea/H250/2014 (A/H5N8) segment 1 (PB2) 4128.4 0.000000e+00 2265/2280 (99%)
EPI561644 A/breeder duck/Korea/H249/2014 (A/H5N8) segment 1 (PB2) 4128.4 0.000000e+00 2265/2280 (99%)
EPI561596 A/broiler duck/Korea/H133/2014 (A/H5N8) segment 1 (PB2) 4128.4 0.000000e+00 2265/2280 (99%)
EPI561589 A/breeder duck/Korea/H128/2014 (A/H5N8) segment 1 (PB2) 4128.4 0.000000e+00 2265/2280 (99%)
EPI561554 A/Coot/Korea/H81/2014 (A/H5N8) segment 1 (PB2) 4128.4 0.000000e+00 2265/2280 (99%)
EPI561547 A/Baikal teal/Korea/H80/2014 (A/H5N8) segment 1 (PB2) 4128.4 0.000000e+00 2265/2280 (99%)
EPI561520 A/broiler duck/Korea/H65/2014 (A/H5N8) segment 1 (PB2) 4128.4 0.000000e+00 2265/2280 (99%)
EPI561346 A/broiler duck/Korea/H47/2014 (A/H5N8) segment 1 (PB2) 4128.4 0.000000e+00 2265/2280 (99%)
EPI561201 A/broiler duck/Korea/H31/2014 (A/H5N8) segment 1 (PB2) 4128.4 0.000000e+00 2265/2280 (99%)
EPI561194 A/broiler duck/Korea/H29/2014 (A/H5N8) segment 1 (PB2) 4128.4 0.000000e+00 2265/2280 (99%)
EPI561185 A/waterfowl/Korea/S005/2014 (A/H5N8) segment 1 (PB2) 4128.4 0.000000e+00 2265/2280 (99%)
EPI542630 A/mallard/Korea/W452/2014 (A/H5N8) segment 1 (PB2) 4128.4 0.000000e+00 2265/2280 (99%)
EPI509707 A/baikal teal/Korea/Donglim3/2014 (A/H5N8) segment 1 (PB2) 4128.4 0.000000e+00 2265/2280 (99%)
EPI509702 A/broiler duck/Korea/Buan2/2014 (A/H5N8) segment 1 (PB2) 4128.4 0.000000e+00 2265/2280 (99%)
EPI585547 A/baikal teal/Korea/1454/2014 (A/H5N8) segment 1 (PB2) 4122.8 0.000000e+00 2264/2280 (99%)
EPI561695 A/spot-billed duck/Korea/H455-42/2014 (A/H5N8) segment 1 (PB2) 4122.8 0.000000e+00 2264/2280 (99%)
EPI561658 A/Korean native chicken/Korea/H257/2014 (A/H5N8) segment 1 (PB2) 4122.8 0.000000e+00 2264/2280 (99%)
EPI561617 A/breeder duck/Korea/H200/2014 (A/H5N8) segment 1 (PB2) 4122.8 0.000000e+00 2264/2280 (99%)
EPI517158 A/Chicken/Kumamoto/1-7/2014 (A/H5N8) segment 1 (PB2) 4122.8 0.000000e+00 2264/2280 (99%)
EPI561688 A/common teal/Korea/H455-30/2014 (A/H5N8) segment 1 (PB2) 4117.3 0.000000e+00 2263/2280 (99%)
EPI547679 A/Chicken/Netherlands/14015526/2014 (A/H5N8) segment 1 (PB2) 4100.7 0.000000e+00 2260/2280 (99%)

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Fri Jul 24, 2015 8:26 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
EPI620456 A/chicken/Iowa/14589-1/2015 (A/H5N2) segment 2 (PB1) 4194.9 0.000000e+00 2273/2274 (99%)
EPI620435 A/turkey/Iowa/14319-1/2015 (A/H5N2) segment 2 (PB1) 4194.9 0.000000e+00 2273/2274 (99%)
EPI620428 A/turkey/Iowa/14318-1/2015 (A/H5N2) segment 2 (PB1) 4194.9 0.000000e+00 2273/2274 (99%)
EPI620421 A/chicken/Iowa/13542-2/2015 (A/H5N2) segment 2 (PB1) 4194.9 0.000000e+00 2273/2274 (99%)
EPI620414 A/turkey/Iowa/13541-1/2015 (A/H5N2) segment 2 (PB1) 4194.9 0.000000e+00 2273/2274 (99%)
EPI587631 A/chicken/Iowa/04-20/2015 (A/H5N2) segment 2 (PB1) 4194.9 0.000000e+00 2273/2274 (99%)
EPI620442 A/chicken/Iowa/14322-6/2015 (A/H5N2) segment 2 (PB1) 4189.3 0.000000e+00 2272/2274 (99%)
EPI590739 A/turkey/Minnesota/9845-4/2015 (A/H5N2) segment 2 (PB1) 4172.7 0.000000e+00 2269/2274 (99%)
EPI620449 A/chicken/Iowa/14399-4/2015 (A/H5N2) segment 2 (PB1) 4167.2 0.000000e+00 2268/2274 (99%)
EPI620407 A/turkey/Iowa/11762-1/2015 (A/H5N2) segment 2 (PB1) 4167.2 0.000000e+00 2268/2274 (99%)
EPI590698 A/chicken/Oregon/A01819044/2015 (A/H5N2) segment 2 (PB1) 4161.6 0.000000e+00 2267/2274 (99%)
EPI590684 A/turkey/Minnesota/9892-2/2015 (A/H5N2) segment 2 (PB1) 4161.6 0.000000e+00 2267/2274 (99%)
EPI586556 A/chicken/BC/FAV25/2014 (A/H5N2) segment 2 (PB1) 4161.6 0.000000e+00 2267/2274 (99%)
EPI586540 A/chicken/BC/FAV23/2014 (A/H5N2) segment 2 (PB1) 4161.6 0.000000e+00 2267/2274 (99%)
EPI586507 A/poultry/BC/FAV19/2014 (A/H5N2) segment 2 (PB1) 4161.6 0.000000e+00 2267/2274 (99%)
EPI584077 A/turkey/BC/FAV14/2014 (A/H5N2) segment 2 (PB1) 4161.6 0.000000e+00 2267/2274 (99%)
EPI573275 A/domestic duck/Washington/61-16/2014 (A/H5N2) segment 2 (PB1) 4161.6 0.000000e+00 2267/2274 (99%)
EPI573270 A/chicken/Washington/61-9/2014 (A/H5N2) segment 2 (PB1) 4161.6 0.000000e+00 2267/2274 (99%)
EPI569364 A/turkey/Washington/61-22/2014 (A/H5N2) segment 2 (PB1) 4161.6 0.000000e+00 2267/2274 (99%)
EPI590718 A/turkey/Missouri/7458-1/2015 (A/H5N2) segment 2 (PB1) 4156.1 0.000000e+00 2266/2274 (99%)
EPI590711 A/turkey/Minnesota/7172-1/2015 (A/H5N2) segment 2 (PB1) 4156.1 0.000000e+00 2266/2274 (99%)
EPI590691 A/chicken/Washington/3490-18/2015 (A/H5N2) segment 2 (PB1) 4156.1 0.000000e+00 2266/2274 (99%)
EPI586516 A/chicken/BC/FAV20/2014 (A/H5N2) segment 2 (PB1) 4156.1 0.000000e+00 2266/2274 (99%)
EPI586499 A/poultry/BC/FAV17/2014 (A/H5N2) segment 2 (PB1) 4156.1 0.000000e+00 2266/2274 (99%)
EPI586491 A/poultry/BC/FAV15/2014 (A/H5N2) segment 2 (PB1) 4156.1 0.000000e+00 2266/2274 (99%)
EPI585090 A/pheasant/Washington/3147-2/2015 (A/H5N2) segment 2 (PB1) 4156.1 0.000000e+00 2266/2274 (99%)
EPI576469 A/chicken/BC/FAV8/2014 (A/H5N2) segment 2 (PB1) 4156.1 0.000000e+00 2266/2274 (99%)
EPI569381 A/Northern pintail/Washington/40964/2014 (A/H5N2) segment 2 (PB1) 4156.1 0.000000e+00 2266/2274 (99%)
EPI586548 A/chicken/BC/FAV24/2014 (A/H5N2) segment 2 (PB1) 4150.5 0.000000e+00 2265/2274 (99%)
EPI586532 A/chicken/BC/FAV22/2014 (A/H5N2) segment 2 (PB1) 4150.5 0.000000e+00 2265/2274 (99%)
EPI586524 A/chicken/BC/FAV21/2014 (A/H5N2) segment 2 (PB1) 4150.5 0.000000e+00 2265/2274 (99%)
EPI576476 A/chicken/BC/FAV9/2014 (A/H5N2) segment 2 (PB1) 4150.5 0.000000e+00 2265/2274 (99%)
EPI573297 A/turkey/BC/FAV10/2014 (A/H5N2) segment 2 (PB1) 4150.5 0.000000e+00 2265/2274 (99%)
EPI590732 A/chicken/Kansas/8395-3/2015 (A/H5N2) segment 2 (PB1) 4145.0 0.000000e+00 2264/2274 (99%)
EPI590725 A/turkey/Arkansas/7791-1/2015 (A/H5N2) segment 2 (PB1) 4145.0 0.000000e+00 2264/2274 (99%)
EPI420193 A/bufflehead/California/3118/2011 (A/H4N8) segment 2 (PB1) 4045.3 0.000000e+00 2246/2274 (98%)
EPI418616 A/American green-winged teal/Mississippi/11OS98/2011 (A/H0) segment 2 (PB1) 4034.2 0.000000e+00 2244/2274 (98%)
EPI512660 A/wood duck/Wisconsin/11OS3443/2011 (A/H11N9) segment 2 (PB1) 4023.1 0.000000e+00 2242/2274 (98%)
EPI512230 A/mallard/Arkansas/12OS179/2012 (A/H1N1) segment 2 (PB1) 4023.1 0.000000e+00 2242/2274 (98%)
EPI436582 A/American green-winged teal/Interior Alaska/10BM05376R0/2010 (A/H3N8) segment 2 (PB1) 4023.1 0.000000e+00 2242/2274 (98%)
EPI418963 A/American green-winged teal/Wisconsin/10OS3127/2010 (A/H5N2) segment 2 (PB1) 4023.1 0.000000e+00 2242/2274 (98%)
EPI453910 A/northern pintail/Interior Alaska/10BM10298R0/2010 (A/H3N8) segment 2 (PB1) 4017.6 0.000000e+00 2241/2274 (98%)
EPI436612 A/northern shoveler/Interior Alaska/10BM05487R0/2010 (A/H3N8) segment 2 (PB1) 4017.6 0.000000e+00 2241/2274 (98%)
EPI436589 A/northern shoveler/Interior Alaska/10BM05382R0/2010 (A/H3N8) segment 2 (PB1) 4017.6 0.000000e+00 2241/2274 (98%)
EPI419953 A/mallard/California/2559P/2011 (A/H5N8) segment 2 (PB1) 4017.6 0.000000e+00 2241/2274 (98%)
EPI419909 A/mallard/California/2552V/2011 (A/H4N8) segment 2 (PB1) 4017.6 0.000000e+00 2241/2274 (98%)
EPI419869 A/mallard/California/2542V/2011 (A/H5N1) segment 2 (PB1) 4017.6 0.000000e+00 2241/2274 (98%)
EPI419842 A/mallard/California/2536P/2011 (A/H5N1) segment 2 (PB1) 4017.6 0.000000e+00 2241/2274 (98%)
EPI419835 A/mallard/California/2535V/2011 (A/H5N1) segment 2 (PB1) 4017.6 0.000000e+00 2241/2274 (98%)
EPI419828 A/mallard/California/2535P/2011 (A/H5N1) segment 2 (PB1) 4017.6 0.000000e+00 2241/2274 (98%)
EPI387181 A/mallard/California/2396/2010 (A/H5N2) segment 2 (PB1) 4017.6 0.000000e+00 2241/2274 (98%)
EPI512474 A/blue-winged teal/Missouri/11OS2563/2011 (A/H12N4) segment 2 (PB1) 4012.0 0.000000e+00 2240/2274 (98%)
EPI452523 A/northern pintail/Interior Alaska/10BM12413R0/2010 (A/H8N4) segment 2 (PB1) 4012.0 0.000000e+00 2240/2274 (98%)
EPI451651 A/mallard/Interior Alaska/10BM07575R0/2010 (A/H7N3) segment 2 (PB1) 4012.0 0.000000e+00 2240/2274 (98%)
EPI436619 A/northern shoveler/Interior Alaska/10BM05491R0/2010 (A/H3N8) segment 2 (PB1) 4012.0 0.000000e+00 2240/2274 (98%)
EPI433197 A/mallard/Interior Alaska/10BM04564R1/2010 (A/H7N3) segment 2 (PB1) 4012.0 0.000000e+00 2240/2274 (98%)
EPI420142 A/mallard/California/2595V/2011 (A/H12N5) segment 2 (PB1) 4012.0 0.000000e+00 2240/2274 (98%)
EPI420135 A/mallard/California/2595P/2011 (A/H12N5) segment 2 (PB1) 4012.0 0.000000e+00 2240/2274 (98%)
EPI420114 A/mallard/California/2590V/2011 (A/H4N6) segment 2 (PB1) 4012.0 0.000000e+00 2240/2274 (98%)
EPI420087 A/mallard/California/2584V/2011 (A/H4N9) segment 2 (PB1) 4012.0 0.000000e+00 2240/2274 (98%)
EPI420080 A/mallard/California/2584P/2011 (A/H4N9) segment 2 (PB1) 4012.0 0.000000e+00 2240/2274 (98%)
EPI419939 A/mallard/California/2555V/2011 (A/H11N9) segment 2 (PB1) 4012.0 0.000000e+00 2240/2274 (98%)
EPI419916 A/mallard/California/2555P/2011 (A/H11N9) segment 2 (PB1) 4012.0 0.000000e+00 2240/2274 (98%)
EPI419807 A/mallard/California/2531V/2011 (A/H5N1) segment 2 (PB1) 4012.0 0.000000e+00 2240/2274 (98%)
EPI419794 A/mallard/California/2531P/2011 (A/H5N1) segment 2 (PB1) 4012.0 0.000000e+00 2240/2274 (98%)
EPI419786 A/mallard/California/2527V/2011 (A/H5N1) segment 2 (PB1) 4012.0 0.000000e+00 2240/2274 (98%)
EPI420128 A/mallard/California/2594V/2011 (A/H4N6) segment 2 (PB1) 4006.5 0.000000e+00 2239/2274 (98%)
EPI420121 A/mallard/California/2594P/2011 (A/H4N6) segment 2 (PB1) 4006.5 0.000000e+00 2239/2274 (98%)
EPI420101 A/mallard/California/2589V/2011 (A/H4N1) segment 2 (PB1) 4006.5 0.000000e+00 2239/2274 (98%)
EPI420094 A/mallard/California/2589P/2011 (A/H4N1) segment 2 (PB1) 4006.5 0.000000e+00 2239/2274 (98%)
EPI420073 A/mallard/California/2578V/2011 (A/H0) segment 2 (PB1) 4006.5 0.000000e+00 2239/2274 (98%)
EPI419855 A/mallard/California/2536V/2011 (A/H5N1) segment 2 (PB1) 4006.5 0.000000e+00 2239/2274 (98%)
EPI419821 A/mallard/California/2533V/2011 (A/H4N6) segment 2 (PB1) 4006.5 0.000000e+00 2239/2274 (98%)
EPI419779 A/mallard/California/2525P/2011 (A/H4N6) segment 2 (PB1) 4006.5 0.000000e+00 2239/2274 (98%)
EPI418440 A/mallard/California/2525V/2011 (A/H0) segment 2 (PB1) 4006.5 0.000000e+00 2239/2274 (98%)
EPI398563 A/chicken/Jalisco/12283/2012 (A/H7N3) segment 2 (PB1) 4006.5 0.000000e+00 2239/2274 (98%)
EPI616068 A/northern shoveler/Ohio/12OS3173/2012 (A/H12N5) segment 2 (PB1) 4001.0 0.000000e+00 2238/2274 (98%)
EPI513088 A/mallard/Wisconsin/11OS4104/2011 (A/H1N2) segment 2 (PB1) 4001.0 0.000000e+00 2238/2274 (98%)
EPI512676 A/mallard/Wisconsin/11OS3468/2011 (A/H2N3) segment 2 (PB1) 4001.0 0.000000e+00 2238/2274 (98%)
EPI419981 A/mallard/California/2566P/2011 (A/H4N8) segment 2 (PB1) 4001.0 0.000000e+00 2238/2274 (98%)
EPI419974 A/mallard/California/2563V/2011 (A/H4N6) segment 2 (PB1) 4001.0 0.000000e+00 2238/2274 (98%)
EPI419967 A/mallard/California/2563P/2011 (A/H4N6) segment 2 (PB1) 4001.0 0.000000e+00 2238/2274 (98%)
EPI387271 A/northern shoveler/California/3628/2011 (A/H10) segment 2 (PB1) 4001.0 0.000000e+00 2238/2274 (98%)
EPI527489 A/blue-winged teal/TX/AI13-1028/2013 (A/H14N5) segment 2 (PB1) 3995.4 0.000000e+00 2237/2274 (98%)
EPI616276 A/mallard/Ohio/12OS2351/2012 (A/H3N6) segment 2 (PB1) 3989.9 0.000000e+00 2236/2274 (98%)
EPI616160 A/American green-winged teal/Ohio/12OS2128/2012 (A/H6N5) segment 2 (PB1) 3989.9 0.000000e+00 2236/2274 (98%)
EPI531395 A/blue-winged teal/Guatemala/CIP049H105-15/2011 (A/H14N3) segment 2 (PB1) 3989.9 0.000000e+00 2236/2274 (98%)
EPI531387 A/blue-winged teal/Guatemala/CIP049H106-62/2011 (A/H14N6) segment 2 (PB1) 3989.9 0.000000e+00 2236/2274 (98%)
EPI513151 A/northern shoveler/Wisconsin/11OS4631/2011 (A/H0) segment 2 (PB1) 3989.9 0.000000e+00 2236/2274 (98%)
EPI512252 A/northern shoveler/Mississippi/12OS231/2012 (A/H0) segment 2 (PB1) 3989.9 0.000000e+00 2236/2274 (98%)
EPI449635 A/mallard/Minnesota/Sg-01034/2008 (A/H11N2) segment 2 (PB1) 3989.9 0.000000e+00 2236/2274 (98%)
EPI420214 A/green-winged teal/California/123/2012 (A/H1N1) segment 2 (PB1) 3989.9 0.000000e+00 2236/2274 (98%)
EPI614841 A/mallard/Ohio/12OS5400/2013 (A/H0) segment 2 (PB1) 3984.3 0.000000e+00 2235/2274 (98%)
EPI549555 A/blue-winged teal/TX/AI13-1009/2013 (A/H11N3) segment 2 (PB1) 3984.3 0.000000e+00 2235/2274 (98%)
EPI512871 A/northern pintail/Wisconsin/11OS3299/2011 (A/H4N6) segment 2 (PB1) 3984.3 0.000000e+00 2235/2274 (98%)
EPI512587 A/American green-winged teal/Mississippi/11OS5869/2011 (A/H4N6) segment 2 (PB1) 3984.3 0.000000e+00 2235/2274 (98%)
EPI333682 A/mallard/Ohio/1695/2009 (A/H4N6) segment 2 (PB1) 3984.3 0.000000e+00 2235/2274 (98%)
EPI617004 A/mallard/Alberta/192/2010 (A/H7N3) segment 2 (PB1) 3978.8 0.000000e+00 2234/2274 (98%)
EPI616992 A/mallard/Alberta/167/2010 (A/H7N3) segment 2 (PB1) 3978.8 0.000000e+00 2234/2274 (98%)
EPI616341 A/mallard/Missouri/12OS5759/2012 (A/H11N9) segment 2 (PB1) 3978.8 0.000000e+00 2234/2274 (98%)

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Fri Jul 24, 2015 8:27 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
EPI620404 A/chicken/Iowa/14399-4/2015 (A/H5N2) segment 3 (PA) 3973.3 0.000000e+00 2151/2151 (100%)
EPI620403 A/chicken/Iowa/14322-6/2015 (A/H5N2) segment 3 (PA) 3973.3 0.000000e+00 2151/2151 (100%)
EPI620402 A/turkey/Iowa/14318-1/2015 (A/H5N2) segment 3 (PA) 3973.3 0.000000e+00 2151/2151 (100%)
EPI620401 A/turkey/Iowa/14319-1/2015 (A/H5N2) segment 3 (PA) 3973.3 0.000000e+00 2151/2151 (100%)
EPI620400 A/chicken/Iowa/13542-2/2015 (A/H5N2) segment 3 (PA) 3973.3 0.000000e+00 2151/2151 (100%)
EPI587639 A/chicken/Iowa/04-20/2015 (A/H5N2) segment 3 (PA) 3973.3 0.000000e+00 2151/2151 (100%)
EPI620399 A/turkey/Iowa/13541-1/2015 (A/H5N2) segment 3 (PA) 3962.2 0.000000e+00 2149/2151 (99%)
EPI620398 A/turkey/Iowa/11762-1/2015 (A/H5N2) segment 3 (PA) 3962.2 0.000000e+00 2149/2151 (99%)
EPI590476 A/turkey/Minnesota/9845-4/2015 (A/H5N2) segment 3 (PA) 3962.2 0.000000e+00 2149/2151 (99%)
EPI590475 A/chicken/Kansas/8395-3/2015 (A/H5N2) segment 3 (PA) 3962.2 0.000000e+00 2149/2151 (99%)
EPI590472 A/turkey/Minnesota/7172-1/2015 (A/H5N2) segment 3 (PA) 3962.2 0.000000e+00 2149/2151 (99%)
EPI590469 A/turkey/Minnesota/9892-2/2015 (A/H5N2) segment 3 (PA) 3962.2 0.000000e+00 2149/2151 (99%)
EPI590473 A/turkey/Missouri/7458-1/2015 (A/H5N2) segment 3 (PA) 3956.6 0.000000e+00 2148/2151 (99%)
EPI569362 A/domestic duck/Washington/61-16/2014 (A/H5N2) segment 3 (PA) 3951.1 0.000000e+00 2147/2151 (99%)
EPI569360 A/chicken/Washington/61-9/2014 (A/H5N2) segment 3 (PA) 3951.1 0.000000e+00 2147/2151 (99%)
EPI590471 A/chicken/Oregon/A01819044/2015 (A/H5N2) segment 3 (PA) 3945.6 0.000000e+00 2146/2151 (99%)
EPI573280 A/turkey/Washington/61-22/2014 (A/H5N2) segment 3 (PA) 3945.6 0.000000e+00 2146/2151 (99%)
EPI590474 A/turkey/Arkansas/7791-1/2015 (A/H5N2) segment 3 (PA) 3940.0 0.000000e+00 2145/2151 (99%)
EPI586557 A/chicken/BC/FAV25/2014 (A/H5N2) segment 3 (PA) 3940.0 0.000000e+00 2145/2151 (99%)
EPI586541 A/chicken/BC/FAV23/2014 (A/H5N2) segment 3 (PA) 3940.0 0.000000e+00 2145/2151 (99%)
EPI586525 A/chicken/BC/FAV21/2014 (A/H5N2) segment 3 (PA) 3940.0 0.000000e+00 2145/2151 (99%)
EPI586508 A/poultry/BC/FAV19/2014 (A/H5N2) segment 3 (PA) 3940.0 0.000000e+00 2145/2151 (99%)
EPI585107 A/pheasant/Washington/3147-2/2015 (A/H5N2) segment 3 (PA) 3940.0 0.000000e+00 2145/2151 (99%)
EPI569382 A/Northern pintail/Washington/40964/2014 (A/H5N2) segment 3 (PA) 3940.0 0.000000e+00 2145/2151 (99%)
EPI586533 A/chicken/BC/FAV22/2014 (A/H5N2) segment 3 (PA) 3934.5 0.000000e+00 2144/2151 (99%)
EPI586517 A/chicken/BC/FAV20/2014 (A/H5N2) segment 3 (PA) 3934.5 0.000000e+00 2144/2151 (99%)
EPI586500 A/poultry/BC/FAV17/2014 (A/H5N2) segment 3 (PA) 3934.5 0.000000e+00 2144/2151 (99%)
EPI584078 A/turkey/BC/FAV14/2014 (A/H5N2) segment 3 (PA) 3934.5 0.000000e+00 2144/2151 (99%)
EPI576173 A/chicken/BC/FAV8/2014 (A/H5N2) segment 3 (PA) 3934.5 0.000000e+00 2144/2151 (99%)
EPI590470 A/chicken/Washington/3490-18/2015 (A/H5N2) segment 3 (PA) 3928.9 0.000000e+00 2143/2151 (99%)
EPI586549 A/chicken/BC/FAV24/2014 (A/H5N2) segment 3 (PA) 3928.9 0.000000e+00 2143/2151 (99%)
EPI586492 A/poultry/BC/FAV15/2014 (A/H5N2) segment 3 (PA) 3928.9 0.000000e+00 2143/2151 (99%)
EPI573292 A/turkey/BC/FAV10/2014 (A/H5N2) segment 3 (PA) 3928.9 0.000000e+00 2143/2151 (99%)
EPI576174 A/chicken/BC/FAV9/2014 (A/H5N2) segment 3 (PA) 3923.4 0.000000e+00 2142/2151 (99%)
EPI587520 A/American wigeon/BC/050-31/2015 (A/H5N8) segment 3 (PA) 3917.9 0.000000e+00 2141/2151 (99%)
EPI585103 A/turkey/California/K1500169-1.2/2015 (A/H5N8) segment 3 (PA) 3912.3 0.000000e+00 2140/2151 (99%)
EPI569389 A/gyrfalcon/Washington/41088-6/2014 (A/H5N8) segment 3 (PA) 3906.8 0.000000e+00 2139/2151 (99%)
EPI569370 A/guinea fowl/Oregon/41613-1/2014 (A/H5N8) segment 3 (PA) 3906.8 0.000000e+00 2139/2151 (99%)
EPI569368 A/chicken/Oregon/41613-2/2014 (A/H5N8) segment 3 (PA) 3906.8 0.000000e+00 2139/2151 (99%)
EPI553207 A/crane/Kagoshima/KU1/2014 (A/H5N8) segment 3 (PA) 3884.6 0.000000e+00 2135/2151 (99%)
EPI588975 A/duck/Taiwan/a068/2015 (A/H5N8) segment 3 (PA) 3879.1 0.000000e+00 2132/2148 (99%)
EPI588967 A/chicken/Taiwan/a174/2015 (A/H5N3) segment 3 (PA) 3879.1 0.000000e+00 2132/2148 (99%)
EPI561686 A/common teal/Korea/H455-30/2014 (A/H5N8) segment 3 (PA) 3879.1 0.000000e+00 2134/2151 (99%)
EPI588951 A/goose/Taiwan/a015/2015 (A/H5N8) segment 3 (PA) 3873.5 0.000000e+00 2132/2149 (99%)
EPI585536 A/baikal teal/Korea/2414/2014 (A/H5N8) segment 3 (PA) 3873.5 0.000000e+00 2133/2151 (99%)
EPI585535 A/baikal teal/Korea/2406/2014 (A/H5N8) segment 3 (PA) 3873.5 0.000000e+00 2133/2151 (99%)
EPI585531 A/baikal teal/Korea/1458/2014 (A/H5N8) segment 3 (PA) 3873.5 0.000000e+00 2133/2151 (99%)
EPI585530 A/baikal teal/Korea/1457/2014 (A/H5N8) segment 3 (PA) 3873.5 0.000000e+00 2133/2151 (99%)
EPI585528 A/baikal teal/Korea/1454/2014 (A/H5N8) segment 3 (PA) 3873.5 0.000000e+00 2133/2151 (99%)
EPI585525 A/baikal teal/Korea/1448/2014 (A/H5N8) segment 3 (PA) 3873.5 0.000000e+00 2133/2151 (99%)
EPI585524 A/baikal teal/Korea/1447/2014 (A/H5N8) segment 3 (PA) 3873.5 0.000000e+00 2133/2151 (99%)
EPI585523 A/baikal teal/Korea/1446/2014 (A/H5N8) segment 3 (PA) 3873.5 0.000000e+00 2133/2151 (99%)
EPI573637 A/crane/Kagoshima/KU13/2014(H5N8) (A/H5N8) segment 3 (PA) 3873.5 0.000000e+00 2133/2151 (99%)
EPI561712 A/bean goose/Korea/H40/2014 (A/H5N8) segment 3 (PA) 3873.5 0.000000e+00 2133/2151 (99%)
EPI561643 A/tundra swan/Korea/H411/2014 (A/H5N8) segment 3 (PA) 3873.5 0.000000e+00 2133/2151 (99%)
EPI561583 A/broiler duck/Korea/H133/2014 (A/H5N8) segment 3 (PA) 3873.5 0.000000e+00 2133/2151 (99%)
EPI561537 A/Baikal teal/Korea/H84/2014 (A/H5N8) segment 3 (PA) 3873.5 0.000000e+00 2133/2151 (99%)
EPI561534 A/Baikal teal/Korea/H68/2014 (A/H5N8) segment 3 (PA) 3873.5 0.000000e+00 2133/2151 (99%)
EPI561502 A/Baikal teal/Korea/H66/2014 (A/H5N8) segment 3 (PA) 3873.5 0.000000e+00 2133/2151 (99%)
EPI561500 A/Baikal teal/Korea/H62/2014 (A/H5N8) segment 3 (PA) 3873.5 0.000000e+00 2133/2151 (99%)
EPI561338 A/broiler duck/Korea/H49/2014 (A/H5N8) segment 3 (PA) 3873.5 0.000000e+00 2133/2151 (99%)
EPI561334 A/broiler duck/Korea/H47/2014 (A/H5N8) segment 3 (PA) 3873.5 0.000000e+00 2133/2151 (99%)
EPI509694 A/baikal teal/Korea/Donglim3/2014 (A/H5N8) segment 3 (PA) 3873.5 0.000000e+00 2133/2151 (99%)
EPI509693 A/broiler duck/Korea/Buan2/2014 (A/H5N8) segment 3 (PA) 3873.5 0.000000e+00 2133/2151 (99%)
EPI585538 A/baikal teal/Korea/2417/2014 (A/H5N8) segment 3 (PA) 3868.0 0.000000e+00 2132/2151 (99%)
EPI585537 A/baikal teal/Korea/2416/2014 (A/H5N8) segment 3 (PA) 3868.0 0.000000e+00 2132/2151 (99%)
EPI585533 A/baikal teal/Korea/2402/2014 (A/H5N8) segment 3 (PA) 3868.0 0.000000e+00 2132/2151 (99%)
EPI585532 A/baikal teal/Korea/2399/2014 (A/H5N8) segment 3 (PA) 3868.0 0.000000e+00 2132/2151 (99%)
EPI585529 A/baikal teal/Korea/1456/2014 (A/H5N8) segment 3 (PA) 3868.0 0.000000e+00 2132/2151 (99%)
EPI561687 A/spot-billed duck/Korea/H455-42/2014 (A/H5N8) segment 3 (PA) 3868.0 0.000000e+00 2132/2151 (99%)
EPI561642 A/bean goose/Korea/H328/2014 (A/H5N8) segment 3 (PA) 3868.0 0.000000e+00 2132/2151 (99%)
EPI561640 A/Korean native chicken/Korea/H257/2014 (A/H5N8) segment 3 (PA) 3868.0 0.000000e+00 2132/2151 (99%)
EPI561588 A/white-fronted goose/Korea/H231/2014 (A/H5N8) segment 3 (PA) 3868.0 0.000000e+00 2132/2151 (99%)
EPI561587 A/mallard/Korea/H207/2014 (A/H5N8) segment 3 (PA) 3868.0 0.000000e+00 2132/2151 (99%)
EPI561586 A/breeder duck/Korea/H200/2014 (A/H5N8) segment 3 (PA) 3868.0 0.000000e+00 2132/2151 (99%)
EPI561584 A/broiler duck/Korea/H145/2014 (A/H5N8) segment 3 (PA) 3868.0 0.000000e+00 2132/2151 (99%)
EPI561582 A/breeder duck/Korea/H128/2014 (A/H5N8) segment 3 (PA) 3868.0 0.000000e+00 2132/2151 (99%)
EPI561501 A/broiler duck/Korea/H65/2014 (A/H5N8) segment 3 (PA) 3868.0 0.000000e+00 2132/2151 (99%)
EPI561335 A/broiler duck/Korea/H48/2014 (A/H5N8) segment 3 (PA) 3868.0 0.000000e+00 2132/2151 (99%)
EPI561333 A/Baikal teal/Korea/H41/2014 (A/H5N8) segment 3 (PA) 3868.0 0.000000e+00 2132/2151 (99%)
EPI561193 A/broiler duck/Korea/H31/2014 (A/H5N8) segment 3 (PA) 3868.0 0.000000e+00 2132/2151 (99%)
EPI561192 A/broiler duck/Korea/H29/2014 (A/H5N8) segment 3 (PA) 3868.0 0.000000e+00 2132/2151 (99%)
EPI585534 A/baikal teal/Korea/2403/2014 (A/H5N8) segment 3 (PA) 3862.5 0.000000e+00 2131/2151 (99%)
EPI585527 A/baikal teal/Korea/1452/2014 (A/H5N8) segment 3 (PA) 3862.5 0.000000e+00 2131/2151 (99%)
EPI585526 A/baikal teal/Korea/1449/2014 (A/H5N8) segment 3 (PA) 3862.5 0.000000e+00 2131/2151 (99%)
EPI585522 A/baikal teal/Korea/1445/2014 (A/H5N8) segment 3 (PA) 3862.5 0.000000e+00 2131/2151 (99%)
EPI585521 A/baikal teal/Korea/1441/2014 (A/H5N8) segment 3 (PA) 3862.5 0.000000e+00 2131/2151 (99%)
EPI585520 A/baikal teal/Korea/1437/2014 (A/H5N8) segment 3 (PA) 3862.5 0.000000e+00 2131/2151 (99%)
EPI561641 A/mallard/Korea/H297/2014 (A/H5N8) segment 3 (PA) 3862.5 0.000000e+00 2131/2151 (99%)
EPI561639 A/breeder chicken/Korea/H250/2014 (A/H5N8) segment 3 (PA) 3862.5 0.000000e+00 2131/2151 (99%)
EPI561585 A/breeder duck/Korea/H158/2014 (A/H5N8) segment 3 (PA) 3862.5 0.000000e+00 2131/2151 (99%)
EPI561539 A/breeder chicken/Korea/H122/2014 (A/H5N8) segment 3 (PA) 3862.5 0.000000e+00 2131/2151 (99%)
EPI561538 A/Baikal teal/Korea/H96/2014 (A/H5N8) segment 3 (PA) 3862.5 0.000000e+00 2131/2151 (99%)
EPI561536 A/Coot/Korea/H81/2014 (A/H5N8) segment 3 (PA) 3862.5 0.000000e+00 2131/2151 (99%)
EPI561535 A/Baikal teal/Korea/H80/2014 (A/H5N8) segment 3 (PA) 3862.5 0.000000e+00 2131/2151 (99%)
EPI561499 A/bean goose/Korea/H53/2014 (A/H5N8) segment 3 (PA) 3862.5 0.000000e+00 2131/2151 (99%)
EPI561184 A/waterfowl/Korea/S005/2014 (A/H5N8) segment 3 (PA) 3862.5 0.000000e+00 2131/2151 (99%)
EPI573645 A/crane/Kagoshima/KU21/2014(H5N8) (A/H5N8) segment 3 (PA) 3856.9 0.000000e+00 2130/2151 (99%)
EPI561638 A/breeder duck/Korea/H249/2014 (A/H5N8) segment 3 (PA) 3856.9 0.000000e+00 2130/2151 (99%)
EPI542618 A/mallard/Korea/W452/2014 (A/H5N8) segment 3 (PA) 3856.9 0.000000e+00 2130/2151 (99%)

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Fri Jul 24, 2015 8:34 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
EPI620461 A/chicken/Iowa/14589-1/2015 (A/H5N2) segment 8 (NS) 1548.6 0.000000e+00 838/838 (100%)
EPI620447 A/chicken/Iowa/14322-6/2015 (A/H5N2) segment 8 (NS) 1548.6 0.000000e+00 838/838 (100%)
EPI620440 A/turkey/Iowa/14319-1/2015 (A/H5N2) segment 8 (NS) 1548.6 0.000000e+00 838/838 (100%)
EPI620433 A/turkey/Iowa/14318-1/2015 (A/H5N2) segment 8 (NS) 1548.6 0.000000e+00 838/838 (100%)
EPI620426 A/chicken/Iowa/13542-2/2015 (A/H5N2) segment 8 (NS) 1548.6 0.000000e+00 838/838 (100%)
EPI620419 A/turkey/Iowa/13541-1/2015 (A/H5N2) segment 8 (NS) 1548.6 0.000000e+00 838/838 (100%)
EPI620412 A/turkey/Iowa/11762-1/2015 (A/H5N2) segment 8 (NS) 1548.6 0.000000e+00 838/838 (100%)
EPI590689 A/turkey/Minnesota/9892-2/2015 (A/H5N2) segment 8 (NS) 1548.6 0.000000e+00 838/838 (100%)
EPI587637 A/chicken/Iowa/04-20/2015 (A/H5N2) segment 8 (NS) 1548.6 0.000000e+00 838/838 (100%)
EPI620454 A/chicken/Iowa/14399-4/2015 (A/H5N2) segment 8 (NS) 1543.1 0.000000e+00 837/838 (99%)
EPI590744 A/turkey/Minnesota/9845-4/2015 (A/H5N2) segment 8 (NS) 1543.1 0.000000e+00 837/838 (99%)
EPI590737 A/chicken/Kansas/8395-3/2015 (A/H5N2) segment 8 (NS) 1543.1 0.000000e+00 837/838 (99%)
EPI590723 A/turkey/Missouri/7458-1/2015 (A/H5N2) segment 8 (NS) 1543.1 0.000000e+00 837/838 (99%)
EPI590716 A/turkey/Minnesota/7172-1/2015 (A/H5N2) segment 8 (NS) 1543.1 0.000000e+00 837/838 (99%)
EPI569366 A/turkey/Washington/61-22/2014 (A/H5N2) segment 8 (NS) 1543.1 0.000000e+00 837/838 (99%)
EPI586554 A/chicken/BC/FAV24/2014 (A/H5N2) segment 8 (NS) 1537.5 0.000000e+00 836/838 (99%)
EPI586538 A/chicken/BC/FAV22/2014 (A/H5N2) segment 8 (NS) 1537.5 0.000000e+00 836/838 (99%)
EPI586522 A/chicken/BC/FAV20/2014 (A/H5N2) segment 8 (NS) 1537.5 0.000000e+00 836/838 (99%)
EPI586514 A/poultry/BC/FAV19/2014 (A/H5N2) segment 8 (NS) 1537.5 0.000000e+00 836/838 (99%)
EPI585671 A/baikal teal/Korea/2417/2014 (A/H5N8) segment 8 (NS) 1537.5 0.000000e+00 836/838 (99%)
EPI585670 A/baikal teal/Korea/2416/2014 (A/H5N8) segment 8 (NS) 1537.5 0.000000e+00 836/838 (99%)
EPI585669 A/baikal teal/Korea/2414/2014 (A/H5N8) segment 8 (NS) 1537.5 0.000000e+00 836/838 (99%)
EPI585667 A/baikal teal/Korea/2403/2014 (A/H5N8) segment 8 (NS) 1537.5 0.000000e+00 836/838 (99%)
EPI585666 A/baikal teal/Korea/2402/2014 (A/H5N8) segment 8 (NS) 1537.5 0.000000e+00 836/838 (99%)
EPI585664 A/baikal teal/Korea/1458/2014 (A/H5N8) segment 8 (NS) 1537.5 0.000000e+00 836/838 (99%)
EPI585663 A/baikal teal/Korea/1457/2014 (A/H5N8) segment 8 (NS) 1537.5 0.000000e+00 836/838 (99%)
EPI585660 A/baikal teal/Korea/1452/2014 (A/H5N8) segment 8 (NS) 1537.5 0.000000e+00 836/838 (99%)
EPI585657 A/baikal teal/Korea/1447/2014 (A/H5N8) segment 8 (NS) 1537.5 0.000000e+00 836/838 (99%)
EPI585656 A/baikal teal/Korea/1446/2014 (A/H5N8) segment 8 (NS) 1537.5 0.000000e+00 836/838 (99%)
EPI585655 A/baikal teal/Korea/1445/2014 (A/H5N8) segment 8 (NS) 1537.5 0.000000e+00 836/838 (99%)
EPI585653 A/baikal teal/Korea/1437/2014 (A/H5N8) segment 8 (NS) 1537.5 0.000000e+00 836/838 (99%)
EPI585096 A/pheasant/Washington/3147-2/2015 (A/H5N2) segment 8 (NS) 1537.5 0.000000e+00 836/838 (99%)
EPI576474 A/chicken/BC/FAV8/2014 (A/H5N2) segment 8 (NS) 1537.5 0.000000e+00 836/838 (99%)
EPI569394 A/gyrfalcon/Washington/41088-6/2014 (A/H5N8) segment 8 (NS) 1537.5 0.000000e+00 836/838 (99%)
EPI569387 A/Northern pintail/Washington/40964/2014 (A/H5N2) segment 8 (NS) 1537.5 0.000000e+00 836/838 (99%)
EPI569363 A/domestic duck/Washington/61-16/2014 (A/H5N2) segment 8 (NS) 1537.5 0.000000e+00 836/838 (99%)
EPI569361 A/chicken/Washington/61-9/2014 (A/H5N2) segment 8 (NS) 1537.5 0.000000e+00 836/838 (99%)
EPI568703 A/guinea fowl/Oregon/41613-1/2014 (A/H5N8) segment 8 (NS) 1537.5 0.000000e+00 836/838 (99%)
EPI568700 A/chicken/Oregon/41613-2/2014 (A/H5N8) segment 8 (NS) 1537.5 0.000000e+00 836/838 (99%)
EPI561713 A/broiler duck/Korea/H31/2014 (A/H5N8) segment 8 (NS) 1537.5 0.000000e+00 836/838 (99%)
EPI561701 A/spot-billed duck/Korea/H455-42/2014 (A/H5N8) segment 8 (NS) 1537.5 0.000000e+00 836/838 (99%)
EPI561694 A/common teal/Korea/H455-30/2014 (A/H5N8) segment 8 (NS) 1537.5 0.000000e+00 836/838 (99%)
EPI561685 A/tundra swan/Korea/H411/2014 (A/H5N8) segment 8 (NS) 1537.5 0.000000e+00 836/838 (99%)
EPI561678 A/bean goose/Korea/H328/2014 (A/H5N8) segment 8 (NS) 1537.5 0.000000e+00 836/838 (99%)
EPI561671 A/mallard/Korea/H297/2014 (A/H5N8) segment 8 (NS) 1537.5 0.000000e+00 836/838 (99%)
EPI561664 A/Korean native chicken/Korea/H257/2014 (A/H5N8) segment 8 (NS) 1537.5 0.000000e+00 836/838 (99%)
EPI561657 A/breeder chicken/Korea/H250/2014 (A/H5N8) segment 8 (NS) 1537.5 0.000000e+00 836/838 (99%)
EPI561630 A/mallard/Korea/H207/2014 (A/H5N8) segment 8 (NS) 1537.5 0.000000e+00 836/838 (99%)
EPI561623 A/breeder duck/Korea/H200/2014 (A/H5N8) segment 8 (NS) 1537.5 0.000000e+00 836/838 (99%)
EPI561574 A/Baikal teal/Korea/H96/2014 (A/H5N8) segment 8 (NS) 1537.5 0.000000e+00 836/838 (99%)
EPI561560 A/Coot/Korea/H81/2014 (A/H5N8) segment 8 (NS) 1537.5 0.000000e+00 836/838 (99%)
EPI561553 A/Baikal teal/Korea/H80/2014 (A/H5N8) segment 8 (NS) 1537.5 0.000000e+00 836/838 (99%)
EPI561533 A/Baikal teal/Korea/H66/2014 (A/H5N8) segment 8 (NS) 1537.5 0.000000e+00 836/838 (99%)
EPI561519 A/Baikal teal/Korea/H62/2014 (A/H5N8) segment 8 (NS) 1537.5 0.000000e+00 836/838 (99%)
EPI561345 A/Baikal teal/Korea/H41/2014 (A/H5N8) segment 8 (NS) 1537.5 0.000000e+00 836/838 (99%)
EPI561200 A/broiler duck/Korea/H29/2014 (A/H5N8) segment 8 (NS) 1537.5 0.000000e+00 836/838 (99%)
EPI542634 A/mallard/Korea/W452/2014 (A/H5N8) segment 8 (NS) 1537.5 0.000000e+00 836/838 (99%)
EPI509757 A/baikal teal/Korea/Donglim3/2014 (A/H5N8) segment 8 (NS) 1537.5 0.000000e+00 836/838 (99%)
EPI509712 A/broiler duck/Korea/Buan2/2014 (A/H5N8) segment 8 (NS) 1537.5 0.000000e+00 836/838 (99%)
EPI590730 A/turkey/Arkansas/7791-1/2015 (A/H5N2) segment 8 (NS) 1532.0 0.000000e+00 835/838 (99%)
EPI590709 A/chicken/Oregon/A01819044/2015 (A/H5N2) segment 8 (NS) 1532.0 0.000000e+00 835/838 (99%)
EPI587525 A/American wigeon/BC/050-31/2015 (A/H5N8) segment 8 (NS) 1532.0 0.000000e+00 835/838 (99%)
EPI586562 A/chicken/BC/FAV25/2014 (A/H5N2) segment 8 (NS) 1532.0 0.000000e+00 835/838 (99%)
EPI586546 A/chicken/BC/FAV23/2014 (A/H5N2) segment 8 (NS) 1532.0 0.000000e+00 835/838 (99%)
EPI586530 A/chicken/BC/FAV21/2014 (A/H5N2) segment 8 (NS) 1532.0 0.000000e+00 835/838 (99%)
EPI586505 A/poultry/BC/FAV17/2014 (A/H5N2) segment 8 (NS) 1532.0 0.000000e+00 835/838 (99%)
EPI585668 A/baikal teal/Korea/2406/2014 (A/H5N8) segment 8 (NS) 1532.0 0.000000e+00 835/838 (99%)
EPI585665 A/baikal teal/Korea/2399/2014 (A/H5N8) segment 8 (NS) 1532.0 0.000000e+00 835/838 (99%)
EPI585661 A/baikal teal/Korea/1454/2014 (A/H5N8) segment 8 (NS) 1532.0 0.000000e+00 835/838 (99%)
EPI585659 A/baikal teal/Korea/1449/2014 (A/H5N8) segment 8 (NS) 1532.0 0.000000e+00 835/838 (99%)
EPI585658 A/baikal teal/Korea/1448/2014 (A/H5N8) segment 8 (NS) 1532.0 0.000000e+00 835/838 (99%)
EPI585654 A/baikal teal/Korea/1441/2014 (A/H5N8) segment 8 (NS) 1532.0 0.000000e+00 835/838 (99%)
EPI584083 A/turkey/BC/FAV14/2014 (A/H5N2) segment 8 (NS) 1532.0 0.000000e+00 835/838 (99%)
EPI561650 A/breeder duck/Korea/H249/2014 (A/H5N8) segment 8 (NS) 1532.0 0.000000e+00 835/838 (99%)
EPI561609 A/broiler duck/Korea/H145/2014 (A/H5N8) segment 8 (NS) 1532.0 0.000000e+00 835/838 (99%)
EPI561602 A/broiler duck/Korea/H133/2014 (A/H5N8) segment 8 (NS) 1532.0 0.000000e+00 835/838 (99%)
EPI561595 A/breeder duck/Korea/H128/2014 (A/H5N8) segment 8 (NS) 1532.0 0.000000e+00 835/838 (99%)
EPI561581 A/breeder chicken/Korea/H122/2014 (A/H5N8) segment 8 (NS) 1532.0 0.000000e+00 835/838 (99%)
EPI561546 A/Baikal teal/Korea/H68/2014 (A/H5N8) segment 8 (NS) 1532.0 0.000000e+00 835/838 (99%)
EPI561364 A/bean goose/Korea/H40/2014 (A/H5N8) segment 8 (NS) 1532.0 0.000000e+00 835/838 (99%)
EPI561357 A/broiler duck/Korea/H48/2014 (A/H5N8) segment 8 (NS) 1532.0 0.000000e+00 835/838 (99%)
EPI561352 A/broiler duck/Korea/H47/2014 (A/H5N8) segment 8 (NS) 1532.0 0.000000e+00 835/838 (99%)
EPI561191 A/waterfowl/Korea/S005/2014 (A/H5N8) segment 8 (NS) 1532.0 0.000000e+00 835/838 (99%)
EPI554604 A/turkey/Germany-NI/R3372/2014 (A/H5N8) segment 8 (NS) 1532.0 0.000000e+00 835/838 (99%)
EPI553471 A/wigeon/Sakha/1/2014 (A/H5N8) segment 8 (NS) 1532.0 0.000000e+00 835/838 (99%)
EPI552750 A/turkey/Germany/R2474-L00899/2014 (A/H5N8) segment 8 (NS) 1532.0 0.000000e+00 835/838 (99%)
EPI548628 A/chicken/Netherlands/14015531/2014 (A/H5N8) segment 8 (NS) 1532.0 0.000000e+00 835/838 (99%)
EPI548428 A/turkey/Germany-MV/R2472/2014 (A/H5N8) segment 8 (NS) 1532.0 0.000000e+00 835/838 (99%)
EPI590696 A/chicken/Washington/3490-18/2015 (A/H5N2) segment 8 (NS) 1526.5 0.000000e+00 834/838 (99%)
EPI588956 A/goose/Taiwan/a015/2015 (A/H5N8) segment 8 (NS) 1526.5 0.000000e+00 834/838 (99%)
EPI586497 A/poultry/BC/FAV15/2014 (A/H5N2) segment 8 (NS) 1526.5 0.000000e+00 834/838 (99%)
EPI585662 A/baikal teal/Korea/1456/2014 (A/H5N8) segment 8 (NS) 1526.5 0.000000e+00 834/838 (99%)
EPI576481 A/chicken/BC/FAV9/2014 (A/H5N2) segment 8 (NS) 1526.5 0.000000e+00 834/838 (99%)
EPI573642 A/crane/Kagoshima/KU13/2014(H5N8) (A/H5N8) segment 8 (NS) 1526.5 0.000000e+00 834/838 (99%)
EPI573302 A/turkey/BC/FAV10/2014 (A/H5N2) segment 8 (NS) 1526.5 0.000000e+00 834/838 (99%)
EPI561637 A/white-fronted goose/Korea/H231/2014 (A/H5N8) segment 8 (NS) 1526.5 0.000000e+00 834/838 (99%)
EPI561616 A/breeder duck/Korea/H158/2014 (A/H5N8) segment 8 (NS) 1526.5 0.000000e+00 834/838 (99%)
EPI561567 A/Baikal teal/Korea/H84/2014 (A/H5N8) segment 8 (NS) 1526.5 0.000000e+00 834/838 (99%)
EPI561512 A/bean goose/Korea/H53/2014 (A/H5N8) segment 8 (NS) 1526.5 0.000000e+00 834/838 (99%)
EPI558013 A/duck/England/36038/14 (A/H5N8) segment 8 (NS) 1526.5 0.000000e+00 834/838 (99%)

_________________
www.twitter.com/hniman


Top
 Profile  
 
Display posts from previous:  Sort by  
Post new topic Reply to topic  [ 9 posts ] 

All times are UTC - 5 hours [ DST ]


Who is online

Users browsing this forum: Google [Bot] and 36 guests


You cannot post new topics in this forum
You cannot reply to topics in this forum
You cannot edit your posts in this forum
You cannot delete your posts in this forum
You cannot post attachments in this forum

Search for:
Jump to:  
Powered by phpBB® Forum Software © phpBB Group