Rhiza Labs FluTracker Forum

The place to discuss the flu
It is currently Thu Oct 19, 2017 5:12 am

All times are UTC - 5 hours [ DST ]




Post new topic Reply to topic  [ 7 posts ] 
Author Message
PostPosted: Mon Jun 15, 2015 7:43 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
Guangdong CDC has released three nearly compete sequences for GD01. Variant 1 has a 414 BP deletion while Variant 2 has a 419 BP deletion.

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Mon Jun 15, 2015 7:46 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
LOCUS KT036372 29928 bp RNA linear VRL 10-JUN-2015
DEFINITION Middle East respiratory syndrome coronavirus isolate ChinaGD01,
partial genome.
ACCESSION KT036372
VERSION KT036372.1 GI:829624497
KEYWORDS .
SOURCE Middle East respiratory syndrome coronavirus (MERS-CoV)
ORGANISM Middle East respiratory syndrome coronavirus
Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA
stage; Nidovirales; Coronaviridae; Coronavirinae; Betacoronavirus;
unclassified Betacoronavirus.
REFERENCE 1 (bases 1 to 29928)
AUTHORS Su,J., Xu,J., Zhang,B., Xie,Q., Zhao,W. and Ke,C.
TITLE Direct Submission
JOURNAL Submitted (08-JUN-2015) Key Laboratory for Repository and
Application of Pathogenic Microbiology, Research Center for
Pathogens Detection Technology of Emerging Infectious Diseases,
Guangdong Provincial Center for Disease Control and Prevention, 176
Xin Gang West Road, Guangzhou, Guangdong 510515, China
COMMENT ##Assembly-Data-START##
Assembly Method :: DNAstar v. 7.0
Sequencing Technology :: Sanger dideoxy sequencing
##Assembly-Data-END##
FEATURES Location/Qualifiers
source 1..29928
/organism="Middle East respiratory syndrome coronavirus"
/mol_type="genomic RNA"
/isolate="ChinaGD01"
/host="Homo sapiens"
/db_xref="taxon:1335626"
/country="China"
/collection_date="28-May-2015"
CDS join(135..13289,13289..21370)
/ribosomal_slippage
/note="ribosomal slippage"
/codon_start=1
/product="ORF1ab"
/protein_id="AKL80591.1"
/db_xref="GI:829624498"
/translation="MSFVAGVIAQGARGTYRAALNSEKHQDHVSLTVPLCGSGNLVEK
LSPWFMDGENAYEVVKAMLLKKEPLLYVPIRLAGHTRHLPGPRVYLVERLIACENPFM
VNQLAYSSSANGSLVGTTLQGKPIGMFFPYDIELVTGKQNILLRKYGRGGYHYTPVHY
ERDNTSCPEWMDDFEADPKGKYAQNLLKKLIGGDVTPVDQYMCGVDGKPISAYAFLMA
KDGITKLADVEADVAARADDEGFITLKNNLYRLVWHVERKDVPYPKQSIFTINSVVQK
DGVENTPPHYFTLGCKILTLTPRNKWSGVSDLSLKQKLLYTFYGKESLENPTYIYHSA
FIECGSCGNDSWLTGNAIQGFACGCGASYTANDVEVQSSGMIKPNALLCATCPFAKGD
SCSSNCKHSVAQLVSYLSERCNVIADSKSFTLIFGGVAYAYFGCEEGTMYFVPRAKSV
VSRIGDSIFTGCTGSWNKVTQIANMFLEQTQHSLNFVGEFVVNDVVLAILSGTTTNVD
KIRQLLKGVTIDKLRDYLADYDVAVTAGPFMDNAINVGGTGLQYAAITAPYVVLTGLG
ESFKKVATIPYKVCNSVKDTLTYYAHSVLYRVFPYDMDSGVSSFSELLFDCVDLSVAS
TYFLVRLLQDKTGDFMSTIITSCQTAVSKLLDTCFEATEATFNFLLDLAGLFRIFLRN
AYVYTSQGFVVVNGKVSTLVKQVLDLLNKGMQLLHTKVSWAGSNISAVIYSGRESLIF
PSGTYYCVTTKAKSVQQDLDVILPGEFSKKQLGLLQPTDNSTTVSVTVSSNMVETVVG
QLEQTNMHSPDVIVGDYVIISEKLFVRSKEEDGFAFYPACTNGHAVPTLFRLKGGAPV
KKVAFGGDQVHEVAAVRSVTVEYNIHAVLDTLLASSSLRTFVVDKSLSIEEFADVVKE
QVSDLLVKLLRGMPIPDFDLDDFIDAPCYCFNAEGDASWSSTMIFSLHPVECDEECSE
VEASGLEEGESECISETSTEQVDVSHEVSDDEWAAAVDEAFPLDEAEDVTESVQEEAQ
PVEVPVEDIAQVVIADTLQETPVVSDTVEVPPQVVKLPSEPQTIQPEVKEVAPVYEAD
TEQTQSVTVKPKRLRKKRNVDPLSNFEHKVITECVTIVLGDAIQVAKCYGESVLVNAA
NTHLKHGGGIAGAINAASKGAVQKESDEYILAKGPLQVGDSVLLQGHSLAKNILHVVG
PDARAKQDVSLLSKCYKAMNAYPLVVTPLVSTGIFGVKPAVSFDYLIREAKTRVLVVV
NSQDVYKSLTIVDIPQSLTFSYDGLRGAIRKAKDYGFTVFVCTDNSANTKVLRNKGVD
YTKKFLTVDGVQYYCYTSKDTLDDILQQANKSVGIISMPLGYVSHGLDLIQAGSVVRR
VNVPYVCLLANKEQEAILMSEDVKLNPSEDFIKHVRTNGGYNSWHLVEGELLVQDLRL
NKLLHWSDQTICYKDSVFYVVKNSTAFPFETLSACRAYLDSRTTQQLTIEVLVTVDGV
NFRTVVLNNKNTYRSQLGCVFFNGADISDTIPDEKQNGHSLYLADNLTADETKALKEL
YGPVDPTFLHRFYSLKAAVHKWKMVVCDKVRSLKLSDNNCYLNAVIMTLDLLKDIKFV
IPALQHAFMKHKGGDSTDFIALIMAYGNCTFGAPDDASRLLHTVLAKAELCCSARMVW
REWCNVCGIKDVVLQGLKACCYVGVQTVEDLRARMTYVCQCGGERHRQIVEHTTPWLL
LSGTPNEKLVTTSTAPDFVAFNVFQGIETAVGHYVHACLKGGLILKFDSGTVSKTSDW
KCKVTDVLFPGQKYSSDCNVVRYSLDGNFRTEVDPDLSAFYVKDGKYFISEPPVTYSP
ATILAGSVYTNSCLVSSDGQPGGDAISLSFNNLLGFDSSKPVTKKYTYSFLPKEDGDV
LLAEFDTYDPIYKNGAMYKGKPILWVNKASYDTNLNKFNRASLRQIFDVAPIELENKF
TPLSVASTPVEPPTVDVVALQQEMTIVKCKGLNKPFVKDNVSFVVDDSGTPVVEYLSK
EDLHTLYVDPKYQVIVLKDNVLSSMLRLHTVESGDINVVAASGSLTRKVKLLFRASFY
FKEFATRTFTATTAVGSCIKSVVRHLGVTKGILTGCFSFVKMLFILPLAYFSDSKLGT
TEVKVSALKTAGVVTGNVVKQCCTAAVDLSMDKLRRVDWKSTLRLLLMLCTTMVLLSS
VYHLYVFNQVLSSDVMFEDAQGLKKFYKEVRAYLGISSACDGLASAYRANSFDVPTFC
ANRSAMCNWCLISQDSITHYPALKMVQTHLSHYVLNIDWLWFAFETGLAYMLYTSAFN
WLLLAGTLHYFFAQTSIFVDWRSYNYAVSSAFWLFTHIPMAGLVRMYNLLACLWLLRK
FYQHVINGCKDTACLLCYKRNRLTRVEASTVVCGGKRTFYITANGGISFCRRHNWNCV
DCDIAGVGNTFICEEVANDLTTALRRPINATDRSHYYVDSVTVKETVVQFNYRRDGQP
FYERFPLCAFTNLDKLKFKEVCKTTTGIPEYNFIIYDSSDRGQESLARSACVYYSQVL
CKSILLVDSSLVTSVGDSSEIATKMFDSFVNSFVSLYNVTRDKLEKLISTARDGVRRG
DNFHSVLTTFIDAARGPAGVESDVETNEIVDSVQYAHKHDIQITNESYNNYVPSYVKP
DSVSTSDLGSLIDCNAASVNQIVLRNSNGACIWNAAAYMKLSDALKRQIRIACRKCNL
AFRLTTSKLRANDNILSVRFTANKIVGGAPTWFNVLRDFTLKGYVLATIIVFLCAVLM
YLCLPTFSMVPVEFYEDRILDFKVLDNGIIRDVNPDDKCFANKHRSFTQWYHEHVGGV
YDNSITCPLTVAVIAGVAGARIPDVPTTLAWVNNQIIFFVSRVFANTGSVCYTPIDEI
PYKSFSDSGCILPSECTMFRDAEGRMTPYCHDPTVLPGAFAYSQMRPHVRYDLYDGNM
FIKFPEVVFESTLRITRTLSTQYCRFGSCEYAQEGVCITTNGSWAIFNDHHLNRPGVY
CGSDFIDIVRRLAVSLFQPITYFQLTTSLVLGIGLCAFLTLLFYYINKVKRAFADYTQ
CAVIAVVAAVLNSLCICFVASIPLCIVPYTALYYYATFYFTNEPAFIMHVSWYIMFGP
IVPIWMTCVYTVAMCFRHFFWVLAYFSKKHVEVFTDGKLNCSFQDAASNIFVINKDTY
AALRNSLTNDAYSRFLGLFNKYKYFSGAMETAAYREAAACHLAKALQTYSETGSDLLY
QPPNCSITSGVLQSGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCP
ADQLSDPNYDALLISMTNHSFSVQKHIGAPANLRVVGHAMQGTLLKLTVDVANPSTPA
YTFTTVKPGAAFSVLACYNGRPTGTFTVVMRPNYTIKGSFLCGSCGSVGYTKEGSVIN
FCYMHQMELANGTHTGSAFDGTMYGAFMDKQVHQVQLTDKYCSVNVVAWLYAAILNGC
AWFVKPNRTSVVSFNEWALANQFTEFVGTQSVDMLAVKTGVAIEQLLYAIQQLYTGFQ
GKQILGSTMLEDEFTPEDVNMQIMGVVMQSGVRKVTYGTAHWLFATLVSTYVIILQAT
KFTLWNYLFETIPTQLFPLLFVTMAFVMLLVKHKHTFLTLFLLPVAICLTYANIVYEP
TTPISSALIAVANWLAPTNAYMRTTHTDIGVYISMSLVLVIVVKRLYNPSLSNFALAL
CSGVMWLYTYSIGEASSPIAYLVFVTTLTSDYTITVFVTVNLAKVCTYAIFAYSPQLT
LVFPEVKMILLLYTCLGFMCTCYFGVFSFLNLKLRAPMGVYDFKVSTQEFRFMTANNL
TAPRNSWEAMALNFKLIGIGGTPCIKVAAMQSKLTDLKCTSVVLLSVLQQLHLEANSR
AWAFCVKCHNDILAATDPSEAFEKFVSLFATLMTFSGNVDLDALASDIFDTPSVLQAT
LSEFSHLATFAELEAAQKAYQEAMDSGDTSPQVLKALQKAVNIAKNAYEKDKAVARKL
ERMADQAMTSMYKQARAEDKKAKIVSAMQTMLFGMIKKLDNDVLNGIISNARNGCIPL
SVIPLCASNKLRVVIPDFTVWNQVVTYPSLNYAGALWDITVINNVDNEIVKSSDVVDS
NENLTWPLVLECTRASTSAVKLQNNEIKPSGLKTMVVSAGQEQTNCNTSSLAYYEPVQ
GRKMLMALLSDNAYLKWARVEGKDGFVSVELQPPCKFLIAGPKGPEIRYLYFVKNLNN
LHRGQVLGHIAATVRLQAGSNTEFASNSSVLSLVNFTVDPQKAYLDFVNAGGAPLTNC
VKMLTPKTGTGIAISVKPESTADQETYGGASVCLYCRAHIEHPDVSGVCKYKGKFVQI
PAQCVRDPVGFCLSNTPCNVCQYWIGYGCNCDSLRQVALPQSKDSNFLNRVRGSIVNA
RIEPCSSGLSTDVVFRAFDICNYKAKVAGIGKYYKTNTCRFVELDDQGHHLDSYFVVK
RHTMENYELEKHCYDLLRDCDAVAPHDFFIFDVDKVKTPHIVRQRLTEYTMMDLVYAL
RHFDQNSEVLKAILVKYGCCDVTYFENKLWFDFVENPSVIGVYHKLGERVRQAILNTV
KFCDHMVKAGLVGVLTLDNQDLNGKWYDFGDFVITQPGSGVAIVDSYYSYLMPVLSMT
DCLAAETHRDCDFNKPLIEWPLTEYDFTDYKVQLFEKYFKYWDQTYHANCVNCTDDRC
VLHCANFNVLFAMTMPKTCFGPIVRKIFVDGVPFVVSCGYHYKELGLVMNMDVSLHRH
RLSLKELMMYAADPAMHIASSNAFLDLRTSCFSVAALTTGLTFQTVRPGNFNQDFYDF
VVSKGFFKEGSSVTLKHFFFAQDGNAAITDYNYYSYNLPTMCDIKQMLFCMEVVNKYF
EIYDGGCLNASEVVVNNLDKSAGHPFNKFGKARVYYESMSYQEQDELFAMTKRNVIPT
MTQMNLKYAISAKNRARTVAGVSILSTMTNRQYHQKMLKSMAATRGATCVIGTTKFYG
GWDFMLKTLYKDVDNPHLMGWDYPKCDRAMPNMCRIFASLILARKHGTCCTTRDRFYR
LANECAQVLSEYVLCGGGYYVKPGGTSSGDATTAYANSVFNILQATTANVSALMGANG
NKIVDKEVKDMQFDLYVNVYRSTSPDPKFVDKYYAFLNKHFSMMILSDDGVVCYNSDY
AAKGYIAGIQNFKETLYYQNNVFMSEAKCWVETDLKKGPHEFCSQHTLYIKDGDDGYF
LPYPDPSRILSAGCFVDDIVKTDGTLMVERFVSLAIDAYPLTKHEDIEYQNVFWVYLQ
YIEKLYKDLTGHMLDSYSVMLCGDNSAKFWEEAFYRDLYSSPTTLQAVGSCVVCHSQT
SLRCGTCIRRPFLCCKCCYDHVIATPHKMVLSVSPYVCNAPGCGVSDVTKLYLGGMSY
FCVDHRPVCSFPLCANGLVFGLYKNMCTGSPSIVEFNRLATCDWTESGDYTLANTTTE
PLKLFAAETLRATEEASKQSYAIATIKEIVGERQLLLVWEAGKSKPPLNRNYVFTGYH
ITKNSKVQLGEYIFERIDYSDAVSYKSSTTYKLTVGDIFVLTSHSVATLTAPTIVNQE
RYVKITGLYPTITVPEEFASHVANFQKSGYSKYVTVQGPPGTGKSHFAIGLAIYYPTA
RVVYTACSHAAVDALCEKAFKYLNIAKCSRIIPAKARVECYDRFKVNETNSQYLFSTI
NALPETSADILVVDEVSMCTNYDLSIINARIKAKHIVYVGDPAQLPAPRTLLTRGTLE
PENFNSVTRLMCNLGPDIFLSMCYRCPKEIVSTVSALVYNNKLLAKKELSGQCFKILY
KGNVTHDASSAINRPQLTFVKNFITANPAWSKAVFISPYNSQNAVARSMLGLTTQTVD
SSQGSEYQYVIFCQTADTAHANNINRFNVAITRAQKGILCVMTSQALFESLEFTELSF
TNYKLQSQIVTGLFKDCSRETSGLSPAYAPTYVSVDDKYKTSDELCVNLNLPANIPYS
RVISRMGFKLDATVPGYPKLFITREEAVRQVRSWIGFDVEGAHASRNACGTNVPLQLG
FSTGVNFVVQPVGVVDTEWGNMLTGIAARPPPGEQFKHLVPLMHKGAAWPIVRRRIVQ
MLSDTLDKLSDYCTFVCWAHGFELTSASYFCKIGKEQKCCMCNRRAAAYSSPLQSYAC
WTHSCGYDYVYNPFFVDVQQWGYVGNLATNHDRYCSVHQGAHVASNDAIMTRCLAIHS
CFIERVDWDIEYPYISHEKKLNSCCRIVERNVVRAALLAGSFDKVYDIGNPKGIPIVD
DPVVDWHYFDAQPLTRKVQQLFYTEDMASRFADGLCLFWNCNVPKYPNNAIVCRFDTR
VHSEFNLPGCDGGSLYVNKHAFHTPAYDVSAFRDLKPLPFFYYSTTPCEVHGNGSMIE
DIDYVPLKSAVCITACNLGGAVCRKHATEYREYMEAYNLVSASGFRLWCYKTFDIYNL
WSTFTKVQGLENIAFNVVKQGHFIGVEGELPVAVVNDKIFTKSGVNDICMFENKTTLP
TNIAFELYAKRAVRSHPDFKLLHNLQADICYKFVLWDYERSNIYGTATIGVCKYTDID
VNSALNICFDIRDNGSLEKFMSTPNAIFISDRKIKKYPCIVGPDYAYFNGAIIRDSDV
VKQPVKFYLYKKVNNEFIDPTECIYTQSRSCSDFLPLSDMEKDFLSFDSDVFIKKYGL
ENYAFEHVVYGDFSHTTLGGLHLLIGLYKKQQEGHIIMEEMLKGSSTIHNYFITETNT
AAFKAVCSVIDLKLDDFVMILKSQDLGVVSKVVKVPIDLTMIEFMLWCKDGQVQTFYP
RLQASADWKPGHAMPSLFKVQNVNLERCELANYKQSIPMPRGVHMNIAKYMQLCQYLN
TCTLAVPANMRVIHFGAGSDKGIAPGTSVLRQWLPTDAIIIDNDLNEFVSDADITLFG
DCVTVRVSQQVDLVISDMYDPTTKNVTGSNESKALFFTYLCNLINNNLALGGSVAIKI
TEHSWSVELYELMGKFAWWTVFCTNANASSSEGFLLGINYLGTIKENIDGGAMHANYI
FWRNSTPMNLSTYSLFDLSKFQLKLKGTPVLQLKESQINELVISLLSQGKLLIRDNDT
LSVSTDVLVNTYRKLR"
CDS 135..13310
/codon_start=1
/product="ORF1a"
/protein_id="AKL80592.1"
/db_xref="GI:829624499"
/translation="MSFVAGVIAQGARGTYRAALNSEKHQDHVSLTVPLCGSGNLVEK
LSPWFMDGENAYEVVKAMLLKKEPLLYVPIRLAGHTRHLPGPRVYLVERLIACENPFM
VNQLAYSSSANGSLVGTTLQGKPIGMFFPYDIELVTGKQNILLRKYGRGGYHYTPVHY
ERDNTSCPEWMDDFEADPKGKYAQNLLKKLIGGDVTPVDQYMCGVDGKPISAYAFLMA
KDGITKLADVEADVAARADDEGFITLKNNLYRLVWHVERKDVPYPKQSIFTINSVVQK
DGVENTPPHYFTLGCKILTLTPRNKWSGVSDLSLKQKLLYTFYGKESLENPTYIYHSA
FIECGSCGNDSWLTGNAIQGFACGCGASYTANDVEVQSSGMIKPNALLCATCPFAKGD
SCSSNCKHSVAQLVSYLSERCNVIADSKSFTLIFGGVAYAYFGCEEGTMYFVPRAKSV
VSRIGDSIFTGCTGSWNKVTQIANMFLEQTQHSLNFVGEFVVNDVVLAILSGTTTNVD
KIRQLLKGVTIDKLRDYLADYDVAVTAGPFMDNAINVGGTGLQYAAITAPYVVLTGLG
ESFKKVATIPYKVCNSVKDTLTYYAHSVLYRVFPYDMDSGVSSFSELLFDCVDLSVAS
TYFLVRLLQDKTGDFMSTIITSCQTAVSKLLDTCFEATEATFNFLLDLAGLFRIFLRN
AYVYTSQGFVVVNGKVSTLVKQVLDLLNKGMQLLHTKVSWAGSNISAVIYSGRESLIF
PSGTYYCVTTKAKSVQQDLDVILPGEFSKKQLGLLQPTDNSTTVSVTVSSNMVETVVG
QLEQTNMHSPDVIVGDYVIISEKLFVRSKEEDGFAFYPACTNGHAVPTLFRLKGGAPV
KKVAFGGDQVHEVAAVRSVTVEYNIHAVLDTLLASSSLRTFVVDKSLSIEEFADVVKE
QVSDLLVKLLRGMPIPDFDLDDFIDAPCYCFNAEGDASWSSTMIFSLHPVECDEECSE
VEASGLEEGESECISETSTEQVDVSHEVSDDEWAAAVDEAFPLDEAEDVTESVQEEAQ
PVEVPVEDIAQVVIADTLQETPVVSDTVEVPPQVVKLPSEPQTIQPEVKEVAPVYEAD
TEQTQSVTVKPKRLRKKRNVDPLSNFEHKVITECVTIVLGDAIQVAKCYGESVLVNAA
NTHLKHGGGIAGAINAASKGAVQKESDEYILAKGPLQVGDSVLLQGHSLAKNILHVVG
PDARAKQDVSLLSKCYKAMNAYPLVVTPLVSTGIFGVKPAVSFDYLIREAKTRVLVVV
NSQDVYKSLTIVDIPQSLTFSYDGLRGAIRKAKDYGFTVFVCTDNSANTKVLRNKGVD
YTKKFLTVDGVQYYCYTSKDTLDDILQQANKSVGIISMPLGYVSHGLDLIQAGSVVRR
VNVPYVCLLANKEQEAILMSEDVKLNPSEDFIKHVRTNGGYNSWHLVEGELLVQDLRL
NKLLHWSDQTICYKDSVFYVVKNSTAFPFETLSACRAYLDSRTTQQLTIEVLVTVDGV
NFRTVVLNNKNTYRSQLGCVFFNGADISDTIPDEKQNGHSLYLADNLTADETKALKEL
YGPVDPTFLHRFYSLKAAVHKWKMVVCDKVRSLKLSDNNCYLNAVIMTLDLLKDIKFV
IPALQHAFMKHKGGDSTDFIALIMAYGNCTFGAPDDASRLLHTVLAKAELCCSARMVW
REWCNVCGIKDVVLQGLKACCYVGVQTVEDLRARMTYVCQCGGERHRQIVEHTTPWLL
LSGTPNEKLVTTSTAPDFVAFNVFQGIETAVGHYVHACLKGGLILKFDSGTVSKTSDW
KCKVTDVLFPGQKYSSDCNVVRYSLDGNFRTEVDPDLSAFYVKDGKYFISEPPVTYSP
ATILAGSVYTNSCLVSSDGQPGGDAISLSFNNLLGFDSSKPVTKKYTYSFLPKEDGDV
LLAEFDTYDPIYKNGAMYKGKPILWVNKASYDTNLNKFNRASLRQIFDVAPIELENKF
TPLSVASTPVEPPTVDVVALQQEMTIVKCKGLNKPFVKDNVSFVVDDSGTPVVEYLSK
EDLHTLYVDPKYQVIVLKDNVLSSMLRLHTVESGDINVVAASGSLTRKVKLLFRASFY
FKEFATRTFTATTAVGSCIKSVVRHLGVTKGILTGCFSFVKMLFILPLAYFSDSKLGT
TEVKVSALKTAGVVTGNVVKQCCTAAVDLSMDKLRRVDWKSTLRLLLMLCTTMVLLSS
VYHLYVFNQVLSSDVMFEDAQGLKKFYKEVRAYLGISSACDGLASAYRANSFDVPTFC
ANRSAMCNWCLISQDSITHYPALKMVQTHLSHYVLNIDWLWFAFETGLAYMLYTSAFN
WLLLAGTLHYFFAQTSIFVDWRSYNYAVSSAFWLFTHIPMAGLVRMYNLLACLWLLRK
FYQHVINGCKDTACLLCYKRNRLTRVEASTVVCGGKRTFYITANGGISFCRRHNWNCV
DCDIAGVGNTFICEEVANDLTTALRRPINATDRSHYYVDSVTVKETVVQFNYRRDGQP
FYERFPLCAFTNLDKLKFKEVCKTTTGIPEYNFIIYDSSDRGQESLARSACVYYSQVL
CKSILLVDSSLVTSVGDSSEIATKMFDSFVNSFVSLYNVTRDKLEKLISTARDGVRRG
DNFHSVLTTFIDAARGPAGVESDVETNEIVDSVQYAHKHDIQITNESYNNYVPSYVKP
DSVSTSDLGSLIDCNAASVNQIVLRNSNGACIWNAAAYMKLSDALKRQIRIACRKCNL
AFRLTTSKLRANDNILSVRFTANKIVGGAPTWFNVLRDFTLKGYVLATIIVFLCAVLM
YLCLPTFSMVPVEFYEDRILDFKVLDNGIIRDVNPDDKCFANKHRSFTQWYHEHVGGV
YDNSITCPLTVAVIAGVAGARIPDVPTTLAWVNNQIIFFVSRVFANTGSVCYTPIDEI
PYKSFSDSGCILPSECTMFRDAEGRMTPYCHDPTVLPGAFAYSQMRPHVRYDLYDGNM
FIKFPEVVFESTLRITRTLSTQYCRFGSCEYAQEGVCITTNGSWAIFNDHHLNRPGVY
CGSDFIDIVRRLAVSLFQPITYFQLTTSLVLGIGLCAFLTLLFYYINKVKRAFADYTQ
CAVIAVVAAVLNSLCICFVASIPLCIVPYTALYYYATFYFTNEPAFIMHVSWYIMFGP
IVPIWMTCVYTVAMCFRHFFWVLAYFSKKHVEVFTDGKLNCSFQDAASNIFVINKDTY
AALRNSLTNDAYSRFLGLFNKYKYFSGAMETAAYREAAACHLAKALQTYSETGSDLLY
QPPNCSITSGVLQSGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCP
ADQLSDPNYDALLISMTNHSFSVQKHIGAPANLRVVGHAMQGTLLKLTVDVANPSTPA
YTFTTVKPGAAFSVLACYNGRPTGTFTVVMRPNYTIKGSFLCGSCGSVGYTKEGSVIN
FCYMHQMELANGTHTGSAFDGTMYGAFMDKQVHQVQLTDKYCSVNVVAWLYAAILNGC
AWFVKPNRTSVVSFNEWALANQFTEFVGTQSVDMLAVKTGVAIEQLLYAIQQLYTGFQ
GKQILGSTMLEDEFTPEDVNMQIMGVVMQSGVRKVTYGTAHWLFATLVSTYVIILQAT
KFTLWNYLFETIPTQLFPLLFVTMAFVMLLVKHKHTFLTLFLLPVAICLTYANIVYEP
TTPISSALIAVANWLAPTNAYMRTTHTDIGVYISMSLVLVIVVKRLYNPSLSNFALAL
CSGVMWLYTYSIGEASSPIAYLVFVTTLTSDYTITVFVTVNLAKVCTYAIFAYSPQLT
LVFPEVKMILLLYTCLGFMCTCYFGVFSFLNLKLRAPMGVYDFKVSTQEFRFMTANNL
TAPRNSWEAMALNFKLIGIGGTPCIKVAAMQSKLTDLKCTSVVLLSVLQQLHLEANSR
AWAFCVKCHNDILAATDPSEAFEKFVSLFATLMTFSGNVDLDALASDIFDTPSVLQAT
LSEFSHLATFAELEAAQKAYQEAMDSGDTSPQVLKALQKAVNIAKNAYEKDKAVARKL
ERMADQAMTSMYKQARAEDKKAKIVSAMQTMLFGMIKKLDNDVLNGIISNARNGCIPL
SVIPLCASNKLRVVIPDFTVWNQVVTYPSLNYAGALWDITVINNVDNEIVKSSDVVDS
NENLTWPLVLECTRASTSAVKLQNNEIKPSGLKTMVVSAGQEQTNCNTSSLAYYEPVQ
GRKMLMALLSDNAYLKWARVEGKDGFVSVELQPPCKFLIAGPKGPEIRYLYFVKNLNN
LHRGQVLGHIAATVRLQAGSNTEFASNSSVLSLVNFTVDPQKAYLDFVNAGGAPLTNC
VKMLTPKTGTGIAISVKPESTADQETYGGASVCLYCRAHIEHPDVSGVCKYKGKFVQI
PAQCVRDPVGFCLSNTPCNVCQYWIGYGCNCDSLRQVALPQSKDSNFLNESGVLL"
CDS 21312..25373
/codon_start=1
/product="S protein"
/protein_id="AKL80593.1"
/db_xref="GI:829624500"
/translation="MIHSVFLLMFLLTPTESYVDVGPDSVKSACIEVDIQQTFFDKTW
PRPIDVSKADGIIYPQGRTYSNITITYQGLFPYQGDHGDMYVYSAGHATGTTPQKLFV
ANYSQDVKQFANGFVVRIGAAANSTGTVIISPSTSATIRKIYPAFMLGSSVGNFSDGK
MGRFFNHTLVLLPDGCGTLLRAFYCILEPRSGNHCPAGNSYTSFATYHTPATDCSDGN
YNRNASLNSFKEYFNLRNCTFMYTYNITEDEILEWFGITQTAQGVHLFSSRYVDLYGG
NMFQFATLPVYDTIKYYSIIPHSIRSIQSDRKAWAAFYVYKLQPLTFLLDFSVDGYIR
RAIDCGFNDLSQLHCSYESFDVESGVYSVSSFEAKPSGSVVEQAEGVECDFSPLLSGT
PPQVYNFKRLVFTNCNYNLTKLLSLFSVNDFTCSQISPAAIASNCYSSLILDYFSYPL
SMKSDLSVSSAGPISQFNYKQSFSNPTCLILATVPHNLTTITKPLKYSYINKCSRLLS
DDRTEVPQLVNANQYSPCVSIVPSTVWEDGDYYRKQLSPLEGGGWLVASGSTVAMTEQ
LQMGFGITVQYGTDTNSVCPKLEFANDTKIASQLGNCVEYSLYGVSGRGVFQNCTAVG
VRQQRFVYDAYQNLVGYYSDDGNYYCLRACVSVPVSVIYDKETKTHATLFGSVACEHI
SSTMSQYSRSTRSMLKRRDSTYGPLQTPVGCVLGLVNSSLFVEDCKLPLGQSLCALPD
TPSTLTPRSVRSVPGEMRLASIAFNHPIQVDQLNSSYFKLSIPTNFSFGVTQEYIQTT
IQKVTVDCKQYVCNGFQKCEQLLREYGQFCSKINQALHGANLRQDDSVRNLFASVKSS
QSSPIIPGFGGDFNLTLLEPVSISTGSRSARSAIEDLLFDKVTIADPGYMQGYDDCMQ
QGPASARDLICAQYVAGYKVLPPLMDVNMEAAYTSSLLGSIAGVGWTAGLSSFAAIPF
AQSIFYRLNGVGITQQVLSENQKLIANKFNQALGAMQTGFTTTNEAFRKVQDAVNNNA
QALSKLASELSNTFGAISASIGDIIQRLDVLEQDAQIDRLINGRLTTLNAFVAQQLVR
SESAALSAQLAKDKVNECVKAQSKRSGFCGQGTHIVSFVVNAPNGLYFMHVGYYPSNH
IEVVSAYGLCDAANPTNCIAPVNGYFIKTNNTRIVDEWSYTGSSFYAPEPITSLNTKY
VAPQVTYQNISTNLPPPLLGNSTGIDFQDELDEFFKNVSTSIPNFGSLTQINTTLLDL
TYEMLSLQQVVKALNESYIDLKELGNYTYYNKWPWYIWLGFIAGLVALALCVFFILCC
TGCGTNCMGKLKCNRCCDRYEEYDLEPHKVHVH"
CDS 25388..25699
/codon_start=1
/product="ORF3"
/protein_id="AKL80594.1"
/db_xref="GI:829624501"
/translation="MRVQRPPTLLLVFSLSFLVTAFSKPLYVPEHCQNYSGCMLRACI
KTAQADTAGLYTNFRIDVPSAESTGTQSVSVDRESTSTHDGLTEHVTSVNLFDVGYSV
N"
CDS 25708..26037
/codon_start=1
/product="ORF4a"
/protein_id="AKL80595.1"
/db_xref="GI:829624502"
/translation="MDYVSLLNQIWQKYLNSPYTTCLYIPKPTAKYTPLVGTSLHPVL
WNCQLSFAGYTESAVNSTKALAKQDAAQRIAWLLHKDGGIPDGCSLYLRHSSLFAQSE
EEESFSN"
CDS 25949..26689
/codon_start=1
/product="ORF4b"
/protein_id="AKL80596.1"
/db_xref="GI:829624503"
/translation="MEESLTDVPSTSGTQVYSRKARKRSHSPTKKLRYVKRRFSLLRP
EDLSVIVQPTHYVRVTFSDPNMWYLRSGHHLHSVHNWLKPYGGQPVSEYHITLALLNL
TDEDLARDFSPIALFLRNVRFELHEFALLRKTLVLNASEIYCANIHRFKPVYRVNTAI
PTIKDWLLVQGFSLYHSGLPLHMSISKLHALDDVTRNYIITMPCFRTYPQQMFVTPLA
VDVVSIRSSNQGNKQIVHSYPILHHPGF"
CDS 26696..27370
/codon_start=1
/product="ORF5"
/protein_id="AKL80597.1"
/db_xref="GI:829624504"
/translation="MAFSASLFKPVQLVPVSPAFHRIESTDSIVFTYIPASGYVAALA
VNVCLIPLLLLLRQDTCRRSIIRTMVLYFLVLYNFLLAIVLVNGVHYPTGSCLIAFLV
ILIILWFVDRIRFCLMLNSYIPLFDMRSHFIRVSTVSSHGMVPVIHTKPLFIRNFDQR
CSCSRCFYLHSSTYIECTYISRFSKISLVSVTDFSLNGNVSTVFVPATRDSVPLHIIA
PSSLIV"
CDS 27446..27694
/codon_start=1
/product="E protein"
/protein_id="AKL80598.1"
/db_xref="GI:829624505"
/translation="MLPFVQERIGLFIVNFFIFTVVCAITLLVCMAFLTATRLCVQCM
TGFNTLLVQPALYLYNTGRSVYVKFQDSKPPLPPDEWV"
CDS 27709..28368
/codon_start=1
/product="M protein"
/protein_id="AKL80599.1"
/db_xref="GI:829624506"
/translation="MSNMTQLTEAQIIAIIKDWNFAWSLIFLLITIVLQYGYPSRSMT
VYVFKMFVLWLLWPSSMALSIFSAIYPIDLASQIISGIVAAVSAMMWISYFVQSIRLF
MRTGSWWSFNPETNCLLNVPIGGTTVVRPLVEDSTSVTAVVTNGHLKMAGMHFGACDY
DRLPNEVTVAKPNVLIALKMVKRQSYGTNSGVAIYHRYKAGNYRSPPITADIELALLR
A"
CDS 28422..29663
/codon_start=1
/product="N protein"
/protein_id="AKL80600.1"
/db_xref="GI:829624507"
/translation="MASPAAPRAVSFADNNDITNTNLSRGRGRNPKPRAAPNNTVSWY
TGLTQHGKVPLTFPPGQGVPLNANSTPAQNAGYWRRQDRKINTGNGIKQLAPRWYFYY
TGTGPEAALPFRAVKDGIVWVHEDGATDAPSTFGTRNPNNDSAIVTQFAPGTKLPKNF
HIEGTGGNSQSSSRASSVSRNSSRSSSQGSRSGNSTRGTSPGPSGIGAVGGDLLYLDL
LNRLQALESGKVKQSQPKVITKKDAAAAKNKMRHKRTSTKSFNMVQAFGLRGPGDLQG
NFGDLQLNKLGTEDPRWPQIAELAPTASAFMGMSQFKLTHQNNDDHGNPVYFLRYSGA
IKLDPKNPNYNKWLELLEQNIDAYKTFPKKEKKQKAPKEESTDQMSEPPKEQRVQGSI
TQRTRTRPSVQPGPMIDVNTD"
CDS 28618..28956
/codon_start=1
/product="ORF8b"
/protein_id="AKL80601.1"
/db_xref="GI:829624508"
/translation="MPIPPLRKMLGIGGDRTEKLIPGMELSNWLPGGTSTTLELDPKQ
HSHSGLLRMASFGSMKMAPLMLLQLLGRGTLTMIQLLLHNSRPVLSFLKTSTLRGLEA
IVNHLQEPLA"

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Mon Jun 15, 2015 7:47 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
1 taggcagtgg acatatgctc aacactgggt ataattctaa ttgaatacta tttttcagtt
61 agagcgtcgt gtctcttgta cgtctcggtc acaatatacg gtttcgtccg gtgcgtggca
121 attcggggca catcatgtct ttcgtggctg gtgtgatcgc gcaaggtgcg cgcggtacgt
181 atcgagcagc gctcaactct gaaaaacatc aagaccatgt gtctctaact gtgccactct
241 gtggttcagg aaacctggtt gaaaaacttt caccatggtt catggatggc gaaaatgcct
301 atgaagtggt gaaggccatg ttacttaaaa aagagccact tctctatgtg cccatccggc
361 tggctggaca cactagacac ctcccaggtc ctcgtgtgta cctggttgag aggctcattg
421 cttgtgaaaa tccattcatg gttaaccaat tggcttatag ctctagtgca aatggcagcc
481 tggttggcac aactttgcag ggcaagccta ttggtatgtt cttcccttat gacatcgaac
541 ttgtcacagg aaagcaaaat attctcctgc gcaagtatgg ccgtggtggt tatcactaca
601 ccccagtcca ctatgagcga gacaacacct cttgccctga gtggatggac gattttgagg
661 cggatcctaa aggcaaatat gcccagaatc tgcttaagaa gttgattggc ggtgatgtca
721 ctccagttga ccaatacatg tgtggcgttg atggaaaacc cattagtgcc tacgcatttt
781 taatggccaa ggatggaata accaaactgg ctgatgttga agcggacgtc gcagcacgtg
841 ctgatgacga aggcttcatc acattaaaga acaatctata tagattggtt tggcatgttg
901 agcgtaaaga cgttccatat cctaagcaat ctatttttac tattaatagt gtggtccaaa
961 aggatggtgt tgaaaacact cctcctcact attttactct tggatgcaaa attttaacgc
1021 tcaccccacg caacaagtgg agtggcgttt ctgacttgtc cctcaaacaa aaactccttt
1081 acaccttcta tggtaaggag tcacttgaga acccaaccta catttaccac tccgcattca
1141 ttgagtgtgg aagttgtggt aatgattcct ggcttacagg gaatgctatc caagggtttg
1201 cctgtggatg tggggcatca tatacagcta atgatgtcga agtccaatca tctggcatga
1261 ttaagccaaa tgctcttctt tgtgctactt gcccctttgc taagggtgac agctgttctt
1321 ctaattgcaa acattcagtt gctcagttgg ttagttacct ttctgaacgc tgtaatgtta
1381 ttgctgattc taagtccttc acacttatct ttggtggcgt agcttacgcc tactttggat
1441 gtgaggaagg tactatgtac tttgtgccta gagctaagtc tgttgtctca aggattggag
1501 actccatctt tacaggctgt actggctctt ggaacaaggt cactcaaatt gctaacatgt
1561 tcttggaaca gactcagcat tcccttaact ttgtgggaga gttcgttgtc aacgatgttg
1621 tcctcgcaat tctctctgga accacaacta atgttgacaa aatacgccag cttctcaaag
1681 gtgtcaccat tgacaagttg cgtgattatt tagctgacta tgacgtagca gtcactgccg
1741 gcccattcat ggataatgct attaatgttg gtggtacagg attacagtat gccgccatta
1801 ctgcacctta tgtagttctc actggcttag gtgagtcctt taagaaagtt gcaaccatac
1861 cgtacaaggt ttgcaactct gttaaggata ctctgactta ttatgctcac agcgtgttgt
1921 acagagtttt tccttatgac atggattctg gtgtgtcatc ctttagtgaa ctactttttg
1981 attgcgttga tctttcagta gcttctacct attttttagt ccgcctcttg caagataaga
2041 ctggcgactt tatgtctaca attattactt cctgccaaac tgctgttagt aagcttctag
2101 atacatgttt tgaagctaca gaagcaacat ttaacttctt gttagatttg gcaggattgt
2161 tcagaatctt tcttcgcaat gcctatgtgt acacttcaca agggtttgtg gtggtcaatg
2221 gcaaagtttc tacacttgtc aaacaagtgt tagacttgct taataagggt atgcaacttt
2281 tgcatacaaa ggtctcctgg gctggttcta atatcagtgc tgttatctac agcggcaggg
2341 agtctctaat attcccatcg ggaacctatt actgtgtcac cactaaggct aagtccgttc
2401 aacaagatct tgacgttatt ttgcctggtg agttttccaa gaagcagtta ggactgctcc
2461 aacctactga caattctaca actgttagtg ttactgtatc cagtaacatg gttgaaactg
2521 ttgtgggtca acttgagcaa actaatatgc atagtcctga tgttatagta ggtgactatg
2581 tcattattag tgaaaaattg tttgtgcgta gtaaggaaga agacggattc gccttctacc
2641 ctgcttgcac taatggtcat gctgtaccga ctctctttag acttaaggga ggtgcacctg
2701 taaaaaaagt agcctttggc ggtgatcaag tacatgaggt tgctgctgta agaagtgtta
2761 ctgtcgagta caacattcat gctgtattag acacactact tgcttcttct agtcttagaa
2821 cctttgttgt agataagtct ttgtcaattg aggagtttgc tgacgtagta aaggaacaag
2881 tctcagactt gcttgttaaa ttactgcgtg gaatgccgat tccagatttt gatttagacg
2941 attttattga cgcaccatgc tattgcttta acgctgaggg tgatgcatct tggtcttcta
3001 ctatgatctt ctctcttcac cccgtcgagt gtgacgagga gtgttctgaa gtagaggctt
3061 caggtttaga agaaggtgaa tcagagtgca tttctgagac ttcaactgaa caagttgacg
3121 tttctcatga ggtttctgac gacgagtggg ctgctgcagt tgatgaagcg ttccccctcg
3181 atgaagcaga agatgttact gaatctgtgc aagaagaagc acaaccagta gaagtacctg
3241 ttgaagatat tgcgcaggtt gtcatagctg acaccttaca ggaaactcct gttgtgtctg
3301 atactgttga agtcccaccg caagtggtga aacttccgtc tgaacctcag actatccagc
3361 ccgaggtaaa agaagttgca cctgtctatg aggctgatac cgaacagaca cagagtgtta
3421 ctgttaaacc taagaggtta cgcaaaaagc gtaatgttga ccctttgtcc aattttgaac
3481 ataaggttat tacagagtgc gttaccatag ttttaggtga cgcaattcaa gtagccaagt
3541 gctatgggga gtctgtgtta gttaatgctg ctaacacaca tcttaagcat ggcggtggta
3601 tcgctggtgc tattaatgcg gcttcaaaag gggctgtcca aaaagagtca gatgagtata
3661 ttctggctaa agggccgtta caagtaggag attcagttct cttgcaaggc cattctctag
3721 ctaagaatat cctgcatgtc gtaggcccag atgcccgcgc taaacaggat gtttctctcc
3781 ttagtaagtg ctataaggct atgaatgcat atcctcttgt agtcactcct cttgtttcaa
3841 caggcatatt tggtgtaaaa ccagctgtgt cttttgatta tcttattaga gaggctaaga
3901 ctagagtttt agtcgtcgtt aattcccaag atgtctataa gagtcttacc atagttgaca
3961 ttccacagag tttgactttt tcatatgatg ggttacgtgg cgcaatacgt aaagctaaag
4021 attatggttt tactgttttt gtgtgcacag acaactctgc taacactaaa gttcttagga
4081 acaagggtgt tgattatact aagaagtttc ttacagttga cggtgtgcaa tattattgct
4141 acacgtctaa ggacacttta gatgatatct tacaacaggc taataagtct gttggtatta
4201 tatctatgcc tttgggatat gtgtctcatg gtttagactt aattcaagca gggagtgtcg
4261 tgcgtagagt taacgtgccc tacgtgtgtc tcctagctaa taaagagcaa gaagctattt
4321 tgatgtctga agacgttaag ttaaaccctt cagaagattt tataaagcac gtccgcacta
4381 atggtggtta caattcttgg catttagtcg agggtgaact attggtgcaa gacttacgct
4441 taaataagct cctgcattgg tctgatcaaa ccatatgcta caaggatagt gtgttttatg
4501 ttgtaaagaa tagtacagct tttccatttg aaacactttc agcatgtcgt gcgtatttgg
4561 attcacgcac gacacagcag ttaacaatcg aagtcttagt gactgtcgat ggtgtaaatt
4621 ttagaacagt cgttctaaat aataagaaca cttatagatc acagcttgga tgcgttttct
4681 ttaatggtgc tgatatttct gataccattc ctgatgagaa acagaatggt cacagtttat
4741 atctagcaga caatttgact gctgatgaaa caaaggcgct taaagagtta tatggccccg
4801 ttgatcctac tttcttacac agattctatt cacttaaggc tgcagtccat aagtggaaga
4861 tggttgtgtg tgataaggta cgttctctca aattgagtga taataattgt tatcttaatg
4921 cagttattat gacacttgat ttattgaagg acattaaatt tgttatacct gctctacagc
4981 atgcatttat gaaacataag ggcggtgatt caactgactt catagccctc attatggctt
5041 atggcaattg cacatttggt gctccagatg atgcctctcg gttacttcat accgtgcttg
5101 caaaggctga gttatgctgt tctgcacgca tggtttggag agagtggtgc aatgtctgtg
5161 gcataaaaga tgttgttcta caaggcttaa aagcttgttg ttacgtgggt gtgcaaactg
5221 ttgaagatct gcgtgctcgc atgacatatg tatgccagtg tggtggtgaa cgtcatcggc
5281 aaatagtcga acacaccacc ccctggttgc tgctctcagg cacaccaaat gaaaaattgg
5341 tgacaacctc cacggcgcct gattttgtag cgtttaatgt ctttcagggc attgaaacgg
5401 ctgttggcca ttatgttcat gcttgcctga agggtggtct tattttaaag tttgactctg
5461 gcaccgttag caagacttca gactggaagt gcaaggtgac agatgtactt ttccccggcc
5521 aaaaatacag tagcgattgt aatgtcgtac ggtattcttt ggacggtaat ttcagaacag
5581 aggttgatcc cgacctatct gctttctatg ttaaggatgg taaatacttt ataagtgaac
5641 cacccgtaac atattcacca gctacaattt tagctggtag tgtctacact aatagctgcc
5701 ttgtatcgtc tgatggacaa cctggcggtg atgctattag tttgagtttt aataaccttt
5761 tagggtttga ttctagtaaa ccagtcacta agaaatacac ttactccttc ttgcctaaag
5821 aagacggcga tgtgttgttg gctgagtttg acacttatga ccctatttat aagaatggtg
5881 ccatgtataa aggcaaacca attctttggg tcaacaaagc atcttatgat actaatctta
5941 ataagttcaa tagagctagt ttgcgtcaaa tttttgacgt agcccccatt gaactcgaaa
6001 ataaattcac acctttgagt gtggcgtcca caccagttga acctccaact gtagatgtgg
6061 tagcacttca acaggaaatg acaattgtca aatgtaaggg tttaaataaa cctttcgtga
6121 aggacaatgt cagtttcgtt gttgatgact caggtactcc cgttgttgag tatctgtcta
6181 aagaagatct acatacattg tatgtagacc ctaagtatca agtcattgtc ttaaaagaca
6241 atgtactttc ttctatgctt agattgcaca ccgttgagtc aggtgatatt aacgttgttg
6301 cagcttccgg atctttgaca cgtaaagtga agttactatt tagggcttca ttttatttca
6361 aagaatttgc tacccgcact ttcactgcta ccactgctgt aggtagttgt ataaagagtg
6421 tagtgcggca tctaggtgtt actaaaggca tattgacagg ctgttttagt tttgtcaaga
6481 tgttatttat tcttccacta gcttacttta gtgattcaaa actcggcacc acagaggtta
6541 aagtgagtgc tttgaaaaca gctggcgttg tgacaggtaa tgttgtaaaa cagtgttgca
6601 ctgctgctgt tgatttaagt atggataagt tgcgccgtgt ggattggaaa tcaaccctac
6661 ggttgttact tatgttatgc acaactatgg tattgttgtc ttctgtgtat cacttgtatg
6721 tcttcaatca ggtcttatca agtgatgtta tgtttgaaga tgcccaaggt ttgaaaaagt
6781 tctacaaaga agttagagct tacctaggaa tctcttctgc ttgtgacggt cttgcttcag
6841 cttatagggc gaattcattt gatgtaccta cattctgcgc aaaccgttct gcaatgtgta
6901 attggtgctt gattagccaa gattccataa ctcactaccc agctcttaag atggttcaaa
6961 cacatcttag ccactatgtt cttaacatag attggttgtg gtttgcattc gagactggtt
7021 tggcatacat gctctatacc tcggccttca actggttgtt gttggcaggt acattgcatt
7081 atttctttgc acagacttcc atatttgtag actggcggtc atacaattat gctgtgtcta
7141 gtgccttctg gttatttacc cacattccaa tggcgggttt ggtacgaatg tataatttgt
7201 tagcatgcct ttggctttta cgcaagtttt atcagcatgt aatcaatggt tgcaaagata
7261 cggcatgctt gctctgctat aagaggaacc gacttactag agttgaagct tctaccgttg
7321 tctgtggtgg aaaacgtacg ttttatatca cagcaaatgg cggtatttca ttctgtcgta
7381 ggcataattg gaattgtgtg gattgtgaca ttgcaggtgt ggggaatacc ttcatctgtg
7441 aagaagtcgc aaatgacctc actaccgccc tacgcaggcc tattaacgct acggatagat
7501 cacattatta tgtggattcc gttacagtta aagagactgt tgttcagttt aattatcgta
7561 gagacggtca accattctac gagcggtttc ccctctgcgc ttttacaaat ctagataagt
7621 tgaagttcaa agaggtctgt aaaactacta ctggtatacc tgaatacaac tttatcatct
7681 acgactcatc agatcgtggc caggaaagtt tagctaggtc tgcatgtgtt tattattctc
7741 aagtcttgtg taaatcaatt cttttggttg actcaagttt ggttacttct gttggtgatt
7801 ctagtgaaat cgccactaaa atgtttgatt cctttgttaa tagtttcgtc tcgctgtata
7861 atgtcacacg cgataagttg gaaaaactta tctctactgc tcgtgatggc gtaaggcgag
7921 gcgataactt ccatagtgtc ttaacaacat tcattgacgc agcacgaggc cccgcaggtg
7981 tggagtctga tgttgagacc aatgaaattg ttgactctgt gcagtatgct cataaacatg
8041 acatacaaat tactaatgag agttacaata attatgtacc ctcatatgtt aaacctgata
8101 gtgtgtctac cagtgattta ggtagtctca ttgattgtaa tgcggcttca gttaaccaaa
8161 ttgtcttgcg taattctaat ggtgcttgta tttggaacgc tgctgcatat atgaaactct
8221 cggatgcact taaacgacag attcgcattg catgccgtaa gtgtaattta gctttccggt
8281 taaccacctc aaagctacgc gctaatgata atatcttatc agttagattc actgctaaca
8341 aaattgttgg tggtgctcct acatggttta atgtgttgcg tgactttacg ttaaagggtt
8401 acgttcttgc taccattatt gtgtttctgt gtgctgtact gatgtatttg tgtttaccta
8461 cattttctat ggtacctgtt gaattttatg aagaccgcat cttggacttt aaagttcttg
8521 ataatggtat cattagggat gtaaatcctg atgataagtg ctttgctaat aagcaccggt
8581 ccttcacaca atggtatcat gagcatgttg gtggtgtcta tgacaactct atcacatgcc
8641 cattgacagt tgcagtaatt gctggagttg ctggtgctcg cattccagac gtacctacta
8701 cattggcttg ggtgaacaat cagataattt tctttgtttc tcgagtcttt gctaatacag
8761 gcagtgtttg ctacactcct atagatgaga taccctataa gagtttctct gatagtggtt
8821 gcattcttcc atctgagtgc actatgttta gggatgcaga gggccgtatg acaccatact
8881 gccatgatcc tactgttttg cctggggctt ttgcgtacag tcagatgagg cctcatgttc
8941 gttacgactt gtatgatggt aacatgttta ttaaatttcc tgaagtagta tttgaaagta
9001 cacttaggat tactagaact ctgtcaactc agtactgccg gttcggtagt tgtgagtatg
9061 cacaagaggg tgtttgtatt accacaaatg gctcgtgggc catttttaat gaccaccatc
9121 ttaatagacc tggtgtctat tgtggctctg attttattga cattgtcagg cggttagcag
9181 tatcactgtt ccagcctatt acttatttcc aattgactac ctcattggtc ttgggtatag
9241 gtttgtgtgc attcctgact ttgctcttct attatattaa taaagtaaaa cgtgcttttg
9301 cagattacac ccagtgtgct gtaattgctg ttgttgctgc tgttcttaat agcttgtgca
9361 tctgctttgt tgcctctata ccattgtgta tagtacctta cactgcattg tactattatg
9421 ctacattcta ttttactaat gagcctgcat ttattatgca tgtttcttgg tacattatgt
9481 tcgggcctat cgttcccata tggatgacct gcgtctatac agttgcaatg tgctttagac
9541 acttcttctg ggttttagct tattttagta agaaacatgt agaagttttt actgatggta
9601 agcttaattg tagtttccag gacgctgcct ctaatatctt tgttattaac aaggacactt
9661 atgcagctct tagaaactct ttaactaatg atgcctattc acgatttttg gggttgttta
9721 acaagtataa gtacttctct ggtgctatgg aaacagccgc ttatcgtgaa gctgcagcat
9781 gtcatcttgc taaagcctta caaacataca gtgagactgg tagtgatctt ctttaccaac
9841 cacccaactg tagcataacc tctggcgtgt tgcaaagcgg tttggtgaaa atgtcacatc
9901 ccagtggaga tgttgaggct tgtatggttc aggttacctg cggtagcatg actcttaatg
9961 gtctttggct tgacaacaca gtctggtgcc cacgacacgt aatgtgcccg gctgaccagt
10021 tgtctgatcc taattatgat gccttgttga tttctatgac taatcatagt ttcagtgtgc
10081 aaaaacacat tggcgctcca gcaaacttgc gtgttgttgg tcatgccatg caaggcactc
10141 ttttgaagtt gactgtcgat gttgctaacc ctagcactcc agcctacact tttacaacag
10201 tgaaacctgg cgcagcattt agtgtgttag catgctataa tggtcgtccg actggtacat
10261 tcactgttgt aatgcgccct aactacacaa ttaagggttc ctttctgtgt ggttcttgtg
10321 gtagtgttgg ttacaccaag gagggtagtg tgatcaattt ttgttacatg catcaaatgg
10381 aacttgctaa tggtacacat accggttcag catttgatgg tactatgtat ggtgccttta
10441 tggataaaca agtgcaccaa gttcagttaa cagacaaata ctgcagtgtt aatgtagtag
10501 cttggcttta cgcagcaata cttaatggtt gcgcttggtt tgtaaaacct aatcgcacta
10561 gtgttgtttc ttttaatgaa tgggctcttg ccaaccaatt cactgaattt gttggcactc
10621 aatccgttga catgttagct gtcaaaacag gcgttgctat tgaacagctg ctttatgcga
10681 tccaacaact ttatactggg ttccagggaa agcaaatcct tggcagtact atgttggaag
10741 atgaattcac acctgaggat gttaatatgc agattatggg tgtggttatg cagagtggtg
10801 tgagaaaagt tacatatggt actgcgcatt ggttgttcgc gacccttgtt tcaacctatg
10861 tgataatctt acaagccact aaatttactt tgtggaacta cttgtttgag actattccca
10921 cacagttgtt cccactctta tttgtgacta tggccttcgt tatgttgttg gttaaacaca
10981 aacacacctt tttgacactt ttcttgttgc ctgtggctat ttgtttgact tatgcaaaca
11041 tagtctacga gcccactact cccatttcgt cagcgctgat tgcagttgca aattggcttg
11101 cccccactaa tgcttatatg cgcactacac atactgatat tggtgtctac attagtatgt
11161 cacttgtatt agtcattgta gtgaagagat tgtacaaccc atcactttct aactttgcgt
11221 tagcattgtg cagtggtgta atgtggttgt acacttatag cattggagaa gcctcaagcc
11281 ccattgccta tctggttttt gtcactacac tcactagtga ttatacgatt acagtctttg
11341 ttactgtcaa ccttgcaaaa gtttgcactt atgccatctt tgcttactca ccacagctta
11401 cacttgtgtt tccggaagtg aagatgatac ttttattata cacatgttta ggtttcatgt
11461 gtacttgcta ttttggtgtc ttctcttttt tgaaccttaa gcttagagca cctatgggtg
11521 tctatgactt taaggtctca acacaagagt tcagattcat gactgctaac aatctaactg
11581 cacctagaaa ttcttgggag gctatggctc tgaactttaa gttaataggt attggcggta
11641 caccttgtat aaaggttgct gctatgcagt ctaaacttac agatcttaaa tgcacatctg
11701 tggttctcct ctctgtgctc caacagttac acttagaggc taatagtagg gcctgggctt
11761 tctgtgttaa atgccataat gacatattgg cagcaacaga ccccagtgag gctttcgaga
11821 aattcgtaag tctctttgcc actttaatga ctttttctgg taatgtagat cttgatgcgt
11881 tagctagtga tatttttgac actcctagcg tacttcaagc tactctttct gagttttcac
11941 acttagctac ctttgctgag ttggaagctg cgcagaaagc ctatcaggaa gctatggact
12001 ctggtgacac ctcaccacaa gttcttaagg ctttgcagaa ggctgttaat atagctaaaa
12061 acgcctatga gaaggataag gcagtggccc gtaagttaga acgtatggct gatcaggcta
12121 tgacttctat gtataagcaa gcacgtgctg aagacaagaa agcaaaaatt gtcagtgcta
12181 tgcaaactat gttgtttggt atgattaaga agctcgacaa cgatgttctt aatggtatca
12241 tttctaacgc taggaatggt tgtatacctc ttagtgtcat tccactgtgt gcttcaaata
12301 aacttcgcgt tgtaattcct gacttcaccg tctggaatca ggtagtcaca tatccctcgc
12361 ttaactacgc tggggctttg tgggacatta cagttataaa caatgtggac aatgaaattg
12421 ttaagtcttc agatgttgta gacagcaatg aaaatttaac atggccactt gttttagaat
12481 gcactagggc atccacttct gccgttaagt tgcaaaataa tgagatcaaa ccttcaggtt
12541 taaaaaccat ggttgtgtct gcaggtcaag agcaaactaa ctgtaatact agttccttag
12601 cttattacga acctgtgcag ggtcgtaaaa tgctgatggc tcttctttct gataatgcct
12661 atctcaaatg ggcgcgtgtt gaaggtaagg acggatttgt tagtgtagag ctacaacctc
12721 cttgcaaatt cttgattgcg ggaccaaaag gacctgaaat ccgatatctc tattttgtta
12781 aaaatcttaa caaccttcat cgcgggcaag tgttagggca cattgctgcg actgttagat
12841 tgcaagctgg ttctaacacc gagtttgcct ctaattcttc ggtgttgtca cttgttaact
12901 tcaccgttga tcctcaaaaa gcttatctcg atttcgtcaa tgcgggaggt gccccattga
12961 caaattgtgt taagatgctt actcctaaaa ctggtacagg tatagctata tctgttaaac
13021 cagagagtac agctgatcaa gagacttatg gtggagcttc agtgtgtctc tattgccgtg
13081 cgcatataga acatcctgat gtctctggtg tttgtaaata taagggtaag tttgtccaaa
13141 tccctgctca gtgtgtccgt gaccctgtgg gattttgttt gtcaaatacc ccctgtaatg
13201 tctgtcaata ttggattgga tatgggtgca attgtgactc gcttaggcaa gtagcactgc
13261 cccaatctaa agattccaat tttttaaacg agtccggggt tctattgtaa atgcccgaat
13321 agaaccctgt tcaagtggtt tgtccactga tgtcgtcttt agggcatttg acatctgcaa
13381 ctataaggct aaggttgctg gtattggaaa atactacaag actaatactt gtaggtttgt
13441 agaattagat gaccaagggc atcatttaga ctcctatttt gtcgttaaga ggcatactat
13501 ggagaattat gaactagaga agcactgtta cgatttgtta cgtgactgtg atgctgtagc
13561 tccccatgat ttcttcatct ttgatgtaga caaagttaaa acacctcata ttgtacgtca
13621 gcgtttaact gagtacacta tgatggatct tgtatatgcc ctgaggcact ttgatcaaaa
13681 tagcgaagtg cttaaggcta tcttagtgaa gtatggttgc tgtgatgtta cctactttga
13741 aaataaactc tggtttgatt ttgttgaaaa tcccagtgtt attggtgttt atcataaact
13801 tggagaacgt gtacgccaag ctatcttaaa cactgttaaa ttttgtgacc acatggtcaa
13861 ggctggttta gtcggtgtgc tcacactaga caaccaggac cttaatggca agtggtatga
13921 ttttggtgac ttcgtaatca ctcaacctgg ttcaggagta gctatagttg atagctacta
13981 ttcttatttg atgcctgtgc tctcaatgac cgattgtctg gccgctgaga cacataggga
14041 ttgtgatttt aataaaccac tcattgagtg gccacttact gagtatgatt ttactgatta
14101 taaggtacaa ctctttgaga agtactttaa atattgggat cagacgtatc acgcaaattg
14161 cgttaattgt actgatgacc gttgtgtgtt acattgtgct aatttcaatg tattgtttgc
14221 tatgaccatg cctaagactt gtttcggacc catagtccga aagatctttg ttgatggcgt
14281 gccatttgta gtatcttgtg gttatcacta caaagaatta ggtttagtca tgaatatgga
14341 tgttagtctc catagacata ggctctctct taaggagttg atgatgtatg ccgctgatcc
14401 agccatgcac attgcctcct ctaacgcttt tcttgatttg aggacatcat gttttagtgt
14461 cgctgcactt acaactggtt tgacttttca aactgtgcgg cctggcaatt ttaaccaaga
14521 cttctatgat ttcgtggtat ctaaaggttt ctttaaggag ggctcttcag ttacgctcaa
14581 acattttttc tttgctcaag atggtaatgc tgctattaca gattataatt actattctta
14641 taatctgcct actatgtgtg acatcaaaca aatgttgttc tgcatggaag ttgtaaacaa
14701 gtacttcgaa atctatgacg gtggttgtct taatgcttct gaagtggttg ttaataattt
14761 agacaagagt gctggccatc cttttaataa gtttggcaaa gctcgtgtct attatgagag
14821 catgtcttac caggagcaag atgaactctt tgccatgaca aagcgtaacg tcattcctac
14881 catgactcaa atgaatctaa aatatgctat tagtgctaag aatagagctc gcactgttgc
14941 aggcgtgtcc atacttagca caatgactaa tcgccagtac catcagaaaa tgcttaagtc
15001 catggctgca actcgtggag cgacttgcgt cattggtact acaaagttct atggtggctg
15061 ggatttcatg cttaaaacat tgtacaaaga tgttgataat ccgcatctta tgggttggga
15121 ttaccctaag tgtgatagag ctatgcctaa tatgtgtaga atcttcgctt cactcatatt
15181 agctcgtaaa catggcactt gttgtactac aagggacaga ttttatcgct tggcaaatga
15241 gtgtgctcag gtgctaagcg aatatgttct atgtggtggt ggttactacg tcaaacctgg
15301 aggtaccagt agcggagatg ccaccactgc atatgccaat agtgtcttta acattttgca
15361 ggcgacaact gctaatgtca gtgcacttat gggtgctaat ggcaacaaga ttgttgacaa
15421 agaagttaaa gacatgcagt ttgatttgta tgtcaatgtt tacaggagca ctagcccaga
15481 ccccaaattt gttgataaat actatgcttt tcttaataag cacttttcta tgatgatact
15541 gtctgatgac ggtgtcgttt gctataatag tgattatgca gctaagggtt acattgctgg
15601 aatacagaat tttaaggaaa cgctgtatta tcagaacaat gtctttatgt ctgaagctaa
15661 atgctgggtg gaaaccgatc tgaagaaagg gccacatgaa ttctgttcac agcatacgct
15721 ttatattaag gatggcgacg atggttactt ccttccttat ccagaccctt caagaatttt
15781 gtctgccggt tgctttgtag atgatatcgt taagactgac ggtacactca tggtagagcg
15841 gtttgtgtct ttggctatag atgcttaccc tctcacaaag catgaagata tagaatacca
15901 gaatgtattc tgggtctact tacagtatat agaaaaactg tataaagacc ttacaggaca
15961 catgcttgac agttattctg tcatgctatg tggtgataat tctgctaagt tttgggaaga
16021 ggcattctac agagatctct atagttcgcc taccactttg caggctgtcg gttcatgcgt
16081 tgtatgccat tcacagactt ccctacgctg tgggacatgc atccgtagac catttctctg
16141 ctgtaaatgc tgctatgatc atgttatagc aactccacat aagatggttt tgtctgtttc
16201 tccttacgtt tgtaatgccc ctggttgtgg cgtttcagac gttactaagc tatatttagg
16261 tggtatgagc tacttttgtg tagatcatag acctgtgtgt agttttccac tttgcgctaa
16321 tggtcttgta ttcggcttat acaagaatat gtgcacaggt agtccttcta tagttgaatt
16381 taataggttg gctacctgtg actggactga aagtggtgat tacacccttg ccaatactac
16441 aacagaacca ctcaaacttt ttgctgctga gactttacgt gccactgaag aggcgtctaa
16501 gcagtcttat gctattgcca ccatcaaaga aattgttggt gagcgccaac tattacttgt
16561 gtgggaggct ggcaagtcca aaccaccact caatcgtaat tatgttttta ctggttatca
16621 tataaccaaa aatagtaaag tgcagctcgg tgagtacatc ttcgagcgca ttgattatag
16681 tgatgctgta tcctacaagt ctagtacaac gtataaactg actgtaggtg acatcttcgt
16741 acttacctct cactctgtgg ctaccttgac ggcgcccaca attgtgaatc aagagaggta
16801 tgttaaaatt actgggttgt acccaaccat tacggtacct gaagagttcg caagtcatgt
16861 tgccaacttc caaaaatcag gttatagtaa atatgtcact gttcagggac cacctggcac
16921 tggcaaaagt cattttgcta tagggttagc gatttactac cctacagcac gtgttgttta
16981 tacagcatgt tcacacgcag ctgttgatgc tttgtgtgaa aaagctttta aatatttgaa
17041 cattgctaaa tgttcccgta tcattcctgc aaaggcacgt gttgagtgct atgacaggtt
17101 taaagttaat gagacaaatt ctcaatattt gtttagtact attaatgctc taccagaaac
17161 ttctgccgat attctggtgg ttgatgaggt tagtatgtgc actaattatg atctttcaat
17221 tattaatgca cgtattaaag ctaagcacat tgtctatgta ggagatccag cacagttgcc
17281 agctcctagg actttgttga ctagaggcac attggaacca gaaaatttca atagtgtcac
17341 tagattgatg tgtaacttag gtcctgacat atttttaagt atgtgctaca ggtgtcctaa
17401 ggaaatagta agcactgtga gcgctcttgt ctacaataat aaattgttag ccaagaagga
17461 gctttcaggc cagtgcttta aaatactcta taagggcaat gtgacgcatg atgctagctc
17521 tgccattaat agaccacaac tcacatttgt gaagaatttt attactgcca atccggcatg
17581 gagtaaggca gtctttattt cgccttataa ttcacagaat gctgtggctc gttcaatgct
17641 gggtcttact actcagactg ttgattcctc acagggttca gaataccagt acgttatctt
17701 ctgtcaaaca gcagatacgg cacatgctaa caacattaac agatttaatg ttgcaatcac
17761 tcgtgcccaa aaaggtattc tttgtgttat gacatctcag gcactctttg agtccttaga
17821 gtttactgaa ttgtctttta ctaattacaa gctccagtct cagattgtaa ctggcctttt
17881 taaagattgc tctagagaaa cttctggcct ctcacctgct tatgcaccaa catacgttag
17941 tgttgatgac aagtataaga cgagtgatga gctttgcgtg aatcttaatt tacccgcaaa
18001 tatcccatac tctcgtgtta tttccaggat gggctttaaa ctcgatgcaa cagttcctgg
18061 atatcctaag cttttcatta ctcgtgaaga ggctgtaagg caagttcgaa gctggatagg
18121 cttcgatgtt gagggtgctc atgcttcccg taatgcatgt ggcaccaatg tgcctctaca
18181 attaggattt tcaactggtg tgaactttgt tgttcagcca gttggtgttg tagacactga
18241 gtggggtaac atgttaacgg gcattgctgc ccgtcctcca ccaggtgaac agtttaagca
18301 cctcgtgcct cttatgcata agggggctgc gtggcctatt gttagacgac gtatagtgca
18361 aatgttgtca gacactttag acaaattgtc tgattactgt acgtttgttt gttgggctca
18421 tggctttgaa ttaacgtctg catcatactt ttgcaagata ggtaaggaac agaagtgttg
18481 catgtgcaat agacgcgctg cagcgtactc ttcacctctg caatcttatg cctgctggac
18541 tcattcctgc ggttatgatt atgtctacaa ccctttcttt gtcgatgttc aacagtgggg
18601 ttatgtaggc aatcttgcta ctaatcacga tcgttattgc tctgtccatc aaggagctca
18661 tgtggcttct aatgatgcaa taatgactcg ttgtttagct attcattctt gttttataga
18721 acgtgtggat tgggatatag agtatcctta tatctcacat gaaaagaaat tgaattcctg
18781 ttgtagaatc gttgagcgca acgtcgtacg tgctgctctt cttgccggtt catttgacaa
18841 agtctatgat attggcaatc ctaaaggaat tcctattgtt gatgaccctg tggttgattg
18901 gcattatttt gatgcacagc ccttgaccag aaaggtacaa cagcttttct atacagagga
18961 catggcctca agatttgctg atgggctctg cttattttgg aactgtaatg taccaaaata
19021 tcctaataat gcaattgtat gcaggtttga cacacgtgtg cattctgagt tcaatttgcc
19081 aggttgtgat ggcggtagtt tgtatgttaa caagcacgct tttcatacac cagcatatga
19141 tgtgagtgca ttccgtgatc tgaaaccttt accattcttt tattattcta ctacaccatg
19201 tgaagtgcat ggtaatggta gtatgataga ggatattgat tatgtacccc taaaatctgc
19261 agtctgtatt acagcttgta atttaggggg cgctgtttgt aggaagcatg ctacagagta
19321 cagagagtat atggaagcat ataatcttgt ctctgcatca ggtttccgcc tttggtgtta
19381 taagaccttt gatatttata atctctggtc tacttttaca aaagttcaag gtttggaaaa
19441 cattgctttt aatgttgtta aacaaggcca ttttattggt gttgagggtg aactacctgt
19501 agctgtagtc aatgataaga tcttcaccaa gagtggcgtt aatgacattt gtatgtttga
19561 gaataaaacc actttgccta ctaatatagc ttttgaactc tatgctaagc gtgctgtacg
19621 ctcgcatccc gatttcaaat tgctacacaa tttacaagca gacatttgct acaagttcgt
19681 cctttgggat tatgaacgta gcaatattta tggtactgct actattggtg tatgtaagta
19741 cactgatatt gatgttaatt cagctttgaa tatatgtttt gacatacgcg ataatggttc
19801 attggagaag ttcatgtcta ctcccaatgc catctttatt tctgatagaa aaattaagaa
19861 atacccttgt attgtaggtc ctgattatgc ttacttcaat ggtgctatca tccgtgatag
19921 tgatgttgtt aaacaaccag tgaagttcta cttgtataag aaagtcaata atgagtttat
19981 tgatcctact gagtgtattt acactcagag tcgctcttgt agtgacttcc tacccctgtc
20041 tgacatggag aaagactttc tatcttttga tagtgatgtt ttcattaaga agtatggctt
20101 ggaaaactat gcttttgagc acgtagtcta tggagacttc tctcatacta cgttaggcgg
20161 tcttcacttg cttattggtt tatacaagaa gcaacaggaa ggtcatatta ttatggaaga
20221 aatgctaaaa ggtagctcaa ctattcataa ctattttatt actgagacta acacagcggc
20281 ttttaaggcg gtgtgttctg ttatagattt aaagcttgac gactttgtta tgattttaaa
20341 gagtcaagac cttggcgtag tatccaaggt tgtcaaggtt cctattgact taacaatgat
20401 tgagtttatg ttatggtgta aggatggaca ggttcaaacc ttctaccctc gactccaggc
20461 ttctgcagat tggaaacctg gtcatgcaat gccatccctc tttaaagttc aaaatgtaaa
20521 ccttgaacgt tgtgagcttg ctaattacaa gcaatctatt cctatgcctc gcggtgtgca
20581 catgaacatc gctaaatata tgcaattgtg ccagtattta aatacttgca cattagccgt
20641 gcctgccaat atgcgtgtta tacattttgg cgctggttct gataaaggta tcgctcctgg
20701 tacatcagtt ttacgacagt ggcttcctac agatgccatt attatagata atgatttaaa
20761 tgagttcgtg tcagatgctg acataacttt atttggagat tgtgtaactg tacgtgtcag
20821 ccaacaagtg gatcttgtta tttccgacat gtatgatcct actactaaga atgtaacagg
20881 tagtaatgag tcaaaggctt tattctttac ttacctgtgt aacctcatta ataataatct
20941 tgctcttggt gggtctgttg ctattaaaat aacagaacac tcttggagcg ttgaacttta
21001 tgaacttatg ggaaaatttg cttggtggac tgttttctgc accaatgcaa atgcatcctc
21061 atctgaagga ttcctcttag gtattaatta cttgggtact attaaagaaa atatagatgg
21121 tggtgctatg cacgccaact atatattttg gagaaattcc actcctatga atctgagtac
21181 ttactcactt tttgatttat ccaagtttca attaaaatta aaaggaacac cagttcttca
21241 attaaaggag agtcaaatta acgaactcgt aatatctctc ctgtcgcagg gtaagttact
21301 tatccgtgac aatgatacac tcagtgtttc tactgatgtt cttgttaaca cctacagaaa
21361 gttacgttga tgtagggcca gattctgtta agtctgcttg tattgaggtt gatatacaac
21421 agactttctt tgataaaact tggcctaggc caattgatgt ttctaaggct gacggtatta
21481 tataccctca aggccgtaca tattctaaca taactatcac ttatcaaggt ctttttccct
21541 atcagggaga ccatggtgat atgtatgtct actctgcagg acatgctaca ggcacaactc
21601 cacaaaagtt gtttgtagct aactattctc aggacgtcaa acagtttgct aatgggtttg
21661 tcgtccgtat aggagcagct gccaattcca ctggcactgt tattattagc ccatctacca
21721 gcgctactat acgaaaaatt taccctgctt ttatgctggg ttcttcagtt ggtaatttct
21781 cagatggtaa aatgggccgc ttcttcaatc atactctagt tcttttgccc gatggatgtg
21841 gcactttact tagagctttt tattgtattc tagagcctcg ctctggaaat cattgtcctg
21901 ctggcaattc ctatacttct tttgccactt atcacactcc tgcaacagat tgttctgatg
21961 gcaattacaa tcgtaatgcc agtctgaact cttttaagga gtattttaat ttacgtaact
22021 gcacctttat gtacacttat aacattaccg aagatgagat tttagagtgg tttggcatta
22081 cacaaactgc tcaaggtgtt cacctcttct catctcggta tgttgatttg tacggcggca
22141 atatgtttca atttgccacc ttgcctgttt atgatactat taagtattat tctatcattc
22201 ctcacagtat tcgttctatc caaagtgata gaaaagcttg ggctgccttc tacgtatata
22261 aacttcaacc gttaactttc ctgttggatt tttctgttga tggttatata cgcagagcta
22321 tagactgtgg ttttaatgat ttgtcacaac tccactgctc atatgaatcc ttcgatgttg
22381 aatctggagt ttattcagtt tcgtctttcg aagcaaaacc ttctggctca gttgtggaac
22441 aggctgaagg tgttgaatgt gatttttcac ctcttctgtc tggcacacct cctcaggttt
22501 ataatttcaa gcgtttggtt tttaccaatt gcaattataa tcttaccaaa ttgctttcac
22561 ttttttctgt gaatgatttt acttgtagtc aaatatctcc agcagcaatt gctagcaact
22621 gttattcttc actgattttg gattattttt catacccact tagtatgaaa tccgatctca
22681 gtgttagttc tgctggtcca atatcccagt ttaattataa acagtccttt tctaatccca
22741 catgtttgat tttagcgact gttcctcata accttactac tattactaag cctcttaagt
22801 acagctatat taacaagtgc tctcgtcttc tttctgatga tcgtactgaa gtacctcagt
22861 tagtgaacgc taatcaatac tcaccctgtg tatccattgt cccatccact gtgtgggaag
22921 acggtgatta ttataggaaa caactatctc cacttgaagg tggtggctgg cttgttgcta
22981 gtggctcaac tgttgccatg actgagcaat tacagatggg ctttggtatt acagttcaat
23041 atggtacaga caccaatagt gtttgcccca agcttgaatt tgctaatgac acaaaaattg
23101 cctctcaatt aggcaattgc gtggaatatt ccctctatgg tgtttcgggc cgtggtgtct
23161 ttcagaattg cacagctgta ggtgttcgac agcagcgctt tgtttatgat gcgtaccaga
23221 atttagttgg ctattattct gatgatggca actactactg tttgcgtgct tgtgttagtg
23281 ttcctgtttc tgtcatctat gataaagaaa ctaaaaccca cgctactcta tttggtagtg
23341 ttgcatgtga acacatttcc tctaccatgt ctcaatactc ccgttctacg cgatcaatgc
23401 ttaaacggcg agattctaca tatggtcccc ttcagacacc tgttggttgt gtcctaggac
23461 ttgttaattc ctctttgttc gtagaggact gcaagttgcc tcttggtcaa tctctctgtg
23521 ctcttcctga cacacctagt actctcacac ctcgcagtgt gcgctctgtt ccaggtgaaa
23581 tgcgcttggc atccattgct tttaatcatc ctattcaggt tgatcaactt aatagtagtt
23641 attttaaatt aagtatacct actaattttt cctttggtgt gactcaggag tacattcaga
23701 caaccattca gaaagttact gttgattgta aacagtacgt ttgcaatggt ttccagaagt
23761 gtgagcaatt actgcgcgag tatggccagt tttgttccaa aataaaccag gctctccatg
23821 gtgccaattt acgccaggat gattctgtac gtaatttgtt tgcgagcgtg aaaagctctc
23881 aatcatctcc tatcatacca ggttttggag gtgactttaa tttgacactt ctagaacctg
23941 tttctatatc tactggcagt cgtagtgcac gtagtgctat tgaggatttg ctatttgaca
24001 aagtcactat agctgatcct ggttatatgc aaggttacga tgattgtatg cagcaaggtc
24061 cagcatcagc tcgtgatctt atttgtgctc aatatgtggc tggttataaa gtattacctc
24121 ctcttatgga tgttaatatg gaagccgcgt acacttcatc tttgcttggc agcatagcag
24181 gtgttggctg gactgctggc ttatcctcct ttgctgctat tccatttgca cagagtattt
24241 tttataggtt aaacggtgtt ggcattactc aacaggttct ttcagagaac caaaagctta
24301 ttgccaataa gtttaatcag gctctgggag ctatgcaaac aggcttcact acaactaatg
24361 aagcttttcg gaaggttcag gatgctgtga acaacaatgc acaggctcta tccaaattag
24421 ctagcgagct atctaatact tttggtgcta tttccgcctc tattggagac atcatacaac
24481 gtcttgacgt tctcgaacag gacgcccaaa tagacagact tattaatggc cgtttgacaa
24541 cactaaatgc ttttgttgca cagcagcttg ttcgttctga atcagctgct ctttccgctc
24601 aattggctaa agataaagtc aatgagtgtg tcaaggcaca atccaagcgt tctggatttt
24661 gcggtcaagg cacacatata gtgtcctttg ttgtaaatgc ccctaatggc ctttacttta
24721 tgcatgttgg ttattaccct agcaaccaca ttgaggttgt ttctgcttat ggtctttgcg
24781 atgcagctaa ccctactaat tgtatagccc ctgttaatgg ctactttatt aaaactaata
24841 acactaggat tgttgatgag tggtcatata ctggctcgtc cttctatgca cctgagccca
24901 tcacctctct taatactaag tatgttgcac cacaggtgac ataccaaaac atttctacta
24961 acctccctcc tcctcttctc ggcaattcca ccgggattga cttccaagat gagttggatg
25021 agtttttcaa aaatgttagc accagtatac ctaattttgg ttctctaaca cagattaata
25081 ctacattact cgatcttacc tacgagatgt tgtctcttca acaagttgtt aaagccctta
25141 atgagtctta catagacctt aaagagcttg gcaattatac ttattacaac aaatggccgt
25201 ggtacatttg gcttggtttc attgctgggc ttgttgcctt agctctatgc gtcttcttca
25261 tactgtgctg cactggttgt ggcacaaact gtatgggaaa acttaagtgt aatcgttgtt
25321 gtgatagata cgaggaatac gacctcgagc cgcataaggt tcatgttcac taattaacga
25381 actatcaatg agagttcaaa gaccacccac tctcttgtta gtgttctcac tctctttttt
25441 ggtcactgca ttttcaaaac ctctctatgt acctgagcat tgtcagaatt attctggttg
25501 catgcttagg gcttgtatta aaactgccca agctgataca gctggtcttt atacaaattt
25561 tcgaattgat gtcccatctg cagaatcaac tggtactcaa tcagtttctg tcgatcgtga
25621 gtctacttca actcatgatg gtcttaccga acatgttact agtgtgaatc tttttgacgt
25681 tggttactca gttaattaac gaactctatg gattacgtgt ctctgcttaa tcaaatttgg
25741 cagaagtacc ttaattcacc gtatactact tgtttgtata tccctaaacc cacagctaag
25801 tatacacctt tagttggcac ttcattgcac cctgtgctgt ggaactgtca gctatccttt
25861 gctggttata ctgaatctgc tgttaattct acaaaagctt tggccaaaca ggacgcagct
25921 cagcgaatcg cttggttgct acataaggat ggaggaatcc ctgacggatg ttccctctac
25981 ctccggcact caagtttatt cgcgcaaagc gaggaagagg agtcattctc caactaagaa
26041 actgcgctac gttaagcgta gattttctct tctgcgccct gaagacctta gtgttattgt
26101 ccaaccaaca cactatgtca gggttacatt ttcagacccc aacatgtggt atctacgttc
26161 gggtcatcat ttacactcag ttcacaattg gcttaaacct tatggcggcc aacctgtttc
26221 tgagtaccat attactctag ctttgctaaa tctcactgat gaagatttag ctagagattt
26281 ttcacccatt gcgctctttt tgcgcaatgt cagatttgag ctacatgagt tcgccttgct
26341 gcgcaaaact cttgttctta atgcatcaga gatctactgt gctaacatac atagatttaa
26401 gcctgtgtat agagttaaca cggcaatccc tactattaag gattggcttc tcgttcaggg
26461 attttccctt taccatagtg gcctcccttt acatatgtca atctctaaat tgcatgcact
26521 ggatgatgtt actcgcaatt acatcattac aatgccatgc tttagaactt atcctcaaca
26581 aatgtttgtt actcctttgg ccgtagatgt tgtctccata cggtcttcca atcagggtaa
26641 taaacaaatt gttcattctt accccatttt acatcatcca ggattttaac gaactatggc
26701 tttctcggcg tctttattta aacccgtcca gctagtccca gtttctcctg catttcatcg
26761 cattgagtct actgactcta ttgttttcac atacattcct gctagcggct atgtagctgc
26821 tttagctgtc aatgtgtgtc tcattcccct attattactg ctacgtcaag atacttgtcg
26881 tcgcagcatt atcagaacta tggttctcta tttccttgtt ctttataact ttttattagc
26941 cattgtacta gtcaatggtg tacattatcc aactggaagt tgcctgatag ccttcttagt
27001 tatcctcata atactttggt ttgtagatag aattcgtttc tgtctcatgc tgaattccta
27061 cattccactg tttgacatgc gttctcactt tattcgtgtt agtacagttt cttctcatgg
27121 tatggtccct gtcatacaca ccaaaccatt atttattaga aacttcgatc agcgttgcag
27181 ctgttctcgt tgtttttatt tgcactcttc tacttatata gagtgcactt atattagccg
27241 ttttagtaag attagcctag tttctgtaac tgacttctcc ttaaacggca atgtttccac
27301 tgttttcgtg cctgcaacgc gcgattcagt tcctcttcac ataatcgccc cgagctcgct
27361 tatcgtttaa gcagctctgc gctactatgg gtcccgtgta gaggctaatc cattagtctc
27421 tctttggaca tatggaaaac gaactatgtt accctttgtc caagaacgaa tagggttgtt
27481 catagtaaac tttttcattt ttaccgtagt atgtgctata acactcttgg tgtgtatggc
27541 tttccttacg gctactagat tatgtgtgca atgtatgaca ggcttcaata ccctgttagt
27601 tcagcccgca ttatacttgt ataatactgg acgttcagtc tatgtaaaat tccaggatag
27661 taaaccccct ctaccacctg acgagtgggt ttaacgaact ccttcataat gtctaatatg
27721 acgcaactca ctgaggcgca gattattgcc attattaaag actggaactt tgcatggtcc
27781 ctgatctttc tcttaattac tatcgtacta cagtatggat acccatcccg tagtatgact
27841 gtctatgtct ttaaaatgtt tgttttatgg ctcctatggc catcttccat ggcgctatca
27901 atatttagcg ccatttatcc aattgatcta gcttcccaga taatctctgg cattgtagca
27961 gctgtttcag ctatgatgtg gatttcctac tttgtgcaga gtatccggct gtttatgaga
28021 actggatcat ggtggtcatt caatcctgag actaattgcc ttttgaatgt tccaattggt
28081 ggtacaactg tcgtacgtcc actcgtagag gactctacca gtgtaactgc tgttgtaacc
28141 aatggtcacc tcaaaatggc tggcatgcat ttcggtgctt gtgactacga cagacttcct
28201 aatgaagtca ccgtggccaa acccaatgtg ctgattgctt taaaaatggt gaagcggcaa
28261 agctacggaa ctaattccgg cgttgccatt taccatagat ataaggcagg taattacagg
28321 agtccgccta ttacggcgga tattgaactt gcattgcttc gagcttaggc tctttagtaa
28381 gagtatctta attgatttta acgaatctca atttcattgt tatggcatcc cctgctgcac
28441 ctcgtgctgt ttcctttgcc gataacaatg atataacaaa tacaaacctg tctcgaggta
28501 gaggacgtaa tccaaaacca cgagctgcac caaataacac tgtctcttgg tacactgggc
28561 ttacccaaca cgggaaagtc cctcttacct ttccacctgg gcagggtgta cctcttaatg
28621 ccaattccac ccctgcgcaa aatgctgggt attggcggag acaggacaga aaaattaata
28681 ccgggaatgg aattaagcaa ctggctccca ggtggtactt ctactacact ggaactggac
28741 ccgaagcagc actcccattc cgggctgtta aggatggcat cgtttgggtc catgaagatg
28801 gcgccactga tgctccttca acttttggga cgcggaaccc taacaatgat tcagctattg
28861 ttacacaatt cgcgcccggt actaagcttc ctaaaaactt ccacattgag gggactggag
28921 gcaatagtca atcatcttca agagcctcta gcgtaagcag aaactcttcc agatctagtt
28981 cacaaggttc aagatcagga aactctaccc gcggcacttc tccaggtcca tctggaatcg
29041 gagcagtagg aggtgatcta ctttaccttg atcttctgaa cagactacaa gcccttgagt
29101 ctggcaaagt aaagcaatcg cagccaaaag taatcactaa gaaagatgct gctgctgcta
29161 aaaataagat gcgccacaag cgcacttcca ccaaaagttt caacatggtg caagcttttg
29221 gtcttcgcgg accaggagac ctccagggaa actttggtga tcttcaattg aataaactcg
29281 gcactgagga cccacgttgg ccccaaattg ctgagcttgc tcctacagcc agtgctttta
29341 tgggtatgtc gcaatttaaa cttacccatc agaacaatga tgatcatggc aaccctgtgt
29401 acttccttcg gtacagtgga gccattaaac ttgacccaaa gaatcccaac tacaataagt
29461 ggttggagct tcttgagcaa aatattgatg cctacaaaac cttccctaag aaggaaaaga
29521 aacaaaaggc accaaaagaa gaatcaacag accaaatgtc tgaacctcca aaggagcagc
29581 gtgtgcaagg tagcatcact cagcgcactc gcacccgtcc aagtgttcag cctggtccaa
29641 tgattgatgt taacactgat tagtgtcact caaagtaaca agatcgcggc aatcgtttgt
29701 gtttggtaac cccatctcac catcgcttgt ccactcttgc acagaatgga atcatgttgt
29761 aattacagtg caataaggta attataaccc atttaattga tagctatgct ttattaaagt
29821 gtgtagctgt agagagaatg ttaaagactg tcacctctgc gtgattgcaa gtgaacagtg
29881 ccccccggga agagctctac agtgtgaaat gtaaataaaa atagctat

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Mon Jun 15, 2015 7:48 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
LOCUS KT036373 29509 bp RNA linear VRL 10-JUN-2015
DEFINITION Middle East respiratory syndrome coronavirus isolate ChinaGD01
variant 1, partial genome.
ACCESSION KT036373
VERSION KT036373.1 GI:829624509
KEYWORDS .
SOURCE Middle East respiratory syndrome coronavirus (MERS-CoV)
ORGANISM Middle East respiratory syndrome coronavirus
Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA
stage; Nidovirales; Coronaviridae; Coronavirinae; Betacoronavirus;
unclassified Betacoronavirus.
REFERENCE 1 (bases 1 to 29509)
AUTHORS Su,J., Wu,J., Zhang,B., Xie,Q., Zhao,W. and Ke,C.
TITLE Direct Submission
JOURNAL Submitted (09-JUN-2015) Key Laboratory for Repository and
Application of Pathogenic Microbiology, Research Center for
Pathogens Detection Technology of Emerging Infectious Diseases,
Guangdong Provincial Center for Disease Control and Prevention, 176
Xin Gang West Road, Guangzhou, Guangdong 510515, China
COMMENT ##Assembly-Data-START##
Assembly Method :: DNAstar v. 7.0
Sequencing Technology :: Sanger dideoxy sequencing
##Assembly-Data-END##
FEATURES Location/Qualifiers
source 1..29509
/organism="Middle East respiratory syndrome coronavirus"
/mol_type="genomic RNA"
/isolate="ChinaGD01 variant 1"
/host="Homo sapiens"
/db_xref="taxon:1335626"
/country="China"
/collection_date="28-May-2015"
CDS join(135..13289,13289..21370)
/ribosomal_slippage
/codon_start=1
/product="ORF1ab"
/protein_id="AKL80602.1"
/db_xref="GI:829624510"
/translation="MSFVAGVIAQGARGTYRAALNSEKHQDHVSLTVPLCGSGNLVEK
LSPWFMDGENAYEVVKAMLLKKEPLLYVPIRLAGHTRHLPGPRVYLVERLIACENPFM
VNQLAYSSSANGSLVGTTLQGKPIGMFFPYDIELVTGKQNILLRKYGRGGYHYTPVHY
ERDNTSCPEWMDDFEADPKGKYAQNLLKKLIGGDVTPVDQYMCGVDGKPISAYAFLMA
KDGITKLADVEADVAARADDEGFITLKNNLYRLVWHVERKDVPYPKQSIFTINSVVQK
DGVENTPPHYFTLGCKILTLTPRNKWSGVSDLSLKQKLLYTFYGKESLENPTYIYHSA
FIECGSCGNDSWLTGNAIQGFACGCGASYTANDVEVQSSGMIKPNALLCATCPFAKGD
SCSSNCKHSVAQLVSYLSERCNVIADSKSFTLIFGGVAYAYFGCEEGTMYFVPRAKSV
VSRIGDSIFTGCTGSWNKVTQIANMFLEQTQHSLNFVGEFVVNDVVLAILSGTTTNVD
KIRQLLKGVTIDKLRDYLADYDVAVTAGPFMDNAINVGGTGLQYAAITAPYVVLTGLG
ESFKKVATIPYKVCNSVKDTLTYYAHSVLYRVFPYDMDSGVSSFSELLFDCVDLSVAS
TYFLVRLLQDKTGDFMSTIITSCQTAVSKLLDTCFEATEATFNFLLDLAGLFRIFLRN
AYVYTSQGFVVVNGKVSTLVKQVLDLLNKGMQLLHTKVSWAGSNISAVIYSGRESLIF
PSGTYYCVTTKAKSVQQDLDVILPGEFSKKQLGLLQPTDNSTTVSVTVSSNMVETVVG
QLEQTNMHSPDVIVGDYVIISEKLFVRSKEEDGFAFYPACTNGHAVPTLFRLKGGAPV
KKVAFGGDQVHEVAAVRSVTVEYNIHAVLDTLLASSSLRTFVVDKSLSIEEFADVVKE
QVSDLLVKLLRGMPIPDFDLDDFIDAPCYCFNAEGDASWSSTMIFSLHPVECDEECSE
VEASGLEEGESECISETSTEQVDVSHEVSDDEWAAAVDEAFPLDEAEDVTESVQEEAQ
PVEVPVEDIAQVVIADTLQETPVVSDTVEVPPQVVKLPSEPQTIQPEVKEVAPVYEAD
TEQTQSVTVKPKRLRKKRNVDPLSNFEHKVITECVTIVLGDAIQVAKCYGESVLVNAA
NTHLKHGGGIAGAINAASKGAVQKESDEYILAKGPLQVGDSVLLQGHSLAKNILHVVG
PDARAKQDVSLLSKCYKAMNAYPLVVTPLVSTGIFGVKPAVSFDYLIREAKTRVLVVV
NSQDVYKSLTIVDIPQSLTFSYDGLRGAIRKAKDYGFTVFVCTDNSANTKVLRNKGVD
YTKKFLTVDGVQYYCYTSKDTLDDILQQANKSVGIISMPLGYVSHGLDLIQAGSVVRR
VNVPYVCLLANKEQEAILMSEDVKLNPSEDFIKHVRTNGGYNSWHLVEGELLVQDLRL
NKLLHWSDQTICYKDSVFYVVKNSTAFPFETLSACRAYLDSRTTQQLTIEVLVTVDGV
NFRTVVLNNKNTYRSQLGCVFFNGADISDTIPDEKQNGHSLYLADNLTADETKALKEL
YGPVDPTFLHRFYSLKAAVHKWKMVVCDKVRSLKLSDNNCYLNAVIMTLDLLKDIKFV
IPALQHAFMKHKGGDSTDFIALIMAYGNCTFGAPDDASRLLHTVLAKAELCCSARMVW
REWCNVCGIKDVVLQGLKACCYVGVQTVEDLRARMTYVCQCGGERHRQIVEHTTPWLL
LSGTPNEKLVTTSTAPDFVAFNVFQGIETAVGHYVHACLKGGLILKFDSGTVSKTSDW
KCKVTDVLFPGQKYSSDCNVVRYSLDGNFRTEVDPDLSAFYVKDGKYFISEPPVTYSP
ATILAGSVYTNSCLVSSDGQPGGDAISLSFNNLLGFDSSKPVTKKYTYSFLPKEDGDV
LLAEFDTYDPIYKNGAMYKGKPILWVNKASYDTNLNKFNRASLRQIFDVAPIELENKF
TPLSVASTPVEPPTVDVVALQQEMTIVKCKGLNKPFVKDNVSFVVDDSGTPVVEYLSK
EDLHTLYVDPKYQVIVLKDNVLSSMLRLHTVESGDINVVAASGSLTRKVKLLFRASFY
FKEFATRTFTATTAVGSCIKSVVRHLGVTKGILTGCFSFVKMLFILPLAYFSDSKLGT
TEVKVSALKTAGVVTGNVVKQCCTAAVDLSMDKLRRVDWKSTLRLLLMLCTTMVLLSS
VYHLYVFNQVLSSDVMFEDAQGLKKFYKEVRAYLGISSACDGLASAYRANSFDVPTFC
ANRSAMCNWCLISQDSITHYPALKMVQTHLSHYVLNIDWLWFAFETGLAYMLYTSAFN
WLLLAGTLHYFFAQTSIFVDWRSYNYAVSSAFWLFTHIPMAGLVRMYNLLACLWLLRK
FYQHVINGCKDTACLLCYKRNRLTRVEASTVVCGGKRTFYITANGGISFCRRHNWNCV
DCDIAGVGNTFICEEVANDLTTALRRPINATDRSHYYVDSVTVKETVVQFNYRRDGQP
FYERFPLCAFTNLDKLKFKEVCKTTTGIPEYNFIIYDSSDRGQESLARSACVYYSQVL
CKSILLVDSSLVTSVGDSSEIATKMFDSFVNSFVSLYNVTRDKLEKLISTARDGVRRG
DNFHSVLTTFIDAARGPAGVESDVETNEIVDSVQYAHKHDIQITNESYNNYVPSYVKP
DSVSTSDLGSLIDCNAASVNQIVLRNSNGACIWNAAAYMKLSDALKRQIRIACRKCNL
AFRLTTSKLRANDNILSVRFTANKIVGGAPTWFNVLRDFTLKGYVLATIIVFLCAVLM
YLCLPTFSMVPVEFYEDRILDFKVLDNGIIRDVNPDDKCFANKHRSFTQWYHEHVGGV
YDNSITCPLTVAVIAGVAGARIPDVPTTLAWVNNQIIFFVSRVFANTGSVCYTPIDEI
PYKSFSDSGCILPSECTMFRDAEGRMTPYCHDPTVLPGAFAYSQMRPHVRYDLYDGNM
FIKFPEVVFESTLRITRTLSTQYCRFGSCEYAQEGVCITTNGSWAIFNDHHLNRPGVY
CGSDFIDIVRRLAVSLFQPITYFQLTTSLVLGIGLCAFLTLLFYYINKVKRAFADYTQ
CAVIAVVAAVLNSLCICFVASIPLCIVPYTALYYYATFYFTNEPAFIMHVSWYIMFGP
IVPIWMTCVYTVAMCFRHFFWVLAYFSKKHVEVFTDGKLNCSFQDAASNIFVINKDTY
AALRNSLTNDAYSRFLGLFNKYKYFSGAMETAAYREAAACHLAKALQTYSETGSDLLY
QPPNCSITSGVLQSGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCP
ADQLSDPNYDALLISMTNHSFSVQKHIGAPANLRVVGHAMQGTLLKLTVDVANPSTPA
YTFTTVKPGAAFSVLACYNGRPTGTFTVVMRPNYTIKGSFLCGSCGSVGYTKEGSVIN
FCYMHQMELANGTHTGSAFDGTMYGAFMDKQVHQVQLTDKYCSVNVVAWLYAAILNGC
AWFVKPNRTSVVSFNEWALANQFTEFVGTQSVDMLAVKTGVAIEQLLYAIQQLYTGFQ
GKQILGSTMLEDEFTPEDVNMQIMGVVMQSGVRKVTYGTAHWLFATLVSTYVIILQAT
KFTLWNYLFETIPTQLFPLLFVTMAFVMLLVKHKHTFLTLFLLPVAICLTYANIVYEP
TTPISSALIAVANWLAPTNAYMRTTHTDIGVYISMSLVLVIVVKRLYNPSLSNFALAL
CSGVMWLYTYSIGEASSPIAYLVFVTTLTSDYTITVFVTVNLAKVCTYAIFAYSPQLT
LVFPEVKMILLLYTCLGFMCTCYFGVFSFLNLKLRAPMGVYDFKVSTQEFRFMTANNL
TAPRNSWEAMALNFKLIGIGGTPCIKVAAMQSKLTDLKCTSVVLLSVLQQLHLEANSR
AWAFCVKCHNDILAATDPSEAFEKFVSLFATLMTFSGNVDLDALASDIFDTPSVLQAT
LSEFSHLATFAELEAAQKAYQEAMDSGDTSPQVLKALQKAVNIAKNAYEKDKAVARKL
ERMADQAMTSMYKQARAEDKKAKIVSAMQTMLFGMIKKLDNDVLNGIISNARNGCIPL
SVIPLCASNKLRVVIPDFTVWNQVVTYPSLNYAGALWDITVINNVDNEIVKSSDVVDS
NENLTWPLVLECTRASTSAVKLQNNEIKPSGLKTMVVSAGQEQTNCNTSSLAYYEPVQ
GRKMLMALLSDNAYLKWARVEGKDGFVSVELQPPCKFLIAGPKGPEIRYLYFVKNLNN
LHRGQVLGHIAATVRLQAGSNTEFASNSSVLSLVNFTVDPQKAYLDFVNAGGAPLTNC
VKMLTPKTGTGIAISVKPESTADQETYGGASVCLYCRAHIEHPDVSGVCKYKGKFVQI
PAQCVRDPVGFCLSNTPCNVCQYWIGYGCNCDSLRQVALPQSKDSNFLNRVRGSIVNA
RIEPCSSGLSTDVVFRAFDICNYKAKVAGIGKYYKTNTCRFVELDDQGHHLDSYFVVK
RHTMENYELEKHCYDLLRDCDAVAPHDFFIFDVDKVKTPHIVRQRLTEYTMMDLVYAL
RHFDQNSEVLKAILVKYGCCDVTYFENKLWFDFVENPSVIGVYHKLGERVRQAILNTV
KFCDHMVKAGLVGVLTLDNQDLNGKWYDFGDFVITQPGSGVAIVDSYYSYLMPVLSMT
DCLAAETHRDCDFNKPLIEWPLTEYDFTDYKVQLFEKYFKYWDQTYHANCVNCTDDRC
VLHCANFNVLFAMTMPKTCFGPIVRKIFVDGVPFVVSCGYHYKELGLVMNMDVSLHRH
RLSLKELMMYAADPAMHIASSNAFLDLRTSCFSVAALTTGLTFQTVRPGNFNQDFYDF
VVSKGFFKEGSSVTLKHFFFAQDGNAAITDYNYYSYNLPTMCDIKQMLFCMEVVNKYF
EIYDGGCLNASEVVVNNLDKSAGHPFNKFGKARVYYESMSYQEQDELFAMTKRNVIPT
MTQMNLKYAISAKNRARTVAGVSILSTMTNRQYHQKMLKSMAATRGATCVIGTTKFYG
GWDFMLKTLYKDVDNPHLMGWDYPKCDRAMPNMCRIFASLILARKHGTCCTTRDRFYR
LANECAQVLSEYVLCGGGYYVKPGGTSSGDATTAYANSVFNILQATTANVSALMGANG
NKIVDKEVKDMQFDLYVNVYRSTSPDPKFVDKYYAFLNKHFSMMILSDDGVVCYNSDY
AAKGYIAGIQNFKETLYYQNNVFMSEAKCWVETDLKKGPHEFCSQHTLYIKDGDDGYF
LPYPDPSRILSAGCFVDDIVKTDGTLMVERFVSLAIDAYPLTKHEDIEYQNVFWVYLQ
YIEKLYKDLTGHMLDSYSVMLCGDNSAKFWEEAFYRDLYSSPTTLQAVGSCVVCHSQT
SLRCGTCIRRPFLCCKCCYDHVIATPHKMVLSVSPYVCNAPGCGVSDVTKLYLGGMSY
FCVDHRPVCSFPLCANGLVFGLYKNMCTGSPSIVEFNRLATCDWTESGDYTLANTTTE
PLKLFAAETLRATEEASKQSYAIATIKEIVGERQLLLVWEAGKSKPPLNRNYVFTGYH
ITKNSKVQLGEYIFERIDYSDAVSYKSSTTYKLTVGDIFVLTSHSVATLTAPTIVNQE
RYVKITGLYPTITVPEEFASHVANFQKSGYSKYVTVQGPPGTGKSHFAIGLAIYYPTA
RVVYTACSHAAVDALCEKAFKYLNIAKCSRIIPAKARVECYDRFKVNETNSQYLFSTI
NALPETSADILVVDEVSMCTNYDLSIINARIKAKHIVYVGDPAQLPAPRTLLTRGTLE
PENFNSVTRLMCNLGPDIFLSMCYRCPKEIVSTVSALVYNNKLLAKKELSGQCFKILY
KGNVTHDASSAINRPQLTFVKNFITANPAWSKAVFISPYNSQNAVARSMLGLTTQTVD
SSQGSEYQYVIFCQTADTAHANNINRFNVAITRAQKGILCVMTSQALFESLEFTELSF
TNYKLQSQIVTGLFKDCSRETSGLSPAYAPTYVSVDDKYKTSDELCVNLNLPANIPYS
RVISRMGFKLDATVPGYPKLFITREEAVRQVRSWIGFDVEGAHASRNACGTNVPLQLG
FSTGVNFVVQPVGVVDTEWGNMLTGIAARPPPGEQFKHLVPLMHKGAAWPIVRRRIVQ
MLSDTLDKLSDYCTFVCWAHGFELTSASYFCKIGKEQKCCMCNRRAAAYSSPLQSYAC
WTHSCGYDYVYNPFFVDVQQWGYVGNLATNHDRYCSVHQGAHVASNDAIMTRCLAIHS
CFIERVDWDIEYPYISHEKKLNSCCRIVERNVVRAALLAGSFDKVYDIGNPKGIPIVD
DPVVDWHYFDAQPLTRKVQQLFYTEDMASRFADGLCLFWNCNVPKYPNNAIVCRFDTR
VHSEFNLPGCDGGSLYVNKHAFHTPAYDVSAFRDLKPLPFFYYSTTPCEVHGNGSMIE
DIDYVPLKSAVCITACNLGGAVCRKHATEYREYMEAYNLVSASGFRLWCYKTFDIYNL
WSTFTKVQGLENIAFNVVKQGHFIGVEGELPVAVVNDKIFTKSGVNDICMFENKTTLP
TNIAFELYAKRAVRSHPDFKLLHNLQADICYKFVLWDYERSNIYGTATIGVCKYTDID
VNSALNICFDIRDNGSLEKFMSTPNAIFISDRKIKKYPCIVGPDYAYFNGAIIRDSDV
VKQPVKFYLYKKVNNEFIDPTECIYTQSRSCSDFLPLSDMEKDFLSFDSDVFIKKYGL
ENYAFEHVVYGDFSHTTLGGLHLLIGLYKKQQEGHIIMEEMLKGSSTIHNYFITETNT
AAFKAVCSVIDLKLDDFVMILKSQDLGVVSKVVKVPIDLTMIEFMLWCKDGQVQTFYP
RLQASADWKPGHAMPSLFKVQNVNLERCELANYKQSIPMPRGVHMNIAKYMQLCQYLN
TCTLAVPANMRVIHFGAGSDKGIAPGTSVLRQWLPTDAIIIDNDLNEFVSDADITLFG
DCVTVRVSQQVDLVISDMYDPTTKNVTGSNESKALFFTYLCNLINNNLALGGSVAIKI
TEHSWSVELYELMGKFAWWTVFCTNANASSSEGFLLGINYLGTIKENIDGGAMHANYI
FWRNSTPMNLSTYSLFDLSKFQLKLKGTPVLQLKESQINELVISLLSQGKLLIRDNDT
LSVSTDVLVNTYRKLR"
CDS 135..13310
/codon_start=1
/product="ORF1a"
/protein_id="AKL80603.1"
/db_xref="GI:829624511"
/translation="MSFVAGVIAQGARGTYRAALNSEKHQDHVSLTVPLCGSGNLVEK
LSPWFMDGENAYEVVKAMLLKKEPLLYVPIRLAGHTRHLPGPRVYLVERLIACENPFM
VNQLAYSSSANGSLVGTTLQGKPIGMFFPYDIELVTGKQNILLRKYGRGGYHYTPVHY
ERDNTSCPEWMDDFEADPKGKYAQNLLKKLIGGDVTPVDQYMCGVDGKPISAYAFLMA
KDGITKLADVEADVAARADDEGFITLKNNLYRLVWHVERKDVPYPKQSIFTINSVVQK
DGVENTPPHYFTLGCKILTLTPRNKWSGVSDLSLKQKLLYTFYGKESLENPTYIYHSA
FIECGSCGNDSWLTGNAIQGFACGCGASYTANDVEVQSSGMIKPNALLCATCPFAKGD
SCSSNCKHSVAQLVSYLSERCNVIADSKSFTLIFGGVAYAYFGCEEGTMYFVPRAKSV
VSRIGDSIFTGCTGSWNKVTQIANMFLEQTQHSLNFVGEFVVNDVVLAILSGTTTNVD
KIRQLLKGVTIDKLRDYLADYDVAVTAGPFMDNAINVGGTGLQYAAITAPYVVLTGLG
ESFKKVATIPYKVCNSVKDTLTYYAHSVLYRVFPYDMDSGVSSFSELLFDCVDLSVAS
TYFLVRLLQDKTGDFMSTIITSCQTAVSKLLDTCFEATEATFNFLLDLAGLFRIFLRN
AYVYTSQGFVVVNGKVSTLVKQVLDLLNKGMQLLHTKVSWAGSNISAVIYSGRESLIF
PSGTYYCVTTKAKSVQQDLDVILPGEFSKKQLGLLQPTDNSTTVSVTVSSNMVETVVG
QLEQTNMHSPDVIVGDYVIISEKLFVRSKEEDGFAFYPACTNGHAVPTLFRLKGGAPV
KKVAFGGDQVHEVAAVRSVTVEYNIHAVLDTLLASSSLRTFVVDKSLSIEEFADVVKE
QVSDLLVKLLRGMPIPDFDLDDFIDAPCYCFNAEGDASWSSTMIFSLHPVECDEECSE
VEASGLEEGESECISETSTEQVDVSHEVSDDEWAAAVDEAFPLDEAEDVTESVQEEAQ
PVEVPVEDIAQVVIADTLQETPVVSDTVEVPPQVVKLPSEPQTIQPEVKEVAPVYEAD
TEQTQSVTVKPKRLRKKRNVDPLSNFEHKVITECVTIVLGDAIQVAKCYGESVLVNAA
NTHLKHGGGIAGAINAASKGAVQKESDEYILAKGPLQVGDSVLLQGHSLAKNILHVVG
PDARAKQDVSLLSKCYKAMNAYPLVVTPLVSTGIFGVKPAVSFDYLIREAKTRVLVVV
NSQDVYKSLTIVDIPQSLTFSYDGLRGAIRKAKDYGFTVFVCTDNSANTKVLRNKGVD
YTKKFLTVDGVQYYCYTSKDTLDDILQQANKSVGIISMPLGYVSHGLDLIQAGSVVRR
VNVPYVCLLANKEQEAILMSEDVKLNPSEDFIKHVRTNGGYNSWHLVEGELLVQDLRL
NKLLHWSDQTICYKDSVFYVVKNSTAFPFETLSACRAYLDSRTTQQLTIEVLVTVDGV
NFRTVVLNNKNTYRSQLGCVFFNGADISDTIPDEKQNGHSLYLADNLTADETKALKEL
YGPVDPTFLHRFYSLKAAVHKWKMVVCDKVRSLKLSDNNCYLNAVIMTLDLLKDIKFV
IPALQHAFMKHKGGDSTDFIALIMAYGNCTFGAPDDASRLLHTVLAKAELCCSARMVW
REWCNVCGIKDVVLQGLKACCYVGVQTVEDLRARMTYVCQCGGERHRQIVEHTTPWLL
LSGTPNEKLVTTSTAPDFVAFNVFQGIETAVGHYVHACLKGGLILKFDSGTVSKTSDW
KCKVTDVLFPGQKYSSDCNVVRYSLDGNFRTEVDPDLSAFYVKDGKYFISEPPVTYSP
ATILAGSVYTNSCLVSSDGQPGGDAISLSFNNLLGFDSSKPVTKKYTYSFLPKEDGDV
LLAEFDTYDPIYKNGAMYKGKPILWVNKASYDTNLNKFNRASLRQIFDVAPIELENKF
TPLSVASTPVEPPTVDVVALQQEMTIVKCKGLNKPFVKDNVSFVVDDSGTPVVEYLSK
EDLHTLYVDPKYQVIVLKDNVLSSMLRLHTVESGDINVVAASGSLTRKVKLLFRASFY
FKEFATRTFTATTAVGSCIKSVVRHLGVTKGILTGCFSFVKMLFILPLAYFSDSKLGT
TEVKVSALKTAGVVTGNVVKQCCTAAVDLSMDKLRRVDWKSTLRLLLMLCTTMVLLSS
VYHLYVFNQVLSSDVMFEDAQGLKKFYKEVRAYLGISSACDGLASAYRANSFDVPTFC
ANRSAMCNWCLISQDSITHYPALKMVQTHLSHYVLNIDWLWFAFETGLAYMLYTSAFN
WLLLAGTLHYFFAQTSIFVDWRSYNYAVSSAFWLFTHIPMAGLVRMYNLLACLWLLRK
FYQHVINGCKDTACLLCYKRNRLTRVEASTVVCGGKRTFYITANGGISFCRRHNWNCV
DCDIAGVGNTFICEEVANDLTTALRRPINATDRSHYYVDSVTVKETVVQFNYRRDGQP
FYERFPLCAFTNLDKLKFKEVCKTTTGIPEYNFIIYDSSDRGQESLARSACVYYSQVL
CKSILLVDSSLVTSVGDSSEIATKMFDSFVNSFVSLYNVTRDKLEKLISTARDGVRRG
DNFHSVLTTFIDAARGPAGVESDVETNEIVDSVQYAHKHDIQITNESYNNYVPSYVKP
DSVSTSDLGSLIDCNAASVNQIVLRNSNGACIWNAAAYMKLSDALKRQIRIACRKCNL
AFRLTTSKLRANDNILSVRFTANKIVGGAPTWFNVLRDFTLKGYVLATIIVFLCAVLM
YLCLPTFSMVPVEFYEDRILDFKVLDNGIIRDVNPDDKCFANKHRSFTQWYHEHVGGV
YDNSITCPLTVAVIAGVAGARIPDVPTTLAWVNNQIIFFVSRVFANTGSVCYTPIDEI
PYKSFSDSGCILPSECTMFRDAEGRMTPYCHDPTVLPGAFAYSQMRPHVRYDLYDGNM
FIKFPEVVFESTLRITRTLSTQYCRFGSCEYAQEGVCITTNGSWAIFNDHHLNRPGVY
CGSDFIDIVRRLAVSLFQPITYFQLTTSLVLGIGLCAFLTLLFYYINKVKRAFADYTQ
CAVIAVVAAVLNSLCICFVASIPLCIVPYTALYYYATFYFTNEPAFIMHVSWYIMFGP
IVPIWMTCVYTVAMCFRHFFWVLAYFSKKHVEVFTDGKLNCSFQDAASNIFVINKDTY
AALRNSLTNDAYSRFLGLFNKYKYFSGAMETAAYREAAACHLAKALQTYSETGSDLLY
QPPNCSITSGVLQSGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCP
ADQLSDPNYDALLISMTNHSFSVQKHIGAPANLRVVGHAMQGTLLKLTVDVANPSTPA
YTFTTVKPGAAFSVLACYNGRPTGTFTVVMRPNYTIKGSFLCGSCGSVGYTKEGSVIN
FCYMHQMELANGTHTGSAFDGTMYGAFMDKQVHQVQLTDKYCSVNVVAWLYAAILNGC
AWFVKPNRTSVVSFNEWALANQFTEFVGTQSVDMLAVKTGVAIEQLLYAIQQLYTGFQ
GKQILGSTMLEDEFTPEDVNMQIMGVVMQSGVRKVTYGTAHWLFATLVSTYVIILQAT
KFTLWNYLFETIPTQLFPLLFVTMAFVMLLVKHKHTFLTLFLLPVAICLTYANIVYEP
TTPISSALIAVANWLAPTNAYMRTTHTDIGVYISMSLVLVIVVKRLYNPSLSNFALAL
CSGVMWLYTYSIGEASSPIAYLVFVTTLTSDYTITVFVTVNLAKVCTYAIFAYSPQLT
LVFPEVKMILLLYTCLGFMCTCYFGVFSFLNLKLRAPMGVYDFKVSTQEFRFMTANNL
TAPRNSWEAMALNFKLIGIGGTPCIKVAAMQSKLTDLKCTSVVLLSVLQQLHLEANSR
AWAFCVKCHNDILAATDPSEAFEKFVSLFATLMTFSGNVDLDALASDIFDTPSVLQAT
LSEFSHLATFAELEAAQKAYQEAMDSGDTSPQVLKALQKAVNIAKNAYEKDKAVARKL
ERMADQAMTSMYKQARAEDKKAKIVSAMQTMLFGMIKKLDNDVLNGIISNARNGCIPL
SVIPLCASNKLRVVIPDFTVWNQVVTYPSLNYAGALWDITVINNVDNEIVKSSDVVDS
NENLTWPLVLECTRASTSAVKLQNNEIKPSGLKTMVVSAGQEQTNCNTSSLAYYEPVQ
GRKMLMALLSDNAYLKWARVEGKDGFVSVELQPPCKFLIAGPKGPEIRYLYFVKNLNN
LHRGQVLGHIAATVRLQAGSNTEFASNSSVLSLVNFTVDPQKAYLDFVNAGGAPLTNC
VKMLTPKTGTGIAISVKPESTADQETYGGASVCLYCRAHIEHPDVSGVCKYKGKFVQI
PAQCVRDPVGFCLSNTPCNVCQYWIGYGCNCDSLRQVALPQSKDSNFLNESGVLL"
CDS 21312..25373
/codon_start=1
/product="S protein"
/protein_id="AKL80604.1"
/db_xref="GI:829624512"
/translation="MIHSVFLLMFLLTPTESYVDVGPDSVKSACIEVDIQQTFFDKTW
PRPIDVSKADGIIYPQGRTYSNITITYQGLFPYQGDHGDMYVYSAGHATGTTPQKLFV
ANYSQDVKQFANGFVVRIGAAANSTGTVIISPSTSATIRKIYPAFMLGSSVGNFSDGK
MGRFFNHTLVLLPDGCGTLLRAFYCILEPRSGNHCPAGNSYTSFATYHTPATDCSDGN
YNRNASLNSFKEYFNLRNCTFMYTYNITEDEILEWFGITQTAQGVHLFSSRYVDLYGG
NMFQFATLPVYDTIKYYSIIPHSIRSIQSDRKAWAAFYVYKLQPLTFLLDFSVDGYIR
RAIDCGFNDLSQLHCSYESFDVESGVYSVSSFEAKPSGSVVEQAEGVECDFSPLLSGT
PPQVYNFKRLVFTNCNYNLTKLLSLFSVNDFTCSQISPAAIASNCYSSLILDYFSYPL
SMKSDLSVSSAGPISQFNYKQSFSNPTCLILATVPHNLTTITKPLKYSYINKCSRLLS
DDRTEVPQLVNANQYSPCVSIVPSTVWEDGDYYRKQLSPLEGGGWLVASGSTVAMTEQ
LQMGFGITVQYGTDTNSVCPKLEFANDTKIASQLGNCVEYSLYGVSGRGVFQNCTAVG
VRQQRFVYDAYQNLVGYYSDDGNYYCLRACVSVPVSVIYDKETKTHATLFGSVACEHI
SSTMSQYSRSTRSMLKRRDSTYGPLQTPVGCVLGLVNSSLFVEDCKLPLGQSLCALPD
TPSTLTPRSVRSVPGEMRLASIAFNHPIQVDQLNSSYFKLSIPTNFSFGVTQEYIQTT
IQKVTVDCKQYVCNGFQKCEQLLREYGQFCSKINQALHGANLRQDDSVRNLFASVKSS
QSSPIIPGFGGDFNLTLLEPVSISTGSRSARSAIEDLLFDKVTIADPGYMQGYDDCMQ
QGPASARDLICAQYVAGYKVLPPLMDVNMEAAYTSSLLGSIAGVGWTAGLSSFAAIPF
AQSIFYRLNGVGITQQVLSENQKLIANKFNQALGAMQTGFTTTNEAFRKVQDAVNNNA
QALSKLASELSNTFGAISASIGDIIQRLDVLEQDAQIDRLINGRLTTLNAFVAQQLVR
SESAALSAQLAKDKVNECVKAQSKRSGFCGQGTHIVSFVVNAPNGLYFMHVGYYPSNH
IEVVSAYGLCDAANPTNCIAPVNGYFIKTNNTRIVDEWSYTGSSFYAPEPITSLNTKY
VAPQVTYQNISTNLPPPLLGNSTGIDFQDELDEFFKNVSTSIPNFGSLTQINTTLLDL
TYEMLSLQQVVKALNESYIDLKELGNYTYYNKWPWYIWLGFIAGLVALALCVFFILCC
TGCGTNCMGKLKCNRCCDRYEEYDLEPHKVHVH"
CDS 25388..25699
/codon_start=1
/product="ORF3"
/protein_id="AKL80605.1"
/db_xref="GI:829624513"
/translation="MRVQRPPTLLLVFSLSFLVTAFSKPLYVPEHCQNYSGCMLRACI
KTAQADTAGLYTNFRIDVPSAESTGTQSVSVDRESTSTHDGLTEHVTSVNLFDVGYSV
N"
CDS 25708..26037
/codon_start=1
/product="ORF4a"
/protein_id="AKL80606.1"
/db_xref="GI:829624514"
/translation="MDYVSLLNQIWQKYLNSPYTTCLYIPKPTAKYTPLVGTSLHPVL
WNCQLSFAGYTESAVNSTKALAKQDAAQRIAWLLHKDGGIPDGCSLYLRHSSLFAQSE
EEESFSN"
CDS 25949..26689
/codon_start=1
/product="ORF4b"
/protein_id="AKL80607.1"
/db_xref="GI:829624515"
/translation="MEESLTDVPSTSGTQVYSRKARKRSHSPTKKLRYVKRRFSLLRP
EDLSVIVQPTHYVRVTFSDPNMWYLRSGHHLHSVHNWLKPYGGQPVSEYHITLALLNL
TDEDLARDFSPIALFLRNVRFELHEFALLRKTLVLNASEIYCANIHRFKPVYRVNTAI
PTIKDWLLVQGFSLYHSGLPLHMSISKLHALDDVTRNYIITMPCFRTYPQQMFVTPLA
VDVVSIRSSNQGNKQIVHSYPILHHPGF"
CDS 26696..27139
/note="81aa deletion in C-terminus"
/codon_start=1
/product="ORF5"
/protein_id="AKL80608.1"
/db_xref="GI:829624516"
/translation="MAFSASLFKPVQLVPVSPAFHRIESTDSIVFTYIPASGYVAALA
VNVCLIPLLLLLRQDTCRRSIIRTMVLYFLVLYNFLLAIVLVNGVHYPTGSCLIAFLV
ILIILWFVDRIRFCLMLNSYIPLFDMRSHFIRVSTVSSHGFPYGY"
CDS 27117..27275
/note="N-terminus truncated with 30aa deletion"
/codon_start=1
/product="E protein"
/protein_id="AKL80609.1"
/db_xref="GI:829624517"
/translation="MAFLTATRLCVQCMTGFNTLLVQPALYLYNTGRSVYVKFQDSKP
PLPPDEWV"
CDS 27290..27949
/codon_start=1
/product="M protein"
/protein_id="AKL80610.1"
/db_xref="GI:829624518"
/translation="MSNMTQLTEAQIIAIIKDWNFAWSLIFLLITIVLQYGYPSRSMT
VYVFKMFVLWLLWPSSMALSIFSAIYPIDLASQIISGIVAAVSAMMWISYFVQSIRLF
MRTGSWWSFNPETNCLLNVPIGGTTVVRPLVEDSTSVTAVVTNGHLKMAGMHFGACDY
DRLPNEVTVAKPNVLIALKMVKRQSYGTNSGVAIYHRYKAGNYRSPPITADIELALLR
A"
CDS 28003..29244
/codon_start=1
/product="N protein"
/protein_id="AKL80611.1"
/db_xref="GI:829624519"
/translation="MASPAAPRAVSFADNNDITNTNLSRGRGRNPKPRAAPNNTVSWY
TGLTQHGKVPLTFPPGQGVPLNANSTPAQNAGYWRRQDRKINTGNGIKQLAPRWYFYY
TGTGPEAALPFRAVKDGIVWVHEDGATDAPSTFGTRNPNNDSAIVTQFAPGTKLPKNF
HIEGTGGNSQSSSRASSVSRNSSRSSSQGSRSGNSTRGTSPGPSGIGAVGGDLLYLDL
LNRLQALESGKVKQSQPKVITKKDAAAAKNKMRHKRTSTKSFNMVQAFGLRGPGDLQG
NFGDLQLNKLGTEDPRWPQIAELAPTASAFMGMSQFKLTHQNNDDHGNPVYFLRYSGA
IKLDPKNPNYNKWLELLEQNIDAYKTFPKKEKKQKAPKEESTDQMSEPPKEQRVQGSI
TQRTRTRPSVQPGPMIDVNTD"
CDS 28199..28537
/codon_start=1
/product="ORF8b"
/protein_id="AKL80612.1"
/db_xref="GI:829624520"
/translation="MPIPPLRKMLGIGGDRTEKLIPGMELSNWLPGGTSTTLELDPKQ
HSHSGLLRMASFGSMKMAPLMLLQLLGRGTLTMIQLLLHNSRPVLSFLKTSTLRGLEA
IVNHLQEPLA"

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Mon Jun 15, 2015 7:48 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
1 taggcagtgg acatatgctc aacactgggt ataattctaa ttgaatacta tttttcagtt
61 agagcgtcgt gtctcttgta cgtctcggtc acaatatacg gtttcgtccg gtgcgtggca
121 attcggggca catcatgtct ttcgtggctg gtgtgatcgc gcaaggtgcg cgcggtacgt
181 atcgagcagc gctcaactct gaaaaacatc aagaccatgt gtctctaact gtgccactct
241 gtggttcagg aaacctggtt gaaaaacttt caccatggtt catggatggc gaaaatgcct
301 atgaagtggt gaaggccatg ttacttaaaa aagagccact tctctatgtg cccatccggc
361 tggctggaca cactagacac ctcccaggtc ctcgtgtgta cctggttgag aggctcattg
421 cttgtgaaaa tccattcatg gttaaccaat tggcttatag ctctagtgca aatggcagcc
481 tggttggcac aactttgcag ggcaagccta ttggtatgtt cttcccttat gacatcgaac
541 ttgtcacagg aaagcaaaat attctcctgc gcaagtatgg ccgtggtggt tatcactaca
601 ccccagtcca ctatgagcga gacaacacct cttgccctga gtggatggac gattttgagg
661 cggatcctaa aggcaaatat gcccagaatc tgcttaagaa gttgattggc ggtgatgtca
721 ctccagttga ccaatacatg tgtggcgttg atggaaaacc cattagtgcc tacgcatttt
781 taatggccaa ggatggaata accaaactgg ctgatgttga agcggacgtc gcagcacgtg
841 ctgatgacga aggcttcatc acattaaaga acaatctata tagattggtt tggcatgttg
901 agcgtaaaga cgttccatat cctaagcaat ctatttttac tattaatagt gtggtccaaa
961 aggatggtgt tgaaaacact cctcctcact attttactct tggatgcaaa attttaacgc
1021 tcaccccacg caacaagtgg agtggcgttt ctgacttgtc cctcaaacaa aaactccttt
1081 acaccttcta tggtaaggag tcacttgaga acccaaccta catttaccac tccgcattca
1141 ttgagtgtgg aagttgtggt aatgattcct ggcttacagg gaatgctatc caagggtttg
1201 cctgtggatg tggggcatca tatacagcta atgatgtcga agtccaatca tctggcatga
1261 ttaagccaaa tgctcttctt tgtgctactt gcccctttgc taagggtgac agctgttctt
1321 ctaattgcaa acattcagtt gctcagttgg ttagttacct ttctgaacgc tgtaatgtta
1381 ttgctgattc taagtccttc acacttatct ttggtggcgt agcttacgcc tactttggat
1441 gtgaggaagg tactatgtac tttgtgccta gagctaagtc tgttgtctca aggattggag
1501 actccatctt tacaggctgt actggctctt ggaacaaggt cactcaaatt gctaacatgt
1561 tcttggaaca gactcagcat tcccttaact ttgtgggaga gttcgttgtc aacgatgttg
1621 tcctcgcaat tctctctgga accacaacta atgttgacaa aatacgccag cttctcaaag
1681 gtgtcaccat tgacaagttg cgtgattatt tagctgacta tgacgtagca gtcactgccg
1741 gcccattcat ggataatgct attaatgttg gtggtacagg attacagtat gccgccatta
1801 ctgcacctta tgtagttctc actggcttag gtgagtcctt taagaaagtt gcaaccatac
1861 cgtacaaggt ttgcaactct gttaaggata ctctgactta ttatgctcac agcgtgttgt
1921 acagagtttt tccttatgac atggattctg gtgtgtcatc ctttagtgaa ctactttttg
1981 attgcgttga tctttcagta gcttctacct attttttagt ccgcctcttg caagataaga
2041 ctggcgactt tatgtctaca attattactt cctgccaaac tgctgttagt aagcttctag
2101 atacatgttt tgaagctaca gaagcaacat ttaacttctt gttagatttg gcaggattgt
2161 tcagaatctt tcttcgcaat gcctatgtgt acacttcaca agggtttgtg gtggtcaatg
2221 gcaaagtttc tacacttgtc aaacaagtgt tagacttgct taataagggt atgcaacttt
2281 tgcatacaaa ggtctcctgg gctggttcta atatcagtgc tgttatctac agcggcaggg
2341 agtctctaat attcccatcg ggaacctatt actgtgtcac cactaaggct aagtccgttc
2401 aacaagatct tgacgttatt ttgcctggtg agttttccaa gaagcagtta ggactgctcc
2461 aacctactga caattctaca actgttagtg ttactgtatc cagtaacatg gttgaaactg
2521 ttgtgggtca acttgagcaa actaatatgc atagtcctga tgttatagta ggtgactatg
2581 tcattattag tgaaaaattg tttgtgcgta gtaaggaaga agacggattc gccttctacc
2641 ctgcttgcac taatggtcat gctgtaccga ctctctttag acttaaggga ggtgcacctg
2701 taaaaaaagt agcctttggc ggtgatcaag tacatgaggt tgctgctgta agaagtgtta
2761 ctgtcgagta caacattcat gctgtattag acacactact tgcttcttct agtcttagaa
2821 cctttgttgt agataagtct ttgtcaattg aggagtttgc tgacgtagta aaggaacaag
2881 tctcagactt gcttgttaaa ttactgcgtg gaatgccgat tccagatttt gatttagacg
2941 attttattga cgcaccatgc tattgcttta acgctgaggg tgatgcatct tggtcttcta
3001 ctatgatctt ctctcttcac cccgtcgagt gtgacgagga gtgttctgaa gtagaggctt
3061 caggtttaga agaaggtgaa tcagagtgca tttctgagac ttcaactgaa caagttgacg
3121 tttctcatga ggtttctgac gacgagtggg ctgctgcagt tgatgaagcg ttccccctcg
3181 atgaagcaga agatgttact gaatctgtgc aagaagaagc acaaccagta gaagtacctg
3241 ttgaagatat tgcgcaggtt gtcatagctg acaccttaca ggaaactcct gttgtgtctg
3301 atactgttga agtcccaccg caagtggtga aacttccgtc tgaacctcag actatccagc
3361 ccgaggtaaa agaagttgca cctgtctatg aggctgatac cgaacagaca cagagtgtta
3421 ctgttaaacc taagaggtta cgcaaaaagc gtaatgttga ccctttgtcc aattttgaac
3481 ataaggttat tacagagtgc gttaccatag ttttaggtga cgcaattcaa gtagccaagt
3541 gctatgggga gtctgtgtta gttaatgctg ctaacacaca tcttaagcat ggcggtggta
3601 tcgctggtgc tattaatgcg gcttcaaaag gggctgtcca aaaagagtca gatgagtata
3661 ttctggctaa agggccgtta caagtaggag attcagttct cttgcaaggc cattctctag
3721 ctaagaatat cctgcatgtc gtaggcccag atgcccgcgc taaacaggat gtttctctcc
3781 ttagtaagtg ctataaggct atgaatgcat atcctcttgt agtcactcct cttgtttcaa
3841 caggcatatt tggtgtaaaa ccagctgtgt cttttgatta tcttattaga gaggctaaga
3901 ctagagtttt agtcgtcgtt aattcccaag atgtctataa gagtcttacc atagttgaca
3961 ttccacagag tttgactttt tcatatgatg ggttacgtgg cgcaatacgt aaagctaaag
4021 attatggttt tactgttttt gtgtgcacag acaactctgc taacactaaa gttcttagga
4081 acaagggtgt tgattatact aagaagtttc ttacagttga cggtgtgcaa tattattgct
4141 acacgtctaa ggacacttta gatgatatct tacaacaggc taataagtct gttggtatta
4201 tatctatgcc tttgggatat gtgtctcatg gtttagactt aattcaagca gggagtgtcg
4261 tgcgtagagt taacgtgccc tacgtgtgtc tcctagctaa taaagagcaa gaagctattt
4321 tgatgtctga agacgttaag ttaaaccctt cagaagattt tataaagcac gtccgcacta
4381 atggtggtta caattcttgg catttagtcg agggtgaact attggtgcaa gacttacgct
4441 taaataagct cctgcattgg tctgatcaaa ccatatgcta caaggatagt gtgttttatg
4501 ttgtaaagaa tagtacagct tttccatttg aaacactttc agcatgtcgt gcgtatttgg
4561 attcacgcac gacacagcag ttaacaatcg aagtcttagt gactgtcgat ggtgtaaatt
4621 ttagaacagt cgttctaaat aataagaaca cttatagatc acagcttgga tgcgttttct
4681 ttaatggtgc tgatatttct gataccattc ctgatgagaa acagaatggt cacagtttat
4741 atctagcaga caatttgact gctgatgaaa caaaggcgct taaagagtta tatggccccg
4801 ttgatcctac tttcttacac agattctatt cacttaaggc tgcagtccat aagtggaaga
4861 tggttgtgtg tgataaggta cgttctctca aattgagtga taataattgt tatcttaatg
4921 cagttattat gacacttgat ttattgaagg acattaaatt tgttatacct gctctacagc
4981 atgcatttat gaaacataag ggcggtgatt caactgactt catagccctc attatggctt
5041 atggcaattg cacatttggt gctccagatg atgcctctcg gttacttcat accgtgcttg
5101 caaaggctga gttatgctgt tctgcacgca tggtttggag agagtggtgc aatgtctgtg
5161 gcataaaaga tgttgttcta caaggcttaa aagcttgttg ttacgtgggt gtgcaaactg
5221 ttgaagatct gcgtgctcgc atgacatatg tatgccagtg tggtggtgaa cgtcatcggc
5281 aaatagtcga acacaccacc ccctggttgc tgctctcagg cacaccaaat gaaaaattgg
5341 tgacaacctc cacggcgcct gattttgtag cgtttaatgt ctttcagggc attgaaacgg
5401 ctgttggcca ttatgttcat gcttgcctga agggtggtct tattttaaag tttgactctg
5461 gcaccgttag caagacttca gactggaagt gcaaggtgac agatgtactt ttccccggcc
5521 aaaaatacag tagcgattgt aatgtcgtac ggtattcttt ggacggtaat ttcagaacag
5581 aggttgatcc cgacctatct gctttctatg ttaaggatgg taaatacttt ataagtgaac
5641 cacccgtaac atattcacca gctacaattt tagctggtag tgtctacact aatagctgcc
5701 ttgtatcgtc tgatggacaa cctggcggtg atgctattag tttgagtttt aataaccttt
5761 tagggtttga ttctagtaaa ccagtcacta agaaatacac ttactccttc ttgcctaaag
5821 aagacggcga tgtgttgttg gctgagtttg acacttatga ccctatttat aagaatggtg
5881 ccatgtataa aggcaaacca attctttggg tcaacaaagc atcttatgat actaatctta
5941 ataagttcaa tagagctagt ttgcgtcaaa tttttgacgt agcccccatt gaactcgaaa
6001 ataaattcac acctttgagt gtggcgtcca caccagttga acctccaact gtagatgtgg
6061 tagcacttca acaggaaatg acaattgtca aatgtaaggg tttaaataaa cctttcgtga
6121 aggacaatgt cagtttcgtt gttgatgact caggtactcc cgttgttgag tatctgtcta
6181 aagaagatct acatacattg tatgtagacc ctaagtatca agtcattgtc ttaaaagaca
6241 atgtactttc ttctatgctt agattgcaca ccgttgagtc aggtgatatt aacgttgttg
6301 cagcttccgg atctttgaca cgtaaagtga agttactatt tagggcttca ttttatttca
6361 aagaatttgc tacccgcact ttcactgcta ccactgctgt aggtagttgt ataaagagtg
6421 tagtgcggca tctaggtgtt actaaaggca tattgacagg ctgttttagt tttgtcaaga
6481 tgttatttat tcttccacta gcttacttta gtgattcaaa actcggcacc acagaggtta
6541 aagtgagtgc tttgaaaaca gctggcgttg tgacaggtaa tgttgtaaaa cagtgttgca
6601 ctgctgctgt tgatttaagt atggataagt tgcgccgtgt ggattggaaa tcaaccctac
6661 ggttgttact tatgttatgc acaactatgg tattgttgtc ttctgtgtat cacttgtatg
6721 tcttcaatca ggtcttatca agtgatgtta tgtttgaaga tgcccaaggt ttgaaaaagt
6781 tctacaaaga agttagagct tacctaggaa tctcttctgc ttgtgacggt cttgcttcag
6841 cttatagggc gaattcattt gatgtaccta cattctgcgc aaaccgttct gcaatgtgta
6901 attggtgctt gattagccaa gattccataa ctcactaccc agctcttaag atggttcaaa
6961 cacatcttag ccactatgtt cttaacatag attggttgtg gtttgcattc gagactggtt
7021 tggcatacat gctctatacc tcggccttca actggttgtt gttggcaggt acattgcatt
7081 atttctttgc acagacttcc atatttgtag actggcggtc atacaattat gctgtgtcta
7141 gtgccttctg gttatttacc cacattccaa tggcgggttt ggtacgaatg tataatttgt
7201 tagcatgcct ttggctttta cgcaagtttt atcagcatgt aatcaatggt tgcaaagata
7261 cggcatgctt gctctgctat aagaggaacc gacttactag agttgaagct tctaccgttg
7321 tctgtggtgg aaaacgtacg ttttatatca cagcaaatgg cggtatttca ttctgtcgta
7381 ggcataattg gaattgtgtg gattgtgaca ttgcaggtgt ggggaatacc ttcatctgtg
7441 aagaagtcgc aaatgacctc actaccgccc tacgcaggcc tattaacgct acggatagat
7501 cacattatta tgtggattcc gttacagtta aagagactgt tgttcagttt aattatcgta
7561 gagacggtca accattctac gagcggtttc ccctctgcgc ttttacaaat ctagataagt
7621 tgaagttcaa agaggtctgt aaaactacta ctggtatacc tgaatacaac tttatcatct
7681 acgactcatc agatcgtggc caggaaagtt tagctaggtc tgcatgtgtt tattattctc
7741 aagtcttgtg taaatcaatt cttttggttg actcaagttt ggttacttct gttggtgatt
7801 ctagtgaaat cgccactaaa atgtttgatt cctttgttaa tagtttcgtc tcgctgtata
7861 atgtcacacg cgataagttg gaaaaactta tctctactgc tcgtgatggc gtaaggcgag
7921 gcgataactt ccatagtgtc ttaacaacat tcattgacgc agcacgaggc cccgcaggtg
7981 tggagtctga tgttgagacc aatgaaattg ttgactctgt gcagtatgct cataaacatg
8041 acatacaaat tactaatgag agttacaata attatgtacc ctcatatgtt aaacctgata
8101 gtgtgtctac cagtgattta ggtagtctca ttgattgtaa tgcggcttca gttaaccaaa
8161 ttgtcttgcg taattctaat ggtgcttgta tttggaacgc tgctgcatat atgaaactct
8221 cggatgcact taaacgacag attcgcattg catgccgtaa gtgtaattta gctttccggt
8281 taaccacctc aaagctacgc gctaatgata atatcttatc agttagattc actgctaaca
8341 aaattgttgg tggtgctcct acatggttta atgtgttgcg tgactttacg ttaaagggtt
8401 acgttcttgc taccattatt gtgtttctgt gtgctgtact gatgtatttg tgtttaccta
8461 cattttctat ggtacctgtt gaattttatg aagaccgcat cttggacttt aaagttcttg
8521 ataatggtat cattagggat gtaaatcctg atgataagtg ctttgctaat aagcaccggt
8581 ccttcacaca atggtatcat gagcatgttg gtggtgtcta tgacaactct atcacatgcc
8641 cattgacagt tgcagtaatt gctggagttg ctggtgctcg cattccagac gtacctacta
8701 cattggcttg ggtgaacaat cagataattt tctttgtttc tcgagtcttt gctaatacag
8761 gcagtgtttg ctacactcct atagatgaga taccctataa gagtttctct gatagtggtt
8821 gcattcttcc atctgagtgc actatgttta gggatgcaga gggccgtatg acaccatact
8881 gccatgatcc tactgttttg cctggggctt ttgcgtacag tcagatgagg cctcatgttc
8941 gttacgactt gtatgatggt aacatgttta ttaaatttcc tgaagtagta tttgaaagta
9001 cacttaggat tactagaact ctgtcaactc agtactgccg gttcggtagt tgtgagtatg
9061 cacaagaggg tgtttgtatt accacaaatg gctcgtgggc catttttaat gaccaccatc
9121 ttaatagacc tggtgtctat tgtggctctg attttattga cattgtcagg cggttagcag
9181 tatcactgtt ccagcctatt acttatttcc aattgactac ctcattggtc ttgggtatag
9241 gtttgtgtgc attcctgact ttgctcttct attatattaa taaagtaaaa cgtgcttttg
9301 cagattacac ccagtgtgct gtaattgctg ttgttgctgc tgttcttaat agcttgtgca
9361 tctgctttgt tgcctctata ccattgtgta tagtacctta cactgcattg tactattatg
9421 ctacattcta ttttactaat gagcctgcat ttattatgca tgtttcttgg tacattatgt
9481 tcgggcctat cgttcccata tggatgacct gcgtctatac agttgcaatg tgctttagac
9541 acttcttctg ggttttagct tattttagta agaaacatgt agaagttttt actgatggta
9601 agcttaattg tagtttccag gacgctgcct ctaatatctt tgttattaac aaggacactt
9661 atgcagctct tagaaactct ttaactaatg atgcctattc acgatttttg gggttgttta
9721 acaagtataa gtacttctct ggtgctatgg aaacagccgc ttatcgtgaa gctgcagcat
9781 gtcatcttgc taaagcctta caaacataca gtgagactgg tagtgatctt ctttaccaac
9841 cacccaactg tagcataacc tctggcgtgt tgcaaagcgg tttggtgaaa atgtcacatc
9901 ccagtggaga tgttgaggct tgtatggttc aggttacctg cggtagcatg actcttaatg
9961 gtctttggct tgacaacaca gtctggtgcc cacgacacgt aatgtgcccg gctgaccagt
10021 tgtctgatcc taattatgat gccttgttga tttctatgac taatcatagt ttcagtgtgc
10081 aaaaacacat tggcgctcca gcaaacttgc gtgttgttgg tcatgccatg caaggcactc
10141 ttttgaagtt gactgtcgat gttgctaacc ctagcactcc agcctacact tttacaacag
10201 tgaaacctgg cgcagcattt agtgtgttag catgctataa tggtcgtccg actggtacat
10261 tcactgttgt aatgcgccct aactacacaa ttaagggttc ctttctgtgt ggttcttgtg
10321 gtagtgttgg ttacaccaag gagggtagtg tgatcaattt ttgttacatg catcaaatgg
10381 aacttgctaa tggtacacat accggttcag catttgatgg tactatgtat ggtgccttta
10441 tggataaaca agtgcaccaa gttcagttaa cagacaaata ctgcagtgtt aatgtagtag
10501 cttggcttta cgcagcaata cttaatggtt gcgcttggtt tgtaaaacct aatcgcacta
10561 gtgttgtttc ttttaatgaa tgggctcttg ccaaccaatt cactgaattt gttggcactc
10621 aatccgttga catgttagct gtcaaaacag gcgttgctat tgaacagctg ctttatgcga
10681 tccaacaact ttatactggg ttccagggaa agcaaatcct tggcagtact atgttggaag
10741 atgaattcac acctgaggat gttaatatgc agattatggg tgtggttatg cagagtggtg
10801 tgagaaaagt tacatatggt actgcgcatt ggttgttcgc gacccttgtt tcaacctatg
10861 tgataatctt acaagccact aaatttactt tgtggaacta cttgtttgag actattccca
10921 cacagttgtt cccactctta tttgtgacta tggccttcgt tatgttgttg gttaaacaca
10981 aacacacctt tttgacactt ttcttgttgc ctgtggctat ttgtttgact tatgcaaaca
11041 tagtctacga gcccactact cccatttcgt cagcgctgat tgcagttgca aattggcttg
11101 cccccactaa tgcttatatg cgcactacac atactgatat tggtgtctac attagtatgt
11161 cacttgtatt agtcattgta gtgaagagat tgtacaaccc atcactttct aactttgcgt
11221 tagcattgtg cagtggtgta atgtggttgt acacttatag cattggagaa gcctcaagcc
11281 ccattgccta tctggttttt gtcactacac tcactagtga ttatacgatt acagtctttg
11341 ttactgtcaa ccttgcaaaa gtttgcactt atgccatctt tgcttactca ccacagctta
11401 cacttgtgtt tccggaagtg aagatgatac ttttattata cacatgttta ggtttcatgt
11461 gtacttgcta ttttggtgtc ttctcttttt tgaaccttaa gcttagagca cctatgggtg
11521 tctatgactt taaggtctca acacaagagt tcagattcat gactgctaac aatctaactg
11581 cacctagaaa ttcttgggag gctatggctc tgaactttaa gttaataggt attggcggta
11641 caccttgtat aaaggttgct gctatgcagt ctaaacttac agatcttaaa tgcacatctg
11701 tggttctcct ctctgtgctc caacagttac acttagaggc taatagtagg gcctgggctt
11761 tctgtgttaa atgccataat gacatattgg cagcaacaga ccccagtgag gctttcgaga
11821 aattcgtaag tctctttgcc actttaatga ctttttctgg taatgtagat cttgatgcgt
11881 tagctagtga tatttttgac actcctagcg tacttcaagc tactctttct gagttttcac
11941 acttagctac ctttgctgag ttggaagctg cgcagaaagc ctatcaggaa gctatggact
12001 ctggtgacac ctcaccacaa gttcttaagg ctttgcagaa ggctgttaat atagctaaaa
12061 acgcctatga gaaggataag gcagtggccc gtaagttaga acgtatggct gatcaggcta
12121 tgacttctat gtataagcaa gcacgtgctg aagacaagaa agcaaaaatt gtcagtgcta
12181 tgcaaactat gttgtttggt atgattaaga agctcgacaa cgatgttctt aatggtatca
12241 tttctaacgc taggaatggt tgtatacctc ttagtgtcat tccactgtgt gcttcaaata
12301 aacttcgcgt tgtaattcct gacttcaccg tctggaatca ggtagtcaca tatccctcgc
12361 ttaactacgc tggggctttg tgggacatta cagttataaa caatgtggac aatgaaattg
12421 ttaagtcttc agatgttgta gacagcaatg aaaatttaac atggccactt gttttagaat
12481 gcactagggc atccacttct gccgttaagt tgcaaaataa tgagatcaaa ccttcaggtt
12541 taaaaaccat ggttgtgtct gcaggtcaag agcaaactaa ctgtaatact agttccttag
12601 cttattacga acctgtgcag ggtcgtaaaa tgctgatggc tcttctttct gataatgcct
12661 atctcaaatg ggcgcgtgtt gaaggtaagg acggatttgt tagtgtagag ctacaacctc
12721 cttgcaaatt cttgattgcg ggaccaaaag gacctgaaat ccgatatctc tattttgtta
12781 aaaatcttaa caaccttcat cgcgggcaag tgttagggca cattgctgcg actgttagat
12841 tgcaagctgg ttctaacacc gagtttgcct ctaattcttc ggtgttgtca cttgttaact
12901 tcaccgttga tcctcaaaaa gcttatctcg atttcgtcaa tgcgggaggt gccccattga
12961 caaattgtgt taagatgctt actcctaaaa ctggtacagg tatagctata tctgttaaac
13021 cagagagtac agctgatcaa gagacttatg gtggagcttc agtgtgtctc tattgccgtg
13081 cgcatataga acatcctgat gtctctggtg tttgtaaata taagggtaag tttgtccaaa
13141 tccctgctca gtgtgtccgt gaccctgtgg gattttgttt gtcaaatacc ccctgtaatg
13201 tctgtcaata ttggattgga tatgggtgca attgtgactc gcttaggcaa gtagcactgc
13261 cccaatctaa agattccaat tttttaaacg agtccggggt tctattgtaa atgcccgaat
13321 agaaccctgt tcaagtggtt tgtccactga tgtcgtcttt agggcatttg acatctgcaa
13381 ctataaggct aaggttgctg gtattggaaa atactacaag actaatactt gtaggtttgt
13441 agaattagat gaccaagggc atcatttaga ctcctatttt gtcgttaaga ggcatactat
13501 ggagaattat gaactagaga agcactgtta cgatttgtta cgtgactgtg atgctgtagc
13561 tccccatgat ttcttcatct ttgatgtaga caaagttaaa acacctcata ttgtacgtca
13621 gcgtttaact gagtacacta tgatggatct tgtatatgcc ctgaggcact ttgatcaaaa
13681 tagcgaagtg cttaaggcta tcttagtgaa gtatggttgc tgtgatgtta cctactttga
13741 aaataaactc tggtttgatt ttgttgaaaa tcccagtgtt attggtgttt atcataaact
13801 tggagaacgt gtacgccaag ctatcttaaa cactgttaaa ttttgtgacc acatggtcaa
13861 ggctggttta gtcggtgtgc tcacactaga caaccaggac cttaatggca agtggtatga
13921 ttttggtgac ttcgtaatca ctcaacctgg ttcaggagta gctatagttg atagctacta
13981 ttcttatttg atgcctgtgc tctcaatgac cgattgtctg gccgctgaga cacataggga
14041 ttgtgatttt aataaaccac tcattgagtg gccacttact gagtatgatt ttactgatta
14101 taaggtacaa ctctttgaga agtactttaa atattgggat cagacgtatc acgcaaattg
14161 cgttaattgt actgatgacc gttgtgtgtt acattgtgct aatttcaatg tattgtttgc
14221 tatgaccatg cctaagactt gtttcggacc catagtccga aagatctttg ttgatggcgt
14281 gccatttgta gtatcttgtg gttatcacta caaagaatta ggtttagtca tgaatatgga
14341 tgttagtctc catagacata ggctctctct taaggagttg atgatgtatg ccgctgatcc
14401 agccatgcac attgcctcct ctaacgcttt tcttgatttg aggacatcat gttttagtgt
14461 cgctgcactt acaactggtt tgacttttca aactgtgcgg cctggcaatt ttaaccaaga
14521 cttctatgat ttcgtggtat ctaaaggttt ctttaaggag ggctcttcag ttacgctcaa
14581 acattttttc tttgctcaag atggtaatgc tgctattaca gattataatt actattctta
14641 taatctgcct actatgtgtg acatcaaaca aatgttgttc tgcatggaag ttgtaaacaa
14701 gtacttcgaa atctatgacg gtggttgtct taatgcttct gaagtggttg ttaataattt
14761 agacaagagt gctggccatc cttttaataa gtttggcaaa gctcgtgtct attatgagag
14821 catgtcttac caggagcaag atgaactctt tgccatgaca aagcgtaacg tcattcctac
14881 catgactcaa atgaatctaa aatatgctat tagtgctaag aatagagctc gcactgttgc
14941 aggcgtgtcc atacttagca caatgactaa tcgccagtac catcagaaaa tgcttaagtc
15001 catggctgca actcgtggag cgacttgcgt cattggtact acaaagttct atggtggctg
15061 ggatttcatg cttaaaacat tgtacaaaga tgttgataat ccgcatctta tgggttggga
15121 ttaccctaag tgtgatagag ctatgcctaa tatgtgtaga atcttcgctt cactcatatt
15181 agctcgtaaa catggcactt gttgtactac aagggacaga ttttatcgct tggcaaatga
15241 gtgtgctcag gtgctaagcg aatatgttct atgtggtggt ggttactacg tcaaacctgg
15301 aggtaccagt agcggagatg ccaccactgc atatgccaat agtgtcttta acattttgca
15361 ggcgacaact gctaatgtca gtgcacttat gggtgctaat ggcaacaaga ttgttgacaa
15421 agaagttaaa gacatgcagt ttgatttgta tgtcaatgtt tacaggagca ctagcccaga
15481 ccccaaattt gttgataaat actatgcttt tcttaataag cacttttcta tgatgatact
15541 gtctgatgac ggtgtcgttt gctataatag tgattatgca gctaagggtt acattgctgg
15601 aatacagaat tttaaggaaa cgctgtatta tcagaacaat gtctttatgt ctgaagctaa
15661 atgctgggtg gaaaccgatc tgaagaaagg gccacatgaa ttctgttcac agcatacgct
15721 ttatattaag gatggcgacg atggttactt ccttccttat ccagaccctt caagaatttt
15781 gtctgccggt tgctttgtag atgatatcgt taagactgac ggtacactca tggtagagcg
15841 gtttgtgtct ttggctatag atgcttaccc tctcacaaag catgaagata tagaatacca
15901 gaatgtattc tgggtctact tacagtatat agaaaaactg tataaagacc ttacaggaca
15961 catgcttgac agttattctg tcatgctatg tggtgataat tctgctaagt tttgggaaga
16021 ggcattctac agagatctct atagttcgcc taccactttg caggctgtcg gttcatgcgt
16081 tgtatgccat tcacagactt ccctacgctg tgggacatgc atccgtagac catttctctg
16141 ctgtaaatgc tgctatgatc atgttatagc aactccacat aagatggttt tgtctgtttc
16201 tccttacgtt tgtaatgccc ctggttgtgg cgtttcagac gttactaagc tatatttagg
16261 tggtatgagc tacttttgtg tagatcatag acctgtgtgt agttttccac tttgcgctaa
16321 tggtcttgta ttcggcttat acaagaatat gtgcacaggt agtccttcta tagttgaatt
16381 taataggttg gctacctgtg actggactga aagtggtgat tacacccttg ccaatactac
16441 aacagaacca ctcaaacttt ttgctgctga gactttacgt gccactgaag aggcgtctaa
16501 gcagtcttat gctattgcca ccatcaaaga aattgttggt gagcgccaac tattacttgt
16561 gtgggaggct ggcaagtcca aaccaccact caatcgtaat tatgttttta ctggttatca
16621 tataaccaaa aatagtaaag tgcagctcgg tgagtacatc ttcgagcgca ttgattatag
16681 tgatgctgta tcctacaagt ctagtacaac gtataaactg actgtaggtg acatcttcgt
16741 acttacctct cactctgtgg ctaccttgac ggcgcccaca attgtgaatc aagagaggta
16801 tgttaaaatt actgggttgt acccaaccat tacggtacct gaagagttcg caagtcatgt
16861 tgccaacttc caaaaatcag gttatagtaa atatgtcact gttcagggac cacctggcac
16921 tggcaaaagt cattttgcta tagggttagc gatttactac cctacagcac gtgttgttta
16981 tacagcatgt tcacacgcag ctgttgatgc tttgtgtgaa aaagctttta aatatttgaa
17041 cattgctaaa tgttcccgta tcattcctgc aaaggcacgt gttgagtgct atgacaggtt
17101 taaagttaat gagacaaatt ctcaatattt gtttagtact attaatgctc taccagaaac
17161 ttctgccgat attctggtgg ttgatgaggt tagtatgtgc actaattatg atctttcaat
17221 tattaatgca cgtattaaag ctaagcacat tgtctatgta ggagatccag cacagttgcc
17281 agctcctagg actttgttga ctagaggcac attggaacca gaaaatttca atagtgtcac
17341 tagattgatg tgtaacttag gtcctgacat atttttaagt atgtgctaca ggtgtcctaa
17401 ggaaatagta agcactgtga gcgctcttgt ctacaataat aaattgttag ccaagaagga
17461 gctttcaggc cagtgcttta aaatactcta taagggcaat gtgacgcatg atgctagctc
17521 tgccattaat agaccacaac tcacatttgt gaagaatttt attactgcca atccggcatg
17581 gagtaaggca gtctttattt cgccttataa ttcacagaat gctgtggctc gttcaatgct
17641 gggtcttact actcagactg ttgattcctc acagggttca gaataccagt acgttatctt
17701 ctgtcaaaca gcagatacgg cacatgctaa caacattaac agatttaatg ttgcaatcac
17761 tcgtgcccaa aaaggtattc tttgtgttat gacatctcag gcactctttg agtccttaga
17821 gtttactgaa ttgtctttta ctaattacaa gctccagtct cagattgtaa ctggcctttt
17881 taaagattgc tctagagaaa cttctggcct ctcacctgct tatgcaccaa catacgttag
17941 tgttgatgac aagtataaga cgagtgatga gctttgcgtg aatcttaatt tacccgcaaa
18001 tatcccatac tctcgtgtta tttccaggat gggctttaaa ctcgatgcaa cagttcctgg
18061 atatcctaag cttttcatta ctcgtgaaga ggctgtaagg caagttcgaa gctggatagg
18121 cttcgatgtt gagggtgctc atgcttcccg taatgcatgt ggcaccaatg tgcctctaca
18181 attaggattt tcaactggtg tgaactttgt tgttcagcca gttggtgttg tagacactga
18241 gtggggtaac atgttaacgg gcattgctgc ccgtcctcca ccaggtgaac agtttaagca
18301 cctcgtgcct cttatgcata agggggctgc gtggcctatt gttagacgac gtatagtgca
18361 aatgttgtca gacactttag acaaattgtc tgattactgt acgtttgttt gttgggctca
18421 tggctttgaa ttaacgtctg catcatactt ttgcaagata ggtaaggaac agaagtgttg
18481 catgtgcaat agacgcgctg cagcgtactc ttcacctctg caatcttatg cctgctggac
18541 tcattcctgc ggttatgatt atgtctacaa ccctttcttt gtcgatgttc aacagtgggg
18601 ttatgtaggc aatcttgcta ctaatcacga tcgttattgc tctgtccatc aaggagctca
18661 tgtggcttct aatgatgcaa taatgactcg ttgtttagct attcattctt gttttataga
18721 acgtgtggat tgggatatag agtatcctta tatctcacat gaaaagaaat tgaattcctg
18781 ttgtagaatc gttgagcgca acgtcgtacg tgctgctctt cttgccggtt catttgacaa
18841 agtctatgat attggcaatc ctaaaggaat tcctattgtt gatgaccctg tggttgattg
18901 gcattatttt gatgcacagc ccttgaccag aaaggtacaa cagcttttct atacagagga
18961 catggcctca agatttgctg atgggctctg cttattttgg aactgtaatg taccaaaata
19021 tcctaataat gcaattgtat gcaggtttga cacacgtgtg cattctgagt tcaatttgcc
19081 aggttgtgat ggcggtagtt tgtatgttaa caagcacgct tttcatacac cagcatatga
19141 tgtgagtgca ttccgtgatc tgaaaccttt accattcttt tattattcta ctacaccatg
19201 tgaagtgcat ggtaatggta gtatgataga ggatattgat tatgtacccc taaaatctgc
19261 agtctgtatt acagcttgta atttaggggg cgctgtttgt aggaagcatg ctacagagta
19321 cagagagtat atggaagcat ataatcttgt ctctgcatca ggtttccgcc tttggtgtta
19381 taagaccttt gatatttata atctctggtc tacttttaca aaagttcaag gtttggaaaa
19441 cattgctttt aatgttgtta aacaaggcca ttttattggt gttgagggtg aactacctgt
19501 agctgtagtc aatgataaga tcttcaccaa gagtggcgtt aatgacattt gtatgtttga
19561 gaataaaacc actttgccta ctaatatagc ttttgaactc tatgctaagc gtgctgtacg
19621 ctcgcatccc gatttcaaat tgctacacaa tttacaagca gacatttgct acaagttcgt
19681 cctttgggat tatgaacgta gcaatattta tggtactgct actattggtg tatgtaagta
19741 cactgatatt gatgttaatt cagctttgaa tatatgtttt gacatacgcg ataatggttc
19801 attggagaag ttcatgtcta ctcccaatgc catctttatt tctgatagaa aaattaagaa
19861 atacccttgt attgtaggtc ctgattatgc ttacttcaat ggtgctatca tccgtgatag
19921 tgatgttgtt aaacaaccag tgaagttcta cttgtataag aaagtcaata atgagtttat
19981 tgatcctact gagtgtattt acactcagag tcgctcttgt agtgacttcc tacccctgtc
20041 tgacatggag aaagactttc tatcttttga tagtgatgtt ttcattaaga agtatggctt
20101 ggaaaactat gcttttgagc acgtagtcta tggagacttc tctcatacta cgttaggcgg
20161 tcttcacttg cttattggtt tatacaagaa gcaacaggaa ggtcatatta ttatggaaga
20221 aatgctaaaa ggtagctcaa ctattcataa ctattttatt actgagacta acacagcggc
20281 ttttaaggcg gtgtgttctg ttatagattt aaagcttgac gactttgtta tgattttaaa
20341 gagtcaagac cttggcgtag tatccaaggt tgtcaaggtt cctattgact taacaatgat
20401 tgagtttatg ttatggtgta aggatggaca ggttcaaacc ttctaccctc gactccaggc
20461 ttctgcagat tggaaacctg gtcatgcaat gccatccctc tttaaagttc aaaatgtaaa
20521 ccttgaacgt tgtgagcttg ctaattacaa gcaatctatt cctatgcctc gcggtgtgca
20581 catgaacatc gctaaatata tgcaattgtg ccagtattta aatacttgca cattagccgt
20641 gcctgccaat atgcgtgtta tacattttgg cgctggttct gataaaggta tcgctcctgg
20701 tacatcagtt ttacgacagt ggcttcctac agatgccatt attatagata atgatttaaa
20761 tgagttcgtg tcagatgctg acataacttt atttggagat tgtgtaactg tacgtgtcag
20821 ccaacaagtg gatcttgtta tttccgacat gtatgatcct actactaaga atgtaacagg
20881 tagtaatgag tcaaaggctt tattctttac ttacctgtgt aacctcatta ataataatct
20941 tgctcttggt gggtctgttg ctattaaaat aacagaacac tcttggagcg ttgaacttta
21001 tgaacttatg ggaaaatttg cttggtggac tgttttctgc accaatgcaa atgcatcctc
21061 atctgaagga ttcctcttag gtattaatta cttgggtact attaaagaaa atatagatgg
21121 tggtgctatg cacgccaact atatattttg gagaaattcc actcctatga atctgagtac
21181 ttactcactt tttgatttat ccaagtttca attaaaatta aaaggaacac cagttcttca
21241 attaaaggag agtcaaatta acgaactcgt aatatctctc ctgtcgcagg gtaagttact
21301 tatccgtgac aatgatacac tcagtgtttc tactgatgtt cttgttaaca cctacagaaa
21361 gttacgttga tgtagggcca gattctgtta agtctgcttg tattgaggtt gatatacaac
21421 agactttctt tgataaaact tggcctaggc caattgatgt ttctaaggct gacggtatta
21481 tataccctca aggccgtaca tattctaaca taactatcac ttatcaaggt ctttttccct
21541 atcagggaga ccatggtgat atgtatgtct actctgcagg acatgctaca ggcacaactc
21601 cacaaaagtt gtttgtagct aactattctc aggacgtcaa acagtttgct aatgggtttg
21661 tcgtccgtat aggagcagct gccaattcca ctggcactgt tattattagc ccatctacca
21721 gcgctactat acgaaaaatt taccctgctt ttatgctggg ttcttcagtt ggtaatttct
21781 cagatggtaa aatgggccgc ttcttcaatc atactctagt tcttttgccc gatggatgtg
21841 gcactttact tagagctttt tattgtattc tagagcctcg ctctggaaat cattgtcctg
21901 ctggcaattc ctatacttct tttgccactt atcacactcc tgcaacagat tgttctgatg
21961 gcaattacaa tcgtaatgcc agtctgaact cttttaagga gtattttaat ttacgtaact
22021 gcacctttat gtacacttat aacattaccg aagatgagat tttagagtgg tttggcatta
22081 cacaaactgc tcaaggtgtt cacctcttct catctcggta tgttgatttg tacggcggca
22141 atatgtttca atttgccacc ttgcctgttt atgatactat taagtattat tctatcattc
22201 ctcacagtat tcgttctatc caaagtgata gaaaagcttg ggctgccttc tacgtatata
22261 aacttcaacc gttaactttc ctgttggatt tttctgttga tggttatata cgcagagcta
22321 tagactgtgg ttttaatgat ttgtcacaac tccactgctc atatgaatcc ttcgatgttg
22381 aatctggagt ttattcagtt tcgtctttcg aagcaaaacc ttctggctca gttgtggaac
22441 aggctgaagg tgttgaatgt gatttttcac ctcttctgtc tggcacacct cctcaggttt
22501 ataatttcaa gcgtttggtt tttaccaatt gcaattataa tcttaccaaa ttgctttcac
22561 ttttttctgt gaatgatttt acttgtagtc aaatatctcc agcagcaatt gctagcaact
22621 gttattcttc actgattttg gattattttt catacccact tagtatgaaa tccgatctca
22681 gtgttagttc tgctggtcca atatcccagt ttaattataa acagtccttt tctaatccca
22741 catgtttgat tttagcgact gttcctcata accttactac tattactaag cctcttaagt
22801 acagctatat taacaagtgc tctcgtcttc tttctgatga tcgtactgaa gtacctcagt
22861 tagtgaacgc taatcaatac tcaccctgtg tatccattgt cccatccact gtgtgggaag
22921 acggtgatta ttataggaaa caactatctc cacttgaagg tggtggctgg cttgttgcta
22981 gtggctcaac tgttgccatg actgagcaat tacagatggg ctttggtatt acagttcaat
23041 atggtacaga caccaatagt gtttgcccca agcttgaatt tgctaatgac acaaaaattg
23101 cctctcaatt aggcaattgc gtggaatatt ccctctatgg tgtttcgggc cgtggtgtct
23161 ttcagaattg cacagctgta ggtgttcgac agcagcgctt tgtttatgat gcgtaccaga
23221 atttagttgg ctattattct gatgatggca actactactg tttgcgtgct tgtgttagtg
23281 ttcctgtttc tgtcatctat gataaagaaa ctaaaaccca cgctactcta tttggtagtg
23341 ttgcatgtga acacatttcc tctaccatgt ctcaatactc ccgttctacg cgatcaatgc
23401 ttaaacggcg agattctaca tatggtcccc ttcagacacc tgttggttgt gtcctaggac
23461 ttgttaattc ctctttgttc gtagaggact gcaagttgcc tcttggtcaa tctctctgtg
23521 ctcttcctga cacacctagt actctcacac ctcgcagtgt gcgctctgtt ccaggtgaaa
23581 tgcgcttggc atccattgct tttaatcatc ctattcaggt tgatcaactt aatagtagtt
23641 attttaaatt aagtatacct actaattttt cctttggtgt gactcaggag tacattcaga
23701 caaccattca gaaagttact gttgattgta aacagtacgt ttgcaatggt ttccagaagt
23761 gtgagcaatt actgcgcgag tatggccagt tttgttccaa aataaaccag gctctccatg
23821 gtgccaattt acgccaggat gattctgtac gtaatttgtt tgcgagcgtg aaaagctctc
23881 aatcatctcc tatcatacca ggttttggag gtgactttaa tttgacactt ctagaacctg
23941 tttctatatc tactggcagt cgtagtgcac gtagtgctat tgaggatttg ctatttgaca
24001 aagtcactat agctgatcct ggttatatgc aaggttacga tgattgtatg cagcaaggtc
24061 cagcatcagc tcgtgatctt atttgtgctc aatatgtggc tggttataaa gtattacctc
24121 ctcttatgga tgttaatatg gaagccgcgt acacttcatc tttgcttggc agcatagcag
24181 gtgttggctg gactgctggc ttatcctcct ttgctgctat tccatttgca cagagtattt
24241 tttataggtt aaacggtgtt ggcattactc aacaggttct ttcagagaac caaaagctta
24301 ttgccaataa gtttaatcag gctctgggag ctatgcaaac aggcttcact acaactaatg
24361 aagcttttcg gaaggttcag gatgctgtga acaacaatgc acaggctcta tccaaattag
24421 ctagcgagct atctaatact tttggtgcta tttccgcctc tattggagac atcatacaac
24481 gtcttgacgt tctcgaacag gacgcccaaa tagacagact tattaatggc cgtttgacaa
24541 cactaaatgc ttttgttgca cagcagcttg ttcgttctga atcagctgct ctttccgctc
24601 aattggctaa agataaagtc aatgagtgtg tcaaggcaca atccaagcgt tctggatttt
24661 gcggtcaagg cacacatata gtgtcctttg ttgtaaatgc ccctaatggc ctttacttta
24721 tgcatgttgg ttattaccct agcaaccaca ttgaggttgt ttctgcttat ggtctttgcg
24781 atgcagctaa ccctactaat tgtatagccc ctgttaatgg ctactttatt aaaactaata
24841 acactaggat tgttgatgag tggtcatata ctggctcgtc cttctatgca cctgagccca
24901 tcacctctct taatactaag tatgttgcac cacaggtgac ataccaaaac atttctacta
24961 acctccctcc tcctcttctc ggcaattcca ccgggattga cttccaagat gagttggatg
25021 agtttttcaa aaatgttagc accagtatac ctaattttgg ttctctaaca cagattaata
25081 ctacattact cgatcttacc tacgagatgt tgtctcttca acaagttgtt aaagccctta
25141 atgagtctta catagacctt aaagagcttg gcaattatac ttattacaac aaatggccgt
25201 ggtacatttg gcttggtttc attgctgggc ttgttgcctt agctctatgc gtcttcttca
25261 tactgtgctg cactggttgt ggcacaaact gtatgggaaa acttaagtgt aatcgttgtt
25321 gtgatagata cgaggaatac gacctcgagc cgcataaggt tcatgttcac taattaacga
25381 actatcaatg agagttcaaa gaccacccac tctcttgtta gtgttctcac tctctttttt
25441 ggtcactgca ttttcaaaac ctctctatgt acctgagcat tgtcagaatt attctggttg
25501 catgcttagg gcttgtatta aaactgccca agctgataca gctggtcttt atacaaattt
25561 tcgaattgat gtcccatctg cagaatcaac tggtactcaa tcagtttctg tcgatcgtga
25621 gtctacttca actcatgatg gtcttaccga acatgttact agtgtgaatc tttttgacgt
25681 tggttactca gttaattaac gaactctatg gattacgtgt ctctgcttaa tcaaatttgg
25741 cagaagtacc ttaattcacc gtatactact tgtttgtata tccctaaacc cacagctaag
25801 tatacacctt tagttggcac ttcattgcac cctgtgctgt ggaactgtca gctatccttt
25861 gctggttata ctgaatctgc tgttaattct acaaaagctt tggccaaaca ggacgcagct
25921 cagcgaatcg cttggttgct acataaggat ggaggaatcc ctgacggatg ttccctctac
25981 ctccggcact caagtttatt cgcgcaaagc gaggaagagg agtcattctc caactaagaa
26041 actgcgctac gttaagcgta gattttctct tctgcgccct gaagacctta gtgttattgt
26101 ccaaccaaca cactatgtca gggttacatt ttcagacccc aacatgtggt atctacgttc
26161 gggtcatcat ttacactcag ttcacaattg gcttaaacct tatggcggcc aacctgtttc
26221 tgagtaccat attactctag ctttgctaaa tctcactgat gaagatttag ctagagattt
26281 ttcacccatt gcgctctttt tgcgcaatgt cagatttgag ctacatgagt tcgccttgct
26341 gcgcaaaact cttgttctta atgcatcaga gatctactgt gctaacatac atagatttaa
26401 gcctgtgtat agagttaaca cggcaatccc tactattaag gattggcttc tcgttcaggg
26461 attttccctt taccatagtg gcctcccttt acatatgtca atctctaaat tgcatgcact
26521 ggatgatgtt actcgcaatt acatcattac aatgccatgc tttagaactt atcctcaaca
26581 aatgtttgtt actcctttgg ccgtagatgt tgtctccata cggtcttcca atcagggtaa
26641 taaacaaatt gttcattctt accccatttt acatcatcca ggattttaac gaactatggc
26701 tttctcggcg tctttattta aacccgtcca gctagtccca gtttctcctg catttcatcg
26761 cattgagtct actgactcta ttgttttcac atacattcct gctagcggct atgtagctgc
26821 tttagctgtc aatgtgtgtc tcattcccct attattactg ctacgtcaag atacttgtcg
26881 tcgcagcatt atcagaacta tggttctcta tttccttgtt ctttataact ttttattagc
26941 cattgtacta gtcaatggtg tacattatcc aactggaagt tgcctgatag ccttcttagt
27001 tatcctcata atactttggt ttgtagatag aattcgtttc tgtctcatgc tgaattccta
27061 cattccactg tttgacatgc gttctcactt tattcgtgtt agtacagttt cttctcatgg
27121 ctttccttac ggctactaga ttatgtgtgc aatgtatgac aggcttcaat accctgttag
27181 ttcagcccgc attatacttg tataatactg gacgttcagt ctatgtaaaa ttccaggata
27241 gtaaaccccc tctaccacct gacgagtggg tttaacgaac tccttcataa tgtctaatat
27301 gacgcaactc actgaggcgc agattattgc cattattaaa gactggaact ttgcatggtc
27361 cctgatcttt ctcttaatta ctatcgtact acagtatgga tacccatccc gtagtatgac
27421 tgtctatgtc tttaaaatgt ttgttttatg gctcctatgg ccatcttcca tggcgctatc
27481 aatatttagc gccatttatc caattgatct agcttcccag ataatctctg gcattgtagc
27541 agctgtttca gctatgatgt ggatttccta ctttgtgcag agtatccggc tgtttatgag
27601 aactggatca tggtggtcat tcaatcctga gactaattgc cttttgaatg ttccaattgg
27661 tggtacaact gtcgtacgtc cactcgtaga ggactctacc agtgtaactg ctgttgtaac
27721 caatggtcac ctcaaaatgg ctggcatgca tttcggtgct tgtgactacg acagacttcc
27781 taatgaagtc accgtggcca aacccaatgt gctgattgct ttaaaaatgg tgaagcggca
27841 aagctacgga actaattccg gcgttgccat ttaccataga tataaggcag gtaattacag
27901 gagtccgcct attacggcgg atattgaact tgcattgctt cgagcttagg ctctttagta
27961 agagtatctt aattgatttt aacgaatctc aatttcattg ttatggcatc ccctgctgca
28021 cctcgtgctg tttcctttgc cgataacaat gatataacaa atacaaacct gtctcgaggt
28081 agaggacgta atccaaaacc acgagctgca ccaaataaca ctgtctcttg gtacactggg
28141 cttacccaac acgggaaagt ccctcttacc tttccacctg ggcagggtgt acctcttaat
28201 gccaattcca cccctgcgca aaatgctggg tattggcgga gacaggacag aaaaattaat
28261 accgggaatg gaattaagca actggctccc aggtggtact tctactacac tggaactgga
28321 cccgaagcag cactcccatt ccgggctgtt aaggatggca tcgtttgggt ccatgaagat
28381 ggcgccactg atgctccttc aacttttggg acgcggaacc ctaacaatga ttcagctatt
28441 gttacacaat tcgcgcccgg tactaagctt cctaaaaact tccacattga ggggactgga
28501 ggcaatagtc aatcatcttc aagagcctct agcgtaagca gaaactcttc cagatctagt
28561 tcacaaggtt caagatcagg aaactctacc cgcggcactt ctccaggtcc atctggaatc
28621 ggagcagtag gaggtgatct actttacctt gatcttctga acagactaca agcccttgag
28681 tctggcaaag taaagcaatc gcagccaaaa gtaatcacta agaaagatgc tgctgctgct
28741 aaaaataaga tgcgccacaa gcgcacttcc accaaaagtt tcaacatggt gcaagctttt
28801 ggtcttcgcg gaccaggaga cctccaggga aactttggtg atcttcaatt gaataaactc
28861 ggcactgagg acccacgttg gccccaaatt gctgagcttg ctcctacagc cagtgctttt
28921 atgggtatgt cgcaatttaa acttacccat cagaacaatg atgatcatgg caaccctgtg
28981 tacttccttc ggtacagtgg agccattaaa cttgacccaa agaatcccaa ctacaataag
29041 tggttggagc ttcttgagca aaatattgat gcctacaaaa ccttccctaa gaaggaaaag
29101 aaacaaaagg caccaaaaga agaatcaaca gaccaaatgt ctgaacctcc aaaggagcag
29161 cgtgtgcaag gtagcatcac tcagcgcact cgcacccgtc caagtgttca gcctggtcca
29221 atgattgatg ttaacactga ttagtgtcac tcaaagtaac aagatcgcgg caatcgtttg
29281 tgtttggtaa ccccatctca ccatcgcttg tccactcttg cacagaatgg aatcatgttg
29341 taattacagt gcaataaggt aattataacc catttaattg atagctatgc tttattaaag
29401 tgtgtagctg tagagagaat gttaaagact gtcacctctg cgtgattgca agtgaacagt
29461 gccccccggg aagagctcta cagtgtgaaa tgtaaataaa aatagctat

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Mon Jun 15, 2015 7:52 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
LOCUS KT036374 29514 bp RNA linear VRL 10-JUN-2015
DEFINITION Middle East respiratory syndrome coronavirus isolate ChinaGD01
variant 2, partial genome.
ACCESSION KT036374
VERSION KT036374.1 GI:829624521
KEYWORDS .
SOURCE Middle East respiratory syndrome coronavirus (MERS-CoV)
ORGANISM Middle East respiratory syndrome coronavirus
Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA
stage; Nidovirales; Coronaviridae; Coronavirinae; Betacoronavirus;
unclassified Betacoronavirus.
REFERENCE 1 (bases 1 to 29514)
AUTHORS Su,J., Wu,J., Zhang,B., Xie,Q., Zhao,W. and Ke,C.
TITLE Direct Submission
JOURNAL Submitted (09-JUN-2015) Key Laboratory for Repository and
Application of Pathogenic Microbiology, Research Center for
Pathogens Detection Technology of Emerging Infectious Diseases,
Guangdong Provincial Center for Disease Control and Prevention, 176
Xin Gang West Road, Guangzhou, Guangdong 510515, China
COMMENT ##Assembly-Data-START##
Assembly Method :: DNAstar v. 7.0
Sequencing Technology :: Sanger dideoxy sequencing
##Assembly-Data-END##
FEATURES Location/Qualifiers
source 1..29514
/organism="Middle East respiratory syndrome coronavirus"
/mol_type="genomic RNA"
/isolate="ChinaGD01 variant 2"
/host="Homo sapiens"
/db_xref="taxon:1335626"
/country="China"
/collection_date="28-May-2015"
CDS join(135..13289,13289..21370)
/ribosomal_slippage
/codon_start=1
/product="ORF1ab"
/protein_id="AKL80613.1"
/db_xref="GI:829624522"
/translation="MSFVAGVIAQGARGTYRAALNSEKHQDHVSLTVPLCGSGNLVEK
LSPWFMDGENAYEVVKAMLLKKEPLLYVPIRLAGHTRHLPGPRVYLVERLIACENPFM
VNQLAYSSSANGSLVGTTLQGKPIGMFFPYDIELVTGKQNILLRKYGRGGYHYTPVHY
ERDNTSCPEWMDDFEADPKGKYAQNLLKKLIGGDVTPVDQYMCGVDGKPISAYAFLMA
KDGITKLADVEADVAARADDEGFITLKNNLYRLVWHVERKDVPYPKQSIFTINSVVQK
DGVENTPPHYFTLGCKILTLTPRNKWSGVSDLSLKQKLLYTFYGKESLENPTYIYHSA
FIECGSCGNDSWLTGNAIQGFACGCGASYTANDVEVQSSGMIKPNALLCATCPFAKGD
SCSSNCKHSVAQLVSYLSERCNVIADSKSFTLIFGGVAYAYFGCEEGTMYFVPRAKSV
VSRIGDSIFTGCTGSWNKVTQIANMFLEQTQHSLNFVGEFVVNDVVLAILSGTTTNVD
KIRQLLKGVTIDKLRDYLADYDVAVTAGPFMDNAINVGGTGLQYAAITAPYVVLTGLG
ESFKKVATIPYKVCNSVKDTLTYYAHSVLYRVFPYDMDSGVSSFSELLFDCVDLSVAS
TYFLVRLLQDKTGDFMSTIITSCQTAVSKLLDTCFEATEATFNFLLDLAGLFRIFLRN
AYVYTSQGFVVVNGKVSTLVKQVLDLLNKGMQLLHTKVSWAGSNISAVIYSGRESLIF
PSGTYYCVTTKAKSVQQDLDVILPGEFSKKQLGLLQPTDNSTTVSVTVSSNMVETVVG
QLEQTNMHSPDVIVGDYVIISEKLFVRSKEEDGFAFYPACTNGHAVPTLFRLKGGAPV
KKVAFGGDQVHEVAAVRSVTVEYNIHAVLDTLLASSSLRTFVVDKSLSIEEFADVVKE
QVSDLLVKLLRGMPIPDFDLDDFIDAPCYCFNAEGDASWSSTMIFSLHPVECDEECSE
VEASGLEEGESECISETSTEQVDVSHEVSDDEWAAAVDEAFPLDEAEDVTESVQEEAQ
PVEVPVEDIAQVVIADTLQETPVVSDTVEVPPQVVKLPSEPQTIQPEVKEVAPVYEAD
TEQTQSVTVKPKRLRKKRNVDPLSNFEHKVITECVTIVLGDAIQVAKCYGESVLVNAA
NTHLKHGGGIAGAINAASKGAVQKESDEYILAKGPLQVGDSVLLQGHSLAKNILHVVG
PDARAKQDVSLLSKCYKAMNAYPLVVTPLVSTGIFGVKPAVSFDYLIREAKTRVLVVV
NSQDVYKSLTIVDIPQSLTFSYDGLRGAIRKAKDYGFTVFVCTDNSANTKVLRNKGVD
YTKKFLTVDGVQYYCYTSKDTLDDILQQANKSVGIISMPLGYVSHGLDLIQAGSVVRR
VNVPYVCLLANKEQEAILMSEDVKLNPSEDFIKHVRTNGGYNSWHLVEGELLVQDLRL
NKLLHWSDQTICYKDSVFYVVKNSTAFPFETLSACRAYLDSRTTQQLTIEVLVTVDGV
NFRTVVLNNKNTYRSQLGCVFFNGADISDTIPDEKQNGHSLYLADNLTADETKALKEL
YGPVDPTFLHRFYSLKAAVHKWKMVVCDKVRSLKLSDNNCYLNAVIMTLDLLKDIKFV
IPALQHAFMKHKGGDSTDFIALIMAYGNCTFGAPDDASRLLHTVLAKAELCCSARMVW
REWCNVCGIKDVVLQGLKACCYVGVQTVEDLRARMTYVCQCGGERHRQIVEHTTPWLL
LSGTPNEKLVTTSTAPDFVAFNVFQGIETAVGHYVHACLKGGLILKFDSGTVSKTSDW
KCKVTDVLFPGQKYSSDCNVVRYSLDGNFRTEVDPDLSAFYVKDGKYFISEPPVTYSP
ATILAGSVYTNSCLVSSDGQPGGDAISLSFNNLLGFDSSKPVTKKYTYSFLPKEDGDV
LLAEFDTYDPIYKNGAMYKGKPILWVNKASYDTNLNKFNRASLRQIFDVAPIELENKF
TPLSVASTPVEPPTVDVVALQQEMTIVKCKGLNKPFVKDNVSFVVDDSGTPVVEYLSK
EDLHTLYVDPKYQVIVLKDNVLSSMLRLHTVESGDINVVAASGSLTRKVKLLFRASFY
FKEFATRTFTATTAVGSCIKSVVRHLGVTKGILTGCFSFVKMLFILPLAYFSDSKLGT
TEVKVSALKTAGVVTGNVVKQCCTAAVDLSMDKLRRVDWKSTLRLLLMLCTTMVLLSS
VYHLYVFNQVLSSDVMFEDAQGLKKFYKEVRAYLGISSACDGLASAYRANSFDVPTFC
ANRSAMCNWCLISQDSITHYPALKMVQTHLSHYVLNIDWLWFAFETGLAYMLYTSAFN
WLLLAGTLHYFFAQTSIFVDWRSYNYAVSSAFWLFTHIPMAGLVRMYNLLACLWLLRK
FYQHVINGCKDTACLLCYKRNRLTRVEASTVVCGGKRTFYITANGGISFCRRHNWNCV
DCDIAGVGNTFICEEVANDLTTALRRPINATDRSHYYVDSVTVKETVVQFNYRRDGQP
FYERFPLCAFTNLDKLKFKEVCKTTTGIPEYNFIIYDSSDRGQESLARSACVYYSQVL
CKSILLVDSSLVTSVGDSSEIATKMFDSFVNSFVSLYNVTRDKLEKLISTARDGVRRG
DNFHSVLTTFIDAARGPAGVESDVETNEIVDSVQYAHKHDIQITNESYNNYVPSYVKP
DSVSTSDLGSLIDCNAASVNQIVLRNSNGACIWNAAAYMKLSDALKRQIRIACRKCNL
AFRLTTSKLRANDNILSVRFTANKIVGGAPTWFNVLRDFTLKGYVLATIIVFLCAVLM
YLCLPTFSMVPVEFYEDRILDFKVLDNGIIRDVNPDDKCFANKHRSFTQWYHEHVGGV
YDNSITCPLTVAVIAGVAGARIPDVPTTLAWVNNQIIFFVSRVFANTGSVCYTPIDEI
PYKSFSDSGCILPSECTMFRDAEGRMTPYCHDPTVLPGAFAYSQMRPHVRYDLYDGNM
FIKFPEVVFESTLRITRTLSTQYCRFGSCEYAQEGVCITTNGSWAIFNDHHLNRPGVY
CGSDFIDIVRRLAVSLFQPITYFQLTTSLVLGIGLCAFLTLLFYYINKVKRAFADYTQ
CAVIAVVAAVLNSLCICFVASIPLCIVPYTALYYYATFYFTNEPAFIMHVSWYIMFGP
IVPIWMTCVYTVAMCFRHFFWVLAYFSKKHVEVFTDGKLNCSFQDAASNIFVINKDTY
AALRNSLTNDAYSRFLGLFNKYKYFSGAMETAAYREAAACHLAKALQTYSETGSDLLY
QPPNCSITSGVLQSGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCP
ADQLSDPNYDALLISMTNHSFSVQKHIGAPANLRVVGHAMQGTLLKLTVDVANPSTPA
YTFTTVKPGAAFSVLACYNGRPTGTFTVVMRPNYTIKGSFLCGSCGSVGYTKEGSVIN
FCYMHQMELANGTHTGSAFDGTMYGAFMDKQVHQVQLTDKYCSVNVVAWLYAAILNGC
AWFVKPNRTSVVSFNEWALANQFTEFVGTQSVDMLAVKTGVAIEQLLYAIQQLYTGFQ
GKQILGSTMLEDEFTPEDVNMQIMGVVMQSGVRKVTYGTAHWLFATLVSTYVIILQAT
KFTLWNYLFETIPTQLFPLLFVTMAFVMLLVKHKHTFLTLFLLPVAICLTYANIVYEP
TTPISSALIAVANWLAPTNAYMRTTHTDIGVYISMSLVLVIVVKRLYNPSLSNFALAL
CSGVMWLYTYSIGEASSPIAYLVFVTTLTSDYTITVFVTVNLAKVCTYAIFAYSPQLT
LVFPEVKMILLLYTCLGFMCTCYFGVFSFLNLKLRAPMGVYDFKVSTQEFRFMTANNL
TAPRNSWEAMALNFKLIGIGGTPCIKVAAMQSKLTDLKCTSVVLLSVLQQLHLEANSR
AWAFCVKCHNDILAATDPSEAFEKFVSLFATLMTFSGNVDLDALASDIFDTPSVLQAT
LSEFSHLATFAELEAAQKAYQEAMDSGDTSPQVLKALQKAVNIAKNAYEKDKAVARKL
ERMADQAMTSMYKQARAEDKKAKIVSAMQTMLFGMIKKLDNDVLNGIISNARNGCIPL
SVIPLCASNKLRVVIPDFTVWNQVVTYPSLNYAGALWDITVINNVDNEIVKSSDVVDS
NENLTWPLVLECTRASTSAVKLQNNEIKPSGLKTMVVSAGQEQTNCNTSSLAYYEPVQ
GRKMLMALLSDNAYLKWARVEGKDGFVSVELQPPCKFLIAGPKGPEIRYLYFVKNLNN
LHRGQVLGHIAATVRLQAGSNTEFASNSSVLSLVNFTVDPQKAYLDFVNAGGAPLTNC
VKMLTPKTGTGIAISVKPESTADQETYGGASVCLYCRAHIEHPDVSGVCKYKGKFVQI
PAQCVRDPVGFCLSNTPCNVCQYWIGYGCNCDSLRQVALPQSKDSNFLNRVRGSIVNA
RIEPCSSGLSTDVVFRAFDICNYKAKVAGIGKYYKTNTCRFVELDDQGHHLDSYFVVK
RHTMENYELEKHCYDLLRDCDAVAPHDFFIFDVDKVKTPHIVRQRLTEYTMMDLVYAL
RHFDQNSEVLKAILVKYGCCDVTYFENKLWFDFVENPSVIGVYHKLGERVRQAILNTV
KFCDHMVKAGLVGVLTLDNQDLNGKWYDFGDFVITQPGSGVAIVDSYYSYLMPVLSMT
DCLAAETHRDCDFNKPLIEWPLTEYDFTDYKVQLFEKYFKYWDQTYHANCVNCTDDRC
VLHCANFNVLFAMTMPKTCFGPIVRKIFVDGVPFVVSCGYHYKELGLVMNMDVSLHRH
RLSLKELMMYAADPAMHIASSNAFLDLRTSCFSVAALTTGLTFQTVRPGNFNQDFYDF
VVSKGFFKEGSSVTLKHFFFAQDGNAAITDYNYYSYNLPTMCDIKQMLFCMEVVNKYF
EIYDGGCLNASEVVVNNLDKSAGHPFNKFGKARVYYESMSYQEQDELFAMTKRNVIPT
MTQMNLKYAISAKNRARTVAGVSILSTMTNRQYHQKMLKSMAATRGATCVIGTTKFYG
GWDFMLKTLYKDVDNPHLMGWDYPKCDRAMPNMCRIFASLILARKHGTCCTTRDRFYR
LANECAQVLSEYVLCGGGYYVKPGGTSSGDATTAYANSVFNILQATTANVSALMGANG
NKIVDKEVKDMQFDLYVNVYRSTSPDPKFVDKYYAFLNKHFSMMILSDDGVVCYNSDY
AAKGYIAGIQNFKETLYYQNNVFMSEAKCWVETDLKKGPHEFCSQHTLYIKDGDDGYF
LPYPDPSRILSAGCFVDDIVKTDGTLMVERFVSLAIDAYPLTKHEDIEYQNVFWVYLQ
YIEKLYKDLTGHMLDSYSVMLCGDNSAKFWEEAFYRDLYSSPTTLQAVGSCVVCHSQT
SLRCGTCIRRPFLCCKCCYDHVIATPHKMVLSVSPYVCNAPGCGVSDVTKLYLGGMSY
FCVDHRPVCSFPLCANGLVFGLYKNMCTGSPSIVEFNRLATCDWTESGDYTLANTTTE
PLKLFAAETLRATEEASKQSYAIATIKEIVGERQLLLVWEAGKSKPPLNRNYVFTGYH
ITKNSKVQLGEYIFERIDYSDAVSYKSSTTYKLTVGDIFVLTSHSVATLTAPTIVNQE
RYVKITGLYPTITVPEEFASHVANFQKSGYSKYVTVQGPPGTGKSHFAIGLAIYYPTA
RVVYTACSHAAVDALCEKAFKYLNIAKCSRIIPAKARVECYDRFKVNETNSQYLFSTI
NALPETSADILVVDEVSMCTNYDLSIINARIKAKHIVYVGDPAQLPAPRTLLTRGTLE
PENFNSVTRLMCNLGPDIFLSMCYRCPKEIVSTVSALVYNNKLLAKKELSGQCFKILY
KGNVTHDASSAINRPQLTFVKNFITANPAWSKAVFISPYNSQNAVARSMLGLTTQTVD
SSQGSEYQYVIFCQTADTAHANNINRFNVAITRAQKGILCVMTSQALFESLEFTELSF
TNYKLQSQIVTGLFKDCSRETSGLSPAYAPTYVSVDDKYKTSDELCVNLNLPANIPYS
RVISRMGFKLDATVPGYPKLFITREEAVRQVRSWIGFDVEGAHASRNACGTNVPLQLG
FSTGVNFVVQPVGVVDTEWGNMLTGIAARPPPGEQFKHLVPLMHKGAAWPIVRRRIVQ
MLSDTLDKLSDYCTFVCWAHGFELTSASYFCKIGKEQKCCMCNRRAAAYSSPLQSYAC
WTHSCGYDYVYNPFFVDVQQWGYVGNLATNHDRYCSVHQGAHVASNDAIMTRCLAIHS
CFIERVDWDIEYPYISHEKKLNSCCRIVERNVVRAALLAGSFDKVYDIGNPKGIPIVD
DPVVDWHYFDAQPLTRKVQQLFYTEDMASRFADGLCLFWNCNVPKYPNNAIVCRFDTR
VHSEFNLPGCDGGSLYVNKHAFHTPAYDVSAFRDLKPLPFFYYSTTPCEVHGNGSMIE
DIDYVPLKSAVCITACNLGGAVCRKHATEYREYMEAYNLVSASGFRLWCYKTFDIYNL
WSTFTKVQGLENIAFNVVKQGHFIGVEGELPVAVVNDKIFTKSGVNDICMFENKTTLP
TNIAFELYAKRAVRSHPDFKLLHNLQADICYKFVLWDYERSNIYGTATIGVCKYTDID
VNSALNICFDIRDNGSLEKFMSTPNAIFISDRKIKKYPCIVGPDYAYFNGAIIRDSDV
VKQPVKFYLYKKVNNEFIDPTECIYTQSRSCSDFLPLSDMEKDFLSFDSDVFIKKYGL
ENYAFEHVVYGDFSHTTLGGLHLLIGLYKKQQEGHIIMEEMLKGSSTIHNYFITETNT
AAFKAVCSVIDLKLDDFVMILKSQDLGVVSKVVKVPIDLTMIEFMLWCKDGQVQTFYP
RLQASADWKPGHAMPSLFKVQNVNLERCELANYKQSIPMPRGVHMNIAKYMQLCQYLN
TCTLAVPANMRVIHFGAGSDKGIAPGTSVLRQWLPTDAIIIDNDLNEFVSDADITLFG
DCVTVRVSQQVDLVISDMYDPTTKNVTGSNESKALFFTYLCNLINNNLALGGSVAIKI
TEHSWSVELYELMGKFAWWTVFCTNANASSSEGFLLGINYLGTIKENIDGGAMHANYI
FWRNSTPMNLSTYSLFDLSKFQLKLKGTPVLQLKESQINELVISLLSQGKLLIRDNDT
LSVSTDVLVNTYRKLR"
CDS 135..13310
/codon_start=1
/product="ORF1a"
/protein_id="AKL80614.1"
/db_xref="GI:829624523"
/translation="MSFVAGVIAQGARGTYRAALNSEKHQDHVSLTVPLCGSGNLVEK
LSPWFMDGENAYEVVKAMLLKKEPLLYVPIRLAGHTRHLPGPRVYLVERLIACENPFM
VNQLAYSSSANGSLVGTTLQGKPIGMFFPYDIELVTGKQNILLRKYGRGGYHYTPVHY
ERDNTSCPEWMDDFEADPKGKYAQNLLKKLIGGDVTPVDQYMCGVDGKPISAYAFLMA
KDGITKLADVEADVAARADDEGFITLKNNLYRLVWHVERKDVPYPKQSIFTINSVVQK
DGVENTPPHYFTLGCKILTLTPRNKWSGVSDLSLKQKLLYTFYGKESLENPTYIYHSA
FIECGSCGNDSWLTGNAIQGFACGCGASYTANDVEVQSSGMIKPNALLCATCPFAKGD
SCSSNCKHSVAQLVSYLSERCNVIADSKSFTLIFGGVAYAYFGCEEGTMYFVPRAKSV
VSRIGDSIFTGCTGSWNKVTQIANMFLEQTQHSLNFVGEFVVNDVVLAILSGTTTNVD
KIRQLLKGVTIDKLRDYLADYDVAVTAGPFMDNAINVGGTGLQYAAITAPYVVLTGLG
ESFKKVATIPYKVCNSVKDTLTYYAHSVLYRVFPYDMDSGVSSFSELLFDCVDLSVAS
TYFLVRLLQDKTGDFMSTIITSCQTAVSKLLDTCFEATEATFNFLLDLAGLFRIFLRN
AYVYTSQGFVVVNGKVSTLVKQVLDLLNKGMQLLHTKVSWAGSNISAVIYSGRESLIF
PSGTYYCVTTKAKSVQQDLDVILPGEFSKKQLGLLQPTDNSTTVSVTVSSNMVETVVG
QLEQTNMHSPDVIVGDYVIISEKLFVRSKEEDGFAFYPACTNGHAVPTLFRLKGGAPV
KKVAFGGDQVHEVAAVRSVTVEYNIHAVLDTLLASSSLRTFVVDKSLSIEEFADVVKE
QVSDLLVKLLRGMPIPDFDLDDFIDAPCYCFNAEGDASWSSTMIFSLHPVECDEECSE
VEASGLEEGESECISETSTEQVDVSHEVSDDEWAAAVDEAFPLDEAEDVTESVQEEAQ
PVEVPVEDIAQVVIADTLQETPVVSDTVEVPPQVVKLPSEPQTIQPEVKEVAPVYEAD
TEQTQSVTVKPKRLRKKRNVDPLSNFEHKVITECVTIVLGDAIQVAKCYGESVLVNAA
NTHLKHGGGIAGAINAASKGAVQKESDEYILAKGPLQVGDSVLLQGHSLAKNILHVVG
PDARAKQDVSLLSKCYKAMNAYPLVVTPLVSTGIFGVKPAVSFDYLIREAKTRVLVVV
NSQDVYKSLTIVDIPQSLTFSYDGLRGAIRKAKDYGFTVFVCTDNSANTKVLRNKGVD
YTKKFLTVDGVQYYCYTSKDTLDDILQQANKSVGIISMPLGYVSHGLDLIQAGSVVRR
VNVPYVCLLANKEQEAILMSEDVKLNPSEDFIKHVRTNGGYNSWHLVEGELLVQDLRL
NKLLHWSDQTICYKDSVFYVVKNSTAFPFETLSACRAYLDSRTTQQLTIEVLVTVDGV
NFRTVVLNNKNTYRSQLGCVFFNGADISDTIPDEKQNGHSLYLADNLTADETKALKEL
YGPVDPTFLHRFYSLKAAVHKWKMVVCDKVRSLKLSDNNCYLNAVIMTLDLLKDIKFV
IPALQHAFMKHKGGDSTDFIALIMAYGNCTFGAPDDASRLLHTVLAKAELCCSARMVW
REWCNVCGIKDVVLQGLKACCYVGVQTVEDLRARMTYVCQCGGERHRQIVEHTTPWLL
LSGTPNEKLVTTSTAPDFVAFNVFQGIETAVGHYVHACLKGGLILKFDSGTVSKTSDW
KCKVTDVLFPGQKYSSDCNVVRYSLDGNFRTEVDPDLSAFYVKDGKYFISEPPVTYSP
ATILAGSVYTNSCLVSSDGQPGGDAISLSFNNLLGFDSSKPVTKKYTYSFLPKEDGDV
LLAEFDTYDPIYKNGAMYKGKPILWVNKASYDTNLNKFNRASLRQIFDVAPIELENKF
TPLSVASTPVEPPTVDVVALQQEMTIVKCKGLNKPFVKDNVSFVVDDSGTPVVEYLSK
EDLHTLYVDPKYQVIVLKDNVLSSMLRLHTVESGDINVVAASGSLTRKVKLLFRASFY
FKEFATRTFTATTAVGSCIKSVVRHLGVTKGILTGCFSFVKMLFILPLAYFSDSKLGT
TEVKVSALKTAGVVTGNVVKQCCTAAVDLSMDKLRRVDWKSTLRLLLMLCTTMVLLSS
VYHLYVFNQVLSSDVMFEDAQGLKKFYKEVRAYLGISSACDGLASAYRANSFDVPTFC
ANRSAMCNWCLISQDSITHYPALKMVQTHLSHYVLNIDWLWFAFETGLAYMLYTSAFN
WLLLAGTLHYFFAQTSIFVDWRSYNYAVSSAFWLFTHIPMAGLVRMYNLLACLWLLRK
FYQHVINGCKDTACLLCYKRNRLTRVEASTVVCGGKRTFYITANGGISFCRRHNWNCV
DCDIAGVGNTFICEEVANDLTTALRRPINATDRSHYYVDSVTVKETVVQFNYRRDGQP
FYERFPLCAFTNLDKLKFKEVCKTTTGIPEYNFIIYDSSDRGQESLARSACVYYSQVL
CKSILLVDSSLVTSVGDSSEIATKMFDSFVNSFVSLYNVTRDKLEKLISTARDGVRRG
DNFHSVLTTFIDAARGPAGVESDVETNEIVDSVQYAHKHDIQITNESYNNYVPSYVKP
DSVSTSDLGSLIDCNAASVNQIVLRNSNGACIWNAAAYMKLSDALKRQIRIACRKCNL
AFRLTTSKLRANDNILSVRFTANKIVGGAPTWFNVLRDFTLKGYVLATIIVFLCAVLM
YLCLPTFSMVPVEFYEDRILDFKVLDNGIIRDVNPDDKCFANKHRSFTQWYHEHVGGV
YDNSITCPLTVAVIAGVAGARIPDVPTTLAWVNNQIIFFVSRVFANTGSVCYTPIDEI
PYKSFSDSGCILPSECTMFRDAEGRMTPYCHDPTVLPGAFAYSQMRPHVRYDLYDGNM
FIKFPEVVFESTLRITRTLSTQYCRFGSCEYAQEGVCITTNGSWAIFNDHHLNRPGVY
CGSDFIDIVRRLAVSLFQPITYFQLTTSLVLGIGLCAFLTLLFYYINKVKRAFADYTQ
CAVIAVVAAVLNSLCICFVASIPLCIVPYTALYYYATFYFTNEPAFIMHVSWYIMFGP
IVPIWMTCVYTVAMCFRHFFWVLAYFSKKHVEVFTDGKLNCSFQDAASNIFVINKDTY
AALRNSLTNDAYSRFLGLFNKYKYFSGAMETAAYREAAACHLAKALQTYSETGSDLLY
QPPNCSITSGVLQSGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCP
ADQLSDPNYDALLISMTNHSFSVQKHIGAPANLRVVGHAMQGTLLKLTVDVANPSTPA
YTFTTVKPGAAFSVLACYNGRPTGTFTVVMRPNYTIKGSFLCGSCGSVGYTKEGSVIN
FCYMHQMELANGTHTGSAFDGTMYGAFMDKQVHQVQLTDKYCSVNVVAWLYAAILNGC
AWFVKPNRTSVVSFNEWALANQFTEFVGTQSVDMLAVKTGVAIEQLLYAIQQLYTGFQ
GKQILGSTMLEDEFTPEDVNMQIMGVVMQSGVRKVTYGTAHWLFATLVSTYVIILQAT
KFTLWNYLFETIPTQLFPLLFVTMAFVMLLVKHKHTFLTLFLLPVAICLTYANIVYEP
TTPISSALIAVANWLAPTNAYMRTTHTDIGVYISMSLVLVIVVKRLYNPSLSNFALAL
CSGVMWLYTYSIGEASSPIAYLVFVTTLTSDYTITVFVTVNLAKVCTYAIFAYSPQLT
LVFPEVKMILLLYTCLGFMCTCYFGVFSFLNLKLRAPMGVYDFKVSTQEFRFMTANNL
TAPRNSWEAMALNFKLIGIGGTPCIKVAAMQSKLTDLKCTSVVLLSVLQQLHLEANSR
AWAFCVKCHNDILAATDPSEAFEKFVSLFATLMTFSGNVDLDALASDIFDTPSVLQAT
LSEFSHLATFAELEAAQKAYQEAMDSGDTSPQVLKALQKAVNIAKNAYEKDKAVARKL
ERMADQAMTSMYKQARAEDKKAKIVSAMQTMLFGMIKKLDNDVLNGIISNARNGCIPL
SVIPLCASNKLRVVIPDFTVWNQVVTYPSLNYAGALWDITVINNVDNEIVKSSDVVDS
NENLTWPLVLECTRASTSAVKLQNNEIKPSGLKTMVVSAGQEQTNCNTSSLAYYEPVQ
GRKMLMALLSDNAYLKWARVEGKDGFVSVELQPPCKFLIAGPKGPEIRYLYFVKNLNN
LHRGQVLGHIAATVRLQAGSNTEFASNSSVLSLVNFTVDPQKAYLDFVNAGGAPLTNC
VKMLTPKTGTGIAISVKPESTADQETYGGASVCLYCRAHIEHPDVSGVCKYKGKFVQI
PAQCVRDPVGFCLSNTPCNVCQYWIGYGCNCDSLRQVALPQSKDSNFLNESGVLL"
CDS 21312..25373
/codon_start=1
/product="S protein"
/protein_id="AKL80615.1"
/db_xref="GI:829624524"
/translation="MIHSVFLLMFLLTPTESYVDVGPDSVKSACIEVDIQQTFFDKTW
PRPIDVSKADGIIYPQGRTYSNITITYQGLFPYQGDHGDMYVYSAGHATGTTPQKLFV
ANYSQDVKQFANGFVVRIGAAANSTGTVIISPSTSATIRKIYPAFMLGSSVGNFSDGK
MGRFFNHTLVLLPDGCGTLLRAFYCILEPRSGNHCPAGNSYTSFATYHTPATDCSDGN
YNRNASLNSFKEYFNLRNCTFMYTYNITEDEILEWFGITQTAQGVHLFSSRYVDLYGG
NMFQFATLPVYDTIKYYSIIPHSIRSIQSDRKAWAAFYVYKLQPLTFLLDFSVDGYIR
RAIDCGFNDLSQLHCSYESFDVESGVYSVSSFEAKPSGSVVEQAEGVECDFSPLLSGT
PPQVYNFKRLVFTNCNYNLTKLLSLFSVNDFTCSQISPAAIASNCYSSLILDYFSYPL
SMKSDLSVSSAGPISQFNYKQSFSNPTCLILATVPHNLTTITKPLKYSYINKCSRLLS
DDRTEVPQLVNANQYSPCVSIVPSTVWEDGDYYRKQLSPLEGGGWLVASGSTVAMTEQ
LQMGFGITVQYGTDTNSVCPKLEFANDTKIASQLGNCVEYSLYGVSGRGVFQNCTAVG
VRQQRFVYDAYQNLVGYYSDDGNYYCLRACVSVPVSVIYDKETKTHATLFGSVACEHI
SSTMSQYSRSTRSMLKRRDSTYGPLQTPVGCVLGLVNSSLFVEDCKLPLGQSLCALPD
TPSTLTPRSVRSVPGEMRLASIAFNHPIQVDQLNSSYFKLSIPTNFSFGVTQEYIQTT
IQKVTVDCKQYVCNGFQKCEQLLREYGQFCSKINQALHGANLRQDDSVRNLFASVKSS
QSSPIIPGFGGDFNLTLLEPVSISTGSRSARSAIEDLLFDKVTIADPGYMQGYDDCMQ
QGPASARDLICAQYVAGYKVLPPLMDVNMEAAYTSSLLGSIAGVGWTAGLSSFAAIPF
AQSIFYRLNGVGITQQVLSENQKLIANKFNQALGAMQTGFTTTNEAFRKVQDAVNNNA
QALSKLASELSNTFGAISASIGDIIQRLDVLEQDAQIDRLINGRLTTLNAFVAQQLVR
SESAALSAQLAKDKVNECVKAQSKRSGFCGQGTHIVSFVVNAPNGLYFMHVGYYPSNH
IEVVSAYGLCDAANPTNCIAPVNGYFIKTNNTRIVDEWSYTGSSFYAPEPITSLNTKY
VAPQVTYQNISTNLPPPLLGNSTGIDFQDELDEFFKNVSTSIPNFGSLTQINTTLLDL
TYEMLSLQQVVKALNESYIDLKELGNYTYYNKWPWYIWLGFIAGLVALALCVFFILCC
TGCGTNCMGKLKCNRCCDRYEEYDLEPHKVHVH"
CDS 25388..25699
/codon_start=1
/product="ORF3"
/protein_id="AKL80616.1"
/db_xref="GI:829624525"
/translation="MRVQRPPTLLLVFSLSFLVTAFSKPLYVPEHCQNYSGCMLRACI
KTAQADTAGLYTNFRIDVPSAESTGTQSVSVDRESTSTHDGLTEHVTSVNLFDVGYSV
N"
CDS 25708..26037
/codon_start=1
/product="ORF4a"
/protein_id="AKL80617.1"
/db_xref="GI:829624526"
/translation="MDYVSLLNQIWQKYLNSPYTTCLYIPKPTAKYTPLVGTSLHPVL
WNCQLSFAGYTESAVNSTKALAKQDAAQRIAWLLHKDGGIPDGCSLYLRHSSLFAQSE
EEESFSN"
CDS 25949..26689
/codon_start=1
/product="ORF4b"
/protein_id="AKL80618.1"
/db_xref="GI:829624527"
/translation="MEESLTDVPSTSGTQVYSRKARKRSHSPTKKLRYVKRRFSLLRP
EDLSVIVQPTHYVRVTFSDPNMWYLRSGHHLHSVHNWLKPYGGQPVSEYHITLALLNL
TDEDLARDFSPIALFLRNVRFELHEFALLRKTLVLNASEIYCANIHRFKPVYRVNTAI
PTIKDWLLVQGFSLYHSGLPLHMSISKLHALDDVTRNYIITMPCFRTYPQQMFVTPLA
VDVVSIRSSNQGNKQIVHSYPILHHPGF"
CDS 26696..27280
/codon_start=1
/product="ORF5-E fusion protein"
/protein_id="AKL80619.1"
/db_xref="GI:829624528"
/translation="MAFSASLFKPVQLVPVSPAFHRIESTDSIVFTYIPASGYVAALA
VNVCLIPLLLLLRQDTCRRSIIRTMVLYFLVLYNFLLAIVLVNGVHYPTGSCLIAFLV
ILIILWFVDRIRFCLMLNSYIPLFDMRSHFIRVSTVSSHGMAFLTATRLCVQCMTGFN
TLLVQPALYLYNTGRSVYVKFQDSKPPLPPDEWV"
CDS 27295..27954
/codon_start=1
/product="M protein"
/protein_id="AKL80620.1"
/db_xref="GI:829624529"
/translation="MSNMTQLTEAQIIAIIKDWNFAWSLIFLLITIVLQYGYPSRSMT
VYVFKMFVLWLLWPSSMALSIFSAIYPIDLASQIISGIVAAVSAMMWISYFVQSIRLF
MRTGSWWSFNPETNCLLNVPIGGTTVVRPLVEDSTSVTAVVTNGHLKMAGMHFGACDY
DRLPNEVTVAKPNVLIALKMVKRQSYGTNSGVAIYHRYKAGNYRSPPITADIELALLR
A"
CDS 28008..29249
/codon_start=1
/product="N protein"
/protein_id="AKL80621.1"
/db_xref="GI:829624530"
/translation="MASPAAPRAVSFADNNDITNTNLSRGRGRNPKPRAAPNNTVSWY
TGLTQHGKVPLTFPPGQGVPLNANSTPAQNAGYWRRQDRKINTGNGIKQLAPRWYFYY
TGTGPEAALPFRAVKDGIVWVHEDGATDAPSTFGTRNPNNDSAIVTQFAPGTKLPKNF
HIEGTGGNSQSSSRASSVSRNSSRSSSQGSRSGNSTRGTSPGPSGIGAVGGDLLYLDL
LNRLQALESGKVKQSQPKVITKKDAAAAKNKMRHKRTSTKSFNMVQAFGLRGPGDLQG
NFGDLQLNKLGTEDPRWPQIAELAPTASAFMGMSQFKLTHQNNDDHGNPVYFLRYSGA
IKLDPKNPNYNKWLELLEQNIDAYKTFPKKEKKQKAPKEESTDQMSEPPKEQRVQGSI
TQRTRTRPSVQPGPMIDVNTD"
CDS 28204..28542
/codon_start=1
/product="ORF8b"
/protein_id="AKL80622.1"
/db_xref="GI:829624531"
/translation="MPIPPLRKMLGIGGDRTEKLIPGMELSNWLPGGTSTTLELDPKQ
HSHSGLLRMASFGSMKMAPLMLLQLLGRGTLTMIQLLLHNSRPVLSFLKTSTLRGLEA
IVNHLQEPLA"

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Mon Jun 15, 2015 7:53 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
1 taggcagtgg acatatgctc aacactgggt ataattctaa ttgaatacta tttttcagtt
61 agagcgtcgt gtctcttgta cgtctcggtc acaatatacg gtttcgtccg gtgcgtggca
121 attcggggca catcatgtct ttcgtggctg gtgtgatcgc gcaaggtgcg cgcggtacgt
181 atcgagcagc gctcaactct gaaaaacatc aagaccatgt gtctctaact gtgccactct
241 gtggttcagg aaacctggtt gaaaaacttt caccatggtt catggatggc gaaaatgcct
301 atgaagtggt gaaggccatg ttacttaaaa aagagccact tctctatgtg cccatccggc
361 tggctggaca cactagacac ctcccaggtc ctcgtgtgta cctggttgag aggctcattg
421 cttgtgaaaa tccattcatg gttaaccaat tggcttatag ctctagtgca aatggcagcc
481 tggttggcac aactttgcag ggcaagccta ttggtatgtt cttcccttat gacatcgaac
541 ttgtcacagg aaagcaaaat attctcctgc gcaagtatgg ccgtggtggt tatcactaca
601 ccccagtcca ctatgagcga gacaacacct cttgccctga gtggatggac gattttgagg
661 cggatcctaa aggcaaatat gcccagaatc tgcttaagaa gttgattggc ggtgatgtca
721 ctccagttga ccaatacatg tgtggcgttg atggaaaacc cattagtgcc tacgcatttt
781 taatggccaa ggatggaata accaaactgg ctgatgttga agcggacgtc gcagcacgtg
841 ctgatgacga aggcttcatc acattaaaga acaatctata tagattggtt tggcatgttg
901 agcgtaaaga cgttccatat cctaagcaat ctatttttac tattaatagt gtggtccaaa
961 aggatggtgt tgaaaacact cctcctcact attttactct tggatgcaaa attttaacgc
1021 tcaccccacg caacaagtgg agtggcgttt ctgacttgtc cctcaaacaa aaactccttt
1081 acaccttcta tggtaaggag tcacttgaga acccaaccta catttaccac tccgcattca
1141 ttgagtgtgg aagttgtggt aatgattcct ggcttacagg gaatgctatc caagggtttg
1201 cctgtggatg tggggcatca tatacagcta atgatgtcga agtccaatca tctggcatga
1261 ttaagccaaa tgctcttctt tgtgctactt gcccctttgc taagggtgac agctgttctt
1321 ctaattgcaa acattcagtt gctcagttgg ttagttacct ttctgaacgc tgtaatgtta
1381 ttgctgattc taagtccttc acacttatct ttggtggcgt agcttacgcc tactttggat
1441 gtgaggaagg tactatgtac tttgtgccta gagctaagtc tgttgtctca aggattggag
1501 actccatctt tacaggctgt actggctctt ggaacaaggt cactcaaatt gctaacatgt
1561 tcttggaaca gactcagcat tcccttaact ttgtgggaga gttcgttgtc aacgatgttg
1621 tcctcgcaat tctctctgga accacaacta atgttgacaa aatacgccag cttctcaaag
1681 gtgtcaccat tgacaagttg cgtgattatt tagctgacta tgacgtagca gtcactgccg
1741 gcccattcat ggataatgct attaatgttg gtggtacagg attacagtat gccgccatta
1801 ctgcacctta tgtagttctc actggcttag gtgagtcctt taagaaagtt gcaaccatac
1861 cgtacaaggt ttgcaactct gttaaggata ctctgactta ttatgctcac agcgtgttgt
1921 acagagtttt tccttatgac atggattctg gtgtgtcatc ctttagtgaa ctactttttg
1981 attgcgttga tctttcagta gcttctacct attttttagt ccgcctcttg caagataaga
2041 ctggcgactt tatgtctaca attattactt cctgccaaac tgctgttagt aagcttctag
2101 atacatgttt tgaagctaca gaagcaacat ttaacttctt gttagatttg gcaggattgt
2161 tcagaatctt tcttcgcaat gcctatgtgt acacttcaca agggtttgtg gtggtcaatg
2221 gcaaagtttc tacacttgtc aaacaagtgt tagacttgct taataagggt atgcaacttt
2281 tgcatacaaa ggtctcctgg gctggttcta atatcagtgc tgttatctac agcggcaggg
2341 agtctctaat attcccatcg ggaacctatt actgtgtcac cactaaggct aagtccgttc
2401 aacaagatct tgacgttatt ttgcctggtg agttttccaa gaagcagtta ggactgctcc
2461 aacctactga caattctaca actgttagtg ttactgtatc cagtaacatg gttgaaactg
2521 ttgtgggtca acttgagcaa actaatatgc atagtcctga tgttatagta ggtgactatg
2581 tcattattag tgaaaaattg tttgtgcgta gtaaggaaga agacggattc gccttctacc
2641 ctgcttgcac taatggtcat gctgtaccga ctctctttag acttaaggga ggtgcacctg
2701 taaaaaaagt agcctttggc ggtgatcaag tacatgaggt tgctgctgta agaagtgtta
2761 ctgtcgagta caacattcat gctgtattag acacactact tgcttcttct agtcttagaa
2821 cctttgttgt agataagtct ttgtcaattg aggagtttgc tgacgtagta aaggaacaag
2881 tctcagactt gcttgttaaa ttactgcgtg gaatgccgat tccagatttt gatttagacg
2941 attttattga cgcaccatgc tattgcttta acgctgaggg tgatgcatct tggtcttcta
3001 ctatgatctt ctctcttcac cccgtcgagt gtgacgagga gtgttctgaa gtagaggctt
3061 caggtttaga agaaggtgaa tcagagtgca tttctgagac ttcaactgaa caagttgacg
3121 tttctcatga ggtttctgac gacgagtggg ctgctgcagt tgatgaagcg ttccccctcg
3181 atgaagcaga agatgttact gaatctgtgc aagaagaagc acaaccagta gaagtacctg
3241 ttgaagatat tgcgcaggtt gtcatagctg acaccttaca ggaaactcct gttgtgtctg
3301 atactgttga agtcccaccg caagtggtga aacttccgtc tgaacctcag actatccagc
3361 ccgaggtaaa agaagttgca cctgtctatg aggctgatac cgaacagaca cagagtgtta
3421 ctgttaaacc taagaggtta cgcaaaaagc gtaatgttga ccctttgtcc aattttgaac
3481 ataaggttat tacagagtgc gttaccatag ttttaggtga cgcaattcaa gtagccaagt
3541 gctatgggga gtctgtgtta gttaatgctg ctaacacaca tcttaagcat ggcggtggta
3601 tcgctggtgc tattaatgcg gcttcaaaag gggctgtcca aaaagagtca gatgagtata
3661 ttctggctaa agggccgtta caagtaggag attcagttct cttgcaaggc cattctctag
3721 ctaagaatat cctgcatgtc gtaggcccag atgcccgcgc taaacaggat gtttctctcc
3781 ttagtaagtg ctataaggct atgaatgcat atcctcttgt agtcactcct cttgtttcaa
3841 caggcatatt tggtgtaaaa ccagctgtgt cttttgatta tcttattaga gaggctaaga
3901 ctagagtttt agtcgtcgtt aattcccaag atgtctataa gagtcttacc atagttgaca
3961 ttccacagag tttgactttt tcatatgatg ggttacgtgg cgcaatacgt aaagctaaag
4021 attatggttt tactgttttt gtgtgcacag acaactctgc taacactaaa gttcttagga
4081 acaagggtgt tgattatact aagaagtttc ttacagttga cggtgtgcaa tattattgct
4141 acacgtctaa ggacacttta gatgatatct tacaacaggc taataagtct gttggtatta
4201 tatctatgcc tttgggatat gtgtctcatg gtttagactt aattcaagca gggagtgtcg
4261 tgcgtagagt taacgtgccc tacgtgtgtc tcctagctaa taaagagcaa gaagctattt
4321 tgatgtctga agacgttaag ttaaaccctt cagaagattt tataaagcac gtccgcacta
4381 atggtggtta caattcttgg catttagtcg agggtgaact attggtgcaa gacttacgct
4441 taaataagct cctgcattgg tctgatcaaa ccatatgcta caaggatagt gtgttttatg
4501 ttgtaaagaa tagtacagct tttccatttg aaacactttc agcatgtcgt gcgtatttgg
4561 attcacgcac gacacagcag ttaacaatcg aagtcttagt gactgtcgat ggtgtaaatt
4621 ttagaacagt cgttctaaat aataagaaca cttatagatc acagcttgga tgcgttttct
4681 ttaatggtgc tgatatttct gataccattc ctgatgagaa acagaatggt cacagtttat
4741 atctagcaga caatttgact gctgatgaaa caaaggcgct taaagagtta tatggccccg
4801 ttgatcctac tttcttacac agattctatt cacttaaggc tgcagtccat aagtggaaga
4861 tggttgtgtg tgataaggta cgttctctca aattgagtga taataattgt tatcttaatg
4921 cagttattat gacacttgat ttattgaagg acattaaatt tgttatacct gctctacagc
4981 atgcatttat gaaacataag ggcggtgatt caactgactt catagccctc attatggctt
5041 atggcaattg cacatttggt gctccagatg atgcctctcg gttacttcat accgtgcttg
5101 caaaggctga gttatgctgt tctgcacgca tggtttggag agagtggtgc aatgtctgtg
5161 gcataaaaga tgttgttcta caaggcttaa aagcttgttg ttacgtgggt gtgcaaactg
5221 ttgaagatct gcgtgctcgc atgacatatg tatgccagtg tggtggtgaa cgtcatcggc
5281 aaatagtcga acacaccacc ccctggttgc tgctctcagg cacaccaaat gaaaaattgg
5341 tgacaacctc cacggcgcct gattttgtag cgtttaatgt ctttcagggc attgaaacgg
5401 ctgttggcca ttatgttcat gcttgcctga agggtggtct tattttaaag tttgactctg
5461 gcaccgttag caagacttca gactggaagt gcaaggtgac agatgtactt ttccccggcc
5521 aaaaatacag tagcgattgt aatgtcgtac ggtattcttt ggacggtaat ttcagaacag
5581 aggttgatcc cgacctatct gctttctatg ttaaggatgg taaatacttt ataagtgaac
5641 cacccgtaac atattcacca gctacaattt tagctggtag tgtctacact aatagctgcc
5701 ttgtatcgtc tgatggacaa cctggcggtg atgctattag tttgagtttt aataaccttt
5761 tagggtttga ttctagtaaa ccagtcacta agaaatacac ttactccttc ttgcctaaag
5821 aagacggcga tgtgttgttg gctgagtttg acacttatga ccctatttat aagaatggtg
5881 ccatgtataa aggcaaacca attctttggg tcaacaaagc atcttatgat actaatctta
5941 ataagttcaa tagagctagt ttgcgtcaaa tttttgacgt agcccccatt gaactcgaaa
6001 ataaattcac acctttgagt gtggcgtcca caccagttga acctccaact gtagatgtgg
6061 tagcacttca acaggaaatg acaattgtca aatgtaaggg tttaaataaa cctttcgtga
6121 aggacaatgt cagtttcgtt gttgatgact caggtactcc cgttgttgag tatctgtcta
6181 aagaagatct acatacattg tatgtagacc ctaagtatca agtcattgtc ttaaaagaca
6241 atgtactttc ttctatgctt agattgcaca ccgttgagtc aggtgatatt aacgttgttg
6301 cagcttccgg atctttgaca cgtaaagtga agttactatt tagggcttca ttttatttca
6361 aagaatttgc tacccgcact ttcactgcta ccactgctgt aggtagttgt ataaagagtg
6421 tagtgcggca tctaggtgtt actaaaggca tattgacagg ctgttttagt tttgtcaaga
6481 tgttatttat tcttccacta gcttacttta gtgattcaaa actcggcacc acagaggtta
6541 aagtgagtgc tttgaaaaca gctggcgttg tgacaggtaa tgttgtaaaa cagtgttgca
6601 ctgctgctgt tgatttaagt atggataagt tgcgccgtgt ggattggaaa tcaaccctac
6661 ggttgttact tatgttatgc acaactatgg tattgttgtc ttctgtgtat cacttgtatg
6721 tcttcaatca ggtcttatca agtgatgtta tgtttgaaga tgcccaaggt ttgaaaaagt
6781 tctacaaaga agttagagct tacctaggaa tctcttctgc ttgtgacggt cttgcttcag
6841 cttatagggc gaattcattt gatgtaccta cattctgcgc aaaccgttct gcaatgtgta
6901 attggtgctt gattagccaa gattccataa ctcactaccc agctcttaag atggttcaaa
6961 cacatcttag ccactatgtt cttaacatag attggttgtg gtttgcattc gagactggtt
7021 tggcatacat gctctatacc tcggccttca actggttgtt gttggcaggt acattgcatt
7081 atttctttgc acagacttcc atatttgtag actggcggtc atacaattat gctgtgtcta
7141 gtgccttctg gttatttacc cacattccaa tggcgggttt ggtacgaatg tataatttgt
7201 tagcatgcct ttggctttta cgcaagtttt atcagcatgt aatcaatggt tgcaaagata
7261 cggcatgctt gctctgctat aagaggaacc gacttactag agttgaagct tctaccgttg
7321 tctgtggtgg aaaacgtacg ttttatatca cagcaaatgg cggtatttca ttctgtcgta
7381 ggcataattg gaattgtgtg gattgtgaca ttgcaggtgt ggggaatacc ttcatctgtg
7441 aagaagtcgc aaatgacctc actaccgccc tacgcaggcc tattaacgct acggatagat
7501 cacattatta tgtggattcc gttacagtta aagagactgt tgttcagttt aattatcgta
7561 gagacggtca accattctac gagcggtttc ccctctgcgc ttttacaaat ctagataagt
7621 tgaagttcaa agaggtctgt aaaactacta ctggtatacc tgaatacaac tttatcatct
7681 acgactcatc agatcgtggc caggaaagtt tagctaggtc tgcatgtgtt tattattctc
7741 aagtcttgtg taaatcaatt cttttggttg actcaagttt ggttacttct gttggtgatt
7801 ctagtgaaat cgccactaaa atgtttgatt cctttgttaa tagtttcgtc tcgctgtata
7861 atgtcacacg cgataagttg gaaaaactta tctctactgc tcgtgatggc gtaaggcgag
7921 gcgataactt ccatagtgtc ttaacaacat tcattgacgc agcacgaggc cccgcaggtg
7981 tggagtctga tgttgagacc aatgaaattg ttgactctgt gcagtatgct cataaacatg
8041 acatacaaat tactaatgag agttacaata attatgtacc ctcatatgtt aaacctgata
8101 gtgtgtctac cagtgattta ggtagtctca ttgattgtaa tgcggcttca gttaaccaaa
8161 ttgtcttgcg taattctaat ggtgcttgta tttggaacgc tgctgcatat atgaaactct
8221 cggatgcact taaacgacag attcgcattg catgccgtaa gtgtaattta gctttccggt
8281 taaccacctc aaagctacgc gctaatgata atatcttatc agttagattc actgctaaca
8341 aaattgttgg tggtgctcct acatggttta atgtgttgcg tgactttacg ttaaagggtt
8401 acgttcttgc taccattatt gtgtttctgt gtgctgtact gatgtatttg tgtttaccta
8461 cattttctat ggtacctgtt gaattttatg aagaccgcat cttggacttt aaagttcttg
8521 ataatggtat cattagggat gtaaatcctg atgataagtg ctttgctaat aagcaccggt
8581 ccttcacaca atggtatcat gagcatgttg gtggtgtcta tgacaactct atcacatgcc
8641 cattgacagt tgcagtaatt gctggagttg ctggtgctcg cattccagac gtacctacta
8701 cattggcttg ggtgaacaat cagataattt tctttgtttc tcgagtcttt gctaatacag
8761 gcagtgtttg ctacactcct atagatgaga taccctataa gagtttctct gatagtggtt
8821 gcattcttcc atctgagtgc actatgttta gggatgcaga gggccgtatg acaccatact
8881 gccatgatcc tactgttttg cctggggctt ttgcgtacag tcagatgagg cctcatgttc
8941 gttacgactt gtatgatggt aacatgttta ttaaatttcc tgaagtagta tttgaaagta
9001 cacttaggat tactagaact ctgtcaactc agtactgccg gttcggtagt tgtgagtatg
9061 cacaagaggg tgtttgtatt accacaaatg gctcgtgggc catttttaat gaccaccatc
9121 ttaatagacc tggtgtctat tgtggctctg attttattga cattgtcagg cggttagcag
9181 tatcactgtt ccagcctatt acttatttcc aattgactac ctcattggtc ttgggtatag
9241 gtttgtgtgc attcctgact ttgctcttct attatattaa taaagtaaaa cgtgcttttg
9301 cagattacac ccagtgtgct gtaattgctg ttgttgctgc tgttcttaat agcttgtgca
9361 tctgctttgt tgcctctata ccattgtgta tagtacctta cactgcattg tactattatg
9421 ctacattcta ttttactaat gagcctgcat ttattatgca tgtttcttgg tacattatgt
9481 tcgggcctat cgttcccata tggatgacct gcgtctatac agttgcaatg tgctttagac
9541 acttcttctg ggttttagct tattttagta agaaacatgt agaagttttt actgatggta
9601 agcttaattg tagtttccag gacgctgcct ctaatatctt tgttattaac aaggacactt
9661 atgcagctct tagaaactct ttaactaatg atgcctattc acgatttttg gggttgttta
9721 acaagtataa gtacttctct ggtgctatgg aaacagccgc ttatcgtgaa gctgcagcat
9781 gtcatcttgc taaagcctta caaacataca gtgagactgg tagtgatctt ctttaccaac
9841 cacccaactg tagcataacc tctggcgtgt tgcaaagcgg tttggtgaaa atgtcacatc
9901 ccagtggaga tgttgaggct tgtatggttc aggttacctg cggtagcatg actcttaatg
9961 gtctttggct tgacaacaca gtctggtgcc cacgacacgt aatgtgcccg gctgaccagt
10021 tgtctgatcc taattatgat gccttgttga tttctatgac taatcatagt ttcagtgtgc
10081 aaaaacacat tggcgctcca gcaaacttgc gtgttgttgg tcatgccatg caaggcactc
10141 ttttgaagtt gactgtcgat gttgctaacc ctagcactcc agcctacact tttacaacag
10201 tgaaacctgg cgcagcattt agtgtgttag catgctataa tggtcgtccg actggtacat
10261 tcactgttgt aatgcgccct aactacacaa ttaagggttc ctttctgtgt ggttcttgtg
10321 gtagtgttgg ttacaccaag gagggtagtg tgatcaattt ttgttacatg catcaaatgg
10381 aacttgctaa tggtacacat accggttcag catttgatgg tactatgtat ggtgccttta
10441 tggataaaca agtgcaccaa gttcagttaa cagacaaata ctgcagtgtt aatgtagtag
10501 cttggcttta cgcagcaata cttaatggtt gcgcttggtt tgtaaaacct aatcgcacta
10561 gtgttgtttc ttttaatgaa tgggctcttg ccaaccaatt cactgaattt gttggcactc
10621 aatccgttga catgttagct gtcaaaacag gcgttgctat tgaacagctg ctttatgcga
10681 tccaacaact ttatactggg ttccagggaa agcaaatcct tggcagtact atgttggaag
10741 atgaattcac acctgaggat gttaatatgc agattatggg tgtggttatg cagagtggtg
10801 tgagaaaagt tacatatggt actgcgcatt ggttgttcgc gacccttgtt tcaacctatg
10861 tgataatctt acaagccact aaatttactt tgtggaacta cttgtttgag actattccca
10921 cacagttgtt cccactctta tttgtgacta tggccttcgt tatgttgttg gttaaacaca
10981 aacacacctt tttgacactt ttcttgttgc ctgtggctat ttgtttgact tatgcaaaca
11041 tagtctacga gcccactact cccatttcgt cagcgctgat tgcagttgca aattggcttg
11101 cccccactaa tgcttatatg cgcactacac atactgatat tggtgtctac attagtatgt
11161 cacttgtatt agtcattgta gtgaagagat tgtacaaccc atcactttct aactttgcgt
11221 tagcattgtg cagtggtgta atgtggttgt acacttatag cattggagaa gcctcaagcc
11281 ccattgccta tctggttttt gtcactacac tcactagtga ttatacgatt acagtctttg
11341 ttactgtcaa ccttgcaaaa gtttgcactt atgccatctt tgcttactca ccacagctta
11401 cacttgtgtt tccggaagtg aagatgatac ttttattata cacatgttta ggtttcatgt
11461 gtacttgcta ttttggtgtc ttctcttttt tgaaccttaa gcttagagca cctatgggtg
11521 tctatgactt taaggtctca acacaagagt tcagattcat gactgctaac aatctaactg
11581 cacctagaaa ttcttgggag gctatggctc tgaactttaa gttaataggt attggcggta
11641 caccttgtat aaaggttgct gctatgcagt ctaaacttac agatcttaaa tgcacatctg
11701 tggttctcct ctctgtgctc caacagttac acttagaggc taatagtagg gcctgggctt
11761 tctgtgttaa atgccataat gacatattgg cagcaacaga ccccagtgag gctttcgaga
11821 aattcgtaag tctctttgcc actttaatga ctttttctgg taatgtagat cttgatgcgt
11881 tagctagtga tatttttgac actcctagcg tacttcaagc tactctttct gagttttcac
11941 acttagctac ctttgctgag ttggaagctg cgcagaaagc ctatcaggaa gctatggact
12001 ctggtgacac ctcaccacaa gttcttaagg ctttgcagaa ggctgttaat atagctaaaa
12061 acgcctatga gaaggataag gcagtggccc gtaagttaga acgtatggct gatcaggcta
12121 tgacttctat gtataagcaa gcacgtgctg aagacaagaa agcaaaaatt gtcagtgcta
12181 tgcaaactat gttgtttggt atgattaaga agctcgacaa cgatgttctt aatggtatca
12241 tttctaacgc taggaatggt tgtatacctc ttagtgtcat tccactgtgt gcttcaaata
12301 aacttcgcgt tgtaattcct gacttcaccg tctggaatca ggtagtcaca tatccctcgc
12361 ttaactacgc tggggctttg tgggacatta cagttataaa caatgtggac aatgaaattg
12421 ttaagtcttc agatgttgta gacagcaatg aaaatttaac atggccactt gttttagaat
12481 gcactagggc atccacttct gccgttaagt tgcaaaataa tgagatcaaa ccttcaggtt
12541 taaaaaccat ggttgtgtct gcaggtcaag agcaaactaa ctgtaatact agttccttag
12601 cttattacga acctgtgcag ggtcgtaaaa tgctgatggc tcttctttct gataatgcct
12661 atctcaaatg ggcgcgtgtt gaaggtaagg acggatttgt tagtgtagag ctacaacctc
12721 cttgcaaatt cttgattgcg ggaccaaaag gacctgaaat ccgatatctc tattttgtta
12781 aaaatcttaa caaccttcat cgcgggcaag tgttagggca cattgctgcg actgttagat
12841 tgcaagctgg ttctaacacc gagtttgcct ctaattcttc ggtgttgtca cttgttaact
12901 tcaccgttga tcctcaaaaa gcttatctcg atttcgtcaa tgcgggaggt gccccattga
12961 caaattgtgt taagatgctt actcctaaaa ctggtacagg tatagctata tctgttaaac
13021 cagagagtac agctgatcaa gagacttatg gtggagcttc agtgtgtctc tattgccgtg
13081 cgcatataga acatcctgat gtctctggtg tttgtaaata taagggtaag tttgtccaaa
13141 tccctgctca gtgtgtccgt gaccctgtgg gattttgttt gtcaaatacc ccctgtaatg
13201 tctgtcaata ttggattgga tatgggtgca attgtgactc gcttaggcaa gtagcactgc
13261 cccaatctaa agattccaat tttttaaacg agtccggggt tctattgtaa atgcccgaat
13321 agaaccctgt tcaagtggtt tgtccactga tgtcgtcttt agggcatttg acatctgcaa
13381 ctataaggct aaggttgctg gtattggaaa atactacaag actaatactt gtaggtttgt
13441 agaattagat gaccaagggc atcatttaga ctcctatttt gtcgttaaga ggcatactat
13501 ggagaattat gaactagaga agcactgtta cgatttgtta cgtgactgtg atgctgtagc
13561 tccccatgat ttcttcatct ttgatgtaga caaagttaaa acacctcata ttgtacgtca
13621 gcgtttaact gagtacacta tgatggatct tgtatatgcc ctgaggcact ttgatcaaaa
13681 tagcgaagtg cttaaggcta tcttagtgaa gtatggttgc tgtgatgtta cctactttga
13741 aaataaactc tggtttgatt ttgttgaaaa tcccagtgtt attggtgttt atcataaact
13801 tggagaacgt gtacgccaag ctatcttaaa cactgttaaa ttttgtgacc acatggtcaa
13861 ggctggttta gtcggtgtgc tcacactaga caaccaggac cttaatggca agtggtatga
13921 ttttggtgac ttcgtaatca ctcaacctgg ttcaggagta gctatagttg atagctacta
13981 ttcttatttg atgcctgtgc tctcaatgac cgattgtctg gccgctgaga cacataggga
14041 ttgtgatttt aataaaccac tcattgagtg gccacttact gagtatgatt ttactgatta
14101 taaggtacaa ctctttgaga agtactttaa atattgggat cagacgtatc acgcaaattg
14161 cgttaattgt actgatgacc gttgtgtgtt acattgtgct aatttcaatg tattgtttgc
14221 tatgaccatg cctaagactt gtttcggacc catagtccga aagatctttg ttgatggcgt
14281 gccatttgta gtatcttgtg gttatcacta caaagaatta ggtttagtca tgaatatgga
14341 tgttagtctc catagacata ggctctctct taaggagttg atgatgtatg ccgctgatcc
14401 agccatgcac attgcctcct ctaacgcttt tcttgatttg aggacatcat gttttagtgt
14461 cgctgcactt acaactggtt tgacttttca aactgtgcgg cctggcaatt ttaaccaaga
14521 cttctatgat ttcgtggtat ctaaaggttt ctttaaggag ggctcttcag ttacgctcaa
14581 acattttttc tttgctcaag atggtaatgc tgctattaca gattataatt actattctta
14641 taatctgcct actatgtgtg acatcaaaca aatgttgttc tgcatggaag ttgtaaacaa
14701 gtacttcgaa atctatgacg gtggttgtct taatgcttct gaagtggttg ttaataattt
14761 agacaagagt gctggccatc cttttaataa gtttggcaaa gctcgtgtct attatgagag
14821 catgtcttac caggagcaag atgaactctt tgccatgaca aagcgtaacg tcattcctac
14881 catgactcaa atgaatctaa aatatgctat tagtgctaag aatagagctc gcactgttgc
14941 aggcgtgtcc atacttagca caatgactaa tcgccagtac catcagaaaa tgcttaagtc
15001 catggctgca actcgtggag cgacttgcgt cattggtact acaaagttct atggtggctg
15061 ggatttcatg cttaaaacat tgtacaaaga tgttgataat ccgcatctta tgggttggga
15121 ttaccctaag tgtgatagag ctatgcctaa tatgtgtaga atcttcgctt cactcatatt
15181 agctcgtaaa catggcactt gttgtactac aagggacaga ttttatcgct tggcaaatga
15241 gtgtgctcag gtgctaagcg aatatgttct atgtggtggt ggttactacg tcaaacctgg
15301 aggtaccagt agcggagatg ccaccactgc atatgccaat agtgtcttta acattttgca
15361 ggcgacaact gctaatgtca gtgcacttat gggtgctaat ggcaacaaga ttgttgacaa
15421 agaagttaaa gacatgcagt ttgatttgta tgtcaatgtt tacaggagca ctagcccaga
15481 ccccaaattt gttgataaat actatgcttt tcttaataag cacttttcta tgatgatact
15541 gtctgatgac ggtgtcgttt gctataatag tgattatgca gctaagggtt acattgctgg
15601 aatacagaat tttaaggaaa cgctgtatta tcagaacaat gtctttatgt ctgaagctaa
15661 atgctgggtg gaaaccgatc tgaagaaagg gccacatgaa ttctgttcac agcatacgct
15721 ttatattaag gatggcgacg atggttactt ccttccttat ccagaccctt caagaatttt
15781 gtctgccggt tgctttgtag atgatatcgt taagactgac ggtacactca tggtagagcg
15841 gtttgtgtct ttggctatag atgcttaccc tctcacaaag catgaagata tagaatacca
15901 gaatgtattc tgggtctact tacagtatat agaaaaactg tataaagacc ttacaggaca
15961 catgcttgac agttattctg tcatgctatg tggtgataat tctgctaagt tttgggaaga
16021 ggcattctac agagatctct atagttcgcc taccactttg caggctgtcg gttcatgcgt
16081 tgtatgccat tcacagactt ccctacgctg tgggacatgc atccgtagac catttctctg
16141 ctgtaaatgc tgctatgatc atgttatagc aactccacat aagatggttt tgtctgtttc
16201 tccttacgtt tgtaatgccc ctggttgtgg cgtttcagac gttactaagc tatatttagg
16261 tggtatgagc tacttttgtg tagatcatag acctgtgtgt agttttccac tttgcgctaa
16321 tggtcttgta ttcggcttat acaagaatat gtgcacaggt agtccttcta tagttgaatt
16381 taataggttg gctacctgtg actggactga aagtggtgat tacacccttg ccaatactac
16441 aacagaacca ctcaaacttt ttgctgctga gactttacgt gccactgaag aggcgtctaa
16501 gcagtcttat gctattgcca ccatcaaaga aattgttggt gagcgccaac tattacttgt
16561 gtgggaggct ggcaagtcca aaccaccact caatcgtaat tatgttttta ctggttatca
16621 tataaccaaa aatagtaaag tgcagctcgg tgagtacatc ttcgagcgca ttgattatag
16681 tgatgctgta tcctacaagt ctagtacaac gtataaactg actgtaggtg acatcttcgt
16741 acttacctct cactctgtgg ctaccttgac ggcgcccaca attgtgaatc aagagaggta
16801 tgttaaaatt actgggttgt acccaaccat tacggtacct gaagagttcg caagtcatgt
16861 tgccaacttc caaaaatcag gttatagtaa atatgtcact gttcagggac cacctggcac
16921 tggcaaaagt cattttgcta tagggttagc gatttactac cctacagcac gtgttgttta
16981 tacagcatgt tcacacgcag ctgttgatgc tttgtgtgaa aaagctttta aatatttgaa
17041 cattgctaaa tgttcccgta tcattcctgc aaaggcacgt gttgagtgct atgacaggtt
17101 taaagttaat gagacaaatt ctcaatattt gtttagtact attaatgctc taccagaaac
17161 ttctgccgat attctggtgg ttgatgaggt tagtatgtgc actaattatg atctttcaat
17221 tattaatgca cgtattaaag ctaagcacat tgtctatgta ggagatccag cacagttgcc
17281 agctcctagg actttgttga ctagaggcac attggaacca gaaaatttca atagtgtcac
17341 tagattgatg tgtaacttag gtcctgacat atttttaagt atgtgctaca ggtgtcctaa
17401 ggaaatagta agcactgtga gcgctcttgt ctacaataat aaattgttag ccaagaagga
17461 gctttcaggc cagtgcttta aaatactcta taagggcaat gtgacgcatg atgctagctc
17521 tgccattaat agaccacaac tcacatttgt gaagaatttt attactgcca atccggcatg
17581 gagtaaggca gtctttattt cgccttataa ttcacagaat gctgtggctc gttcaatgct
17641 gggtcttact actcagactg ttgattcctc acagggttca gaataccagt acgttatctt
17701 ctgtcaaaca gcagatacgg cacatgctaa caacattaac agatttaatg ttgcaatcac
17761 tcgtgcccaa aaaggtattc tttgtgttat gacatctcag gcactctttg agtccttaga
17821 gtttactgaa ttgtctttta ctaattacaa gctccagtct cagattgtaa ctggcctttt
17881 taaagattgc tctagagaaa cttctggcct ctcacctgct tatgcaccaa catacgttag
17941 tgttgatgac aagtataaga cgagtgatga gctttgcgtg aatcttaatt tacccgcaaa
18001 tatcccatac tctcgtgtta tttccaggat gggctttaaa ctcgatgcaa cagttcctgg
18061 atatcctaag cttttcatta ctcgtgaaga ggctgtaagg caagttcgaa gctggatagg
18121 cttcgatgtt gagggtgctc atgcttcccg taatgcatgt ggcaccaatg tgcctctaca
18181 attaggattt tcaactggtg tgaactttgt tgttcagcca gttggtgttg tagacactga
18241 gtggggtaac atgttaacgg gcattgctgc ccgtcctcca ccaggtgaac agtttaagca
18301 cctcgtgcct cttatgcata agggggctgc gtggcctatt gttagacgac gtatagtgca
18361 aatgttgtca gacactttag acaaattgtc tgattactgt acgtttgttt gttgggctca
18421 tggctttgaa ttaacgtctg catcatactt ttgcaagata ggtaaggaac agaagtgttg
18481 catgtgcaat agacgcgctg cagcgtactc ttcacctctg caatcttatg cctgctggac
18541 tcattcctgc ggttatgatt atgtctacaa ccctttcttt gtcgatgttc aacagtgggg
18601 ttatgtaggc aatcttgcta ctaatcacga tcgttattgc tctgtccatc aaggagctca
18661 tgtggcttct aatgatgcaa taatgactcg ttgtttagct attcattctt gttttataga
18721 acgtgtggat tgggatatag agtatcctta tatctcacat gaaaagaaat tgaattcctg
18781 ttgtagaatc gttgagcgca acgtcgtacg tgctgctctt cttgccggtt catttgacaa
18841 agtctatgat attggcaatc ctaaaggaat tcctattgtt gatgaccctg tggttgattg
18901 gcattatttt gatgcacagc ccttgaccag aaaggtacaa cagcttttct atacagagga
18961 catggcctca agatttgctg atgggctctg cttattttgg aactgtaatg taccaaaata
19021 tcctaataat gcaattgtat gcaggtttga cacacgtgtg cattctgagt tcaatttgcc
19081 aggttgtgat ggcggtagtt tgtatgttaa caagcacgct tttcatacac cagcatatga
19141 tgtgagtgca ttccgtgatc tgaaaccttt accattcttt tattattcta ctacaccatg
19201 tgaagtgcat ggtaatggta gtatgataga ggatattgat tatgtacccc taaaatctgc
19261 agtctgtatt acagcttgta atttaggggg cgctgtttgt aggaagcatg ctacagagta
19321 cagagagtat atggaagcat ataatcttgt ctctgcatca ggtttccgcc tttggtgtta
19381 taagaccttt gatatttata atctctggtc tacttttaca aaagttcaag gtttggaaaa
19441 cattgctttt aatgttgtta aacaaggcca ttttattggt gttgagggtg aactacctgt
19501 agctgtagtc aatgataaga tcttcaccaa gagtggcgtt aatgacattt gtatgtttga
19561 gaataaaacc actttgccta ctaatatagc ttttgaactc tatgctaagc gtgctgtacg
19621 ctcgcatccc gatttcaaat tgctacacaa tttacaagca gacatttgct acaagttcgt
19681 cctttgggat tatgaacgta gcaatattta tggtactgct actattggtg tatgtaagta
19741 cactgatatt gatgttaatt cagctttgaa tatatgtttt gacatacgcg ataatggttc
19801 attggagaag ttcatgtcta ctcccaatgc catctttatt tctgatagaa aaattaagaa
19861 atacccttgt attgtaggtc ctgattatgc ttacttcaat ggtgctatca tccgtgatag
19921 tgatgttgtt aaacaaccag tgaagttcta cttgtataag aaagtcaata atgagtttat
19981 tgatcctact gagtgtattt acactcagag tcgctcttgt agtgacttcc tacccctgtc
20041 tgacatggag aaagactttc tatcttttga tagtgatgtt ttcattaaga agtatggctt
20101 ggaaaactat gcttttgagc acgtagtcta tggagacttc tctcatacta cgttaggcgg
20161 tcttcacttg cttattggtt tatacaagaa gcaacaggaa ggtcatatta ttatggaaga
20221 aatgctaaaa ggtagctcaa ctattcataa ctattttatt actgagacta acacagcggc
20281 ttttaaggcg gtgtgttctg ttatagattt aaagcttgac gactttgtta tgattttaaa
20341 gagtcaagac cttggcgtag tatccaaggt tgtcaaggtt cctattgact taacaatgat
20401 tgagtttatg ttatggtgta aggatggaca ggttcaaacc ttctaccctc gactccaggc
20461 ttctgcagat tggaaacctg gtcatgcaat gccatccctc tttaaagttc aaaatgtaaa
20521 ccttgaacgt tgtgagcttg ctaattacaa gcaatctatt cctatgcctc gcggtgtgca
20581 catgaacatc gctaaatata tgcaattgtg ccagtattta aatacttgca cattagccgt
20641 gcctgccaat atgcgtgtta tacattttgg cgctggttct gataaaggta tcgctcctgg
20701 tacatcagtt ttacgacagt ggcttcctac agatgccatt attatagata atgatttaaa
20761 tgagttcgtg tcagatgctg acataacttt atttggagat tgtgtaactg tacgtgtcag
20821 ccaacaagtg gatcttgtta tttccgacat gtatgatcct actactaaga atgtaacagg
20881 tagtaatgag tcaaaggctt tattctttac ttacctgtgt aacctcatta ataataatct
20941 tgctcttggt gggtctgttg ctattaaaat aacagaacac tcttggagcg ttgaacttta
21001 tgaacttatg ggaaaatttg cttggtggac tgttttctgc accaatgcaa atgcatcctc
21061 atctgaagga ttcctcttag gtattaatta cttgggtact attaaagaaa atatagatgg
21121 tggtgctatg cacgccaact atatattttg gagaaattcc actcctatga atctgagtac
21181 ttactcactt tttgatttat ccaagtttca attaaaatta aaaggaacac cagttcttca
21241 attaaaggag agtcaaatta acgaactcgt aatatctctc ctgtcgcagg gtaagttact
21301 tatccgtgac aatgatacac tcagtgtttc tactgatgtt cttgttaaca cctacagaaa
21361 gttacgttga tgtagggcca gattctgtta agtctgcttg tattgaggtt gatatacaac
21421 agactttctt tgataaaact tggcctaggc caattgatgt ttctaaggct gacggtatta
21481 tataccctca aggccgtaca tattctaaca taactatcac ttatcaaggt ctttttccct
21541 atcagggaga ccatggtgat atgtatgtct actctgcagg acatgctaca ggcacaactc
21601 cacaaaagtt gtttgtagct aactattctc aggacgtcaa acagtttgct aatgggtttg
21661 tcgtccgtat aggagcagct gccaattcca ctggcactgt tattattagc ccatctacca
21721 gcgctactat acgaaaaatt taccctgctt ttatgctggg ttcttcagtt ggtaatttct
21781 cagatggtaa aatgggccgc ttcttcaatc atactctagt tcttttgccc gatggatgtg
21841 gcactttact tagagctttt tattgtattc tagagcctcg ctctggaaat cattgtcctg
21901 ctggcaattc ctatacttct tttgccactt atcacactcc tgcaacagat tgttctgatg
21961 gcaattacaa tcgtaatgcc agtctgaact cttttaagga gtattttaat ttacgtaact
22021 gcacctttat gtacacttat aacattaccg aagatgagat tttagagtgg tttggcatta
22081 cacaaactgc tcaaggtgtt cacctcttct catctcggta tgttgatttg tacggcggca
22141 atatgtttca atttgccacc ttgcctgttt atgatactat taagtattat tctatcattc
22201 ctcacagtat tcgttctatc caaagtgata gaaaagcttg ggctgccttc tacgtatata
22261 aacttcaacc gttaactttc ctgttggatt tttctgttga tggttatata cgcagagcta
22321 tagactgtgg ttttaatgat ttgtcacaac tccactgctc atatgaatcc ttcgatgttg
22381 aatctggagt ttattcagtt tcgtctttcg aagcaaaacc ttctggctca gttgtggaac
22441 aggctgaagg tgttgaatgt gatttttcac ctcttctgtc tggcacacct cctcaggttt
22501 ataatttcaa gcgtttggtt tttaccaatt gcaattataa tcttaccaaa ttgctttcac
22561 ttttttctgt gaatgatttt acttgtagtc aaatatctcc agcagcaatt gctagcaact
22621 gttattcttc actgattttg gattattttt catacccact tagtatgaaa tccgatctca
22681 gtgttagttc tgctggtcca atatcccagt ttaattataa acagtccttt tctaatccca
22741 catgtttgat tttagcgact gttcctcata accttactac tattactaag cctcttaagt
22801 acagctatat taacaagtgc tctcgtcttc tttctgatga tcgtactgaa gtacctcagt
22861 tagtgaacgc taatcaatac tcaccctgtg tatccattgt cccatccact gtgtgggaag
22921 acggtgatta ttataggaaa caactatctc cacttgaagg tggtggctgg cttgttgcta
22981 gtggctcaac tgttgccatg actgagcaat tacagatggg ctttggtatt acagttcaat
23041 atggtacaga caccaatagt gtttgcccca agcttgaatt tgctaatgac acaaaaattg
23101 cctctcaatt aggcaattgc gtggaatatt ccctctatgg tgtttcgggc cgtggtgtct
23161 ttcagaattg cacagctgta ggtgttcgac agcagcgctt tgtttatgat gcgtaccaga
23221 atttagttgg ctattattct gatgatggca actactactg tttgcgtgct tgtgttagtg
23281 ttcctgtttc tgtcatctat gataaagaaa ctaaaaccca cgctactcta tttggtagtg
23341 ttgcatgtga acacatttcc tctaccatgt ctcaatactc ccgttctacg cgatcaatgc
23401 ttaaacggcg agattctaca tatggtcccc ttcagacacc tgttggttgt gtcctaggac
23461 ttgttaattc ctctttgttc gtagaggact gcaagttgcc tcttggtcaa tctctctgtg
23521 ctcttcctga cacacctagt actctcacac ctcgcagtgt gcgctctgtt ccaggtgaaa
23581 tgcgcttggc atccattgct tttaatcatc ctattcaggt tgatcaactt aatagtagtt
23641 attttaaatt aagtatacct actaattttt cctttggtgt gactcaggag tacattcaga
23701 caaccattca gaaagttact gttgattgta aacagtacgt ttgcaatggt ttccagaagt
23761 gtgagcaatt actgcgcgag tatggccagt tttgttccaa aataaaccag gctctccatg
23821 gtgccaattt acgccaggat gattctgtac gtaatttgtt tgcgagcgtg aaaagctctc
23881 aatcatctcc tatcatacca ggttttggag gtgactttaa tttgacactt ctagaacctg
23941 tttctatatc tactggcagt cgtagtgcac gtagtgctat tgaggatttg ctatttgaca
24001 aagtcactat agctgatcct ggttatatgc aaggttacga tgattgtatg cagcaaggtc
24061 cagcatcagc tcgtgatctt atttgtgctc aatatgtggc tggttataaa gtattacctc
24121 ctcttatgga tgttaatatg gaagccgcgt acacttcatc tttgcttggc agcatagcag
24181 gtgttggctg gactgctggc ttatcctcct ttgctgctat tccatttgca cagagtattt
24241 tttataggtt aaacggtgtt ggcattactc aacaggttct ttcagagaac caaaagctta
24301 ttgccaataa gtttaatcag gctctgggag ctatgcaaac aggcttcact acaactaatg
24361 aagcttttcg gaaggttcag gatgctgtga acaacaatgc acaggctcta tccaaattag
24421 ctagcgagct atctaatact tttggtgcta tttccgcctc tattggagac atcatacaac
24481 gtcttgacgt tctcgaacag gacgcccaaa tagacagact tattaatggc cgtttgacaa
24541 cactaaatgc ttttgttgca cagcagcttg ttcgttctga atcagctgct ctttccgctc
24601 aattggctaa agataaagtc aatgagtgtg tcaaggcaca atccaagcgt tctggatttt
24661 gcggtcaagg cacacatata gtgtcctttg ttgtaaatgc ccctaatggc ctttacttta
24721 tgcatgttgg ttattaccct agcaaccaca ttgaggttgt ttctgcttat ggtctttgcg
24781 atgcagctaa ccctactaat tgtatagccc ctgttaatgg ctactttatt aaaactaata
24841 acactaggat tgttgatgag tggtcatata ctggctcgtc cttctatgca cctgagccca
24901 tcacctctct taatactaag tatgttgcac cacaggtgac ataccaaaac atttctacta
24961 acctccctcc tcctcttctc ggcaattcca ccgggattga cttccaagat gagttggatg
25021 agtttttcaa aaatgttagc accagtatac ctaattttgg ttctctaaca cagattaata
25081 ctacattact cgatcttacc tacgagatgt tgtctcttca acaagttgtt aaagccctta
25141 atgagtctta catagacctt aaagagcttg gcaattatac ttattacaac aaatggccgt
25201 ggtacatttg gcttggtttc attgctgggc ttgttgcctt agctctatgc gtcttcttca
25261 tactgtgctg cactggttgt ggcacaaact gtatgggaaa acttaagtgt aatcgttgtt
25321 gtgatagata cgaggaatac gacctcgagc cgcataaggt tcatgttcac taattaacga
25381 actatcaatg agagttcaaa gaccacccac tctcttgtta gtgttctcac tctctttttt
25441 ggtcactgca ttttcaaaac ctctctatgt acctgagcat tgtcagaatt attctggttg
25501 catgcttagg gcttgtatta aaactgccca agctgataca gctggtcttt atacaaattt
25561 tcgaattgat gtcccatctg cagaatcaac tggtactcaa tcagtttctg tcgatcgtga
25621 gtctacttca actcatgatg gtcttaccga acatgttact agtgtgaatc tttttgacgt
25681 tggttactca gttaattaac gaactctatg gattacgtgt ctctgcttaa tcaaatttgg
25741 cagaagtacc ttaattcacc gtatactact tgtttgtata tccctaaacc cacagctaag
25801 tatacacctt tagttggcac ttcattgcac cctgtgctgt ggaactgtca gctatccttt
25861 gctggttata ctgaatctgc tgttaattct acaaaagctt tggccaaaca ggacgcagct
25921 cagcgaatcg cttggttgct acataaggat ggaggaatcc ctgacggatg ttccctctac
25981 ctccggcact caagtttatt cgcgcaaagc gaggaagagg agtcattctc caactaagaa
26041 actgcgctac gttaagcgta gattttctct tctgcgccct gaagacctta gtgttattgt
26101 ccaaccaaca cactatgtca gggttacatt ttcagacccc aacatgtggt atctacgttc
26161 gggtcatcat ttacactcag ttcacaattg gcttaaacct tatggcggcc aacctgtttc
26221 tgagtaccat attactctag ctttgctaaa tctcactgat gaagatttag ctagagattt
26281 ttcacccatt gcgctctttt tgcgcaatgt cagatttgag ctacatgagt tcgccttgct
26341 gcgcaaaact cttgttctta atgcatcaga gatctactgt gctaacatac atagatttaa
26401 gcctgtgtat agagttaaca cggcaatccc tactattaag gattggcttc tcgttcaggg
26461 attttccctt taccatagtg gcctcccttt acatatgtca atctctaaat tgcatgcact
26521 ggatgatgtt actcgcaatt acatcattac aatgccatgc tttagaactt atcctcaaca
26581 aatgtttgtt actcctttgg ccgtagatgt tgtctccata cggtcttcca atcagggtaa
26641 taaacaaatt gttcattctt accccatttt acatcatcca ggattttaac gaactatggc
26701 tttctcggcg tctttattta aacccgtcca gctagtccca gtttctcctg catttcatcg
26761 cattgagtct actgactcta ttgttttcac atacattcct gctagcggct atgtagctgc
26821 tttagctgtc aatgtgtgtc tcattcccct attattactg ctacgtcaag atacttgtcg
26881 tcgcagcatt atcagaacta tggttctcta tttccttgtt ctttataact ttttattagc
26941 cattgtacta gtcaatggtg tacattatcc aactggaagt tgcctgatag ccttcttagt
27001 tatcctcata atactttggt ttgtagatag aattcgtttc tgtctcatgc tgaattccta
27061 cattccactg tttgacatgc gttctcactt tattcgtgtt agtacagttt cttctcatgg
27121 tatggctttc cttacggcta ctagattatg tgtgcaatgt atgacaggct tcaataccct
27181 gttagttcag cccgcattat acttgtataa tactggacgt tcagtctatg taaaattcca
27241 ggatagtaaa ccccctctac cacctgacga gtgggtttaa cgaactcctt cataatgtct
27301 aatatgacgc aactcactga ggcgcagatt attgccatta ttaaagactg gaactttgca
27361 tggtccctga tctttctctt aattactatc gtactacagt atggataccc atcccgtagt
27421 atgactgtct atgtctttaa aatgtttgtt ttatggctcc tatggccatc ttccatggcg
27481 ctatcaatat ttagcgccat ttatccaatt gatctagctt cccagataat ctctggcatt
27541 gtagcagctg tttcagctat gatgtggatt tcctactttg tgcagagtat ccggctgttt
27601 atgagaactg gatcatggtg gtcattcaat cctgagacta attgcctttt gaatgttcca
27661 attggtggta caactgtcgt acgtccactc gtagaggact ctaccagtgt aactgctgtt
27721 gtaaccaatg gtcacctcaa aatggctggc atgcatttcg gtgcttgtga ctacgacaga
27781 cttcctaatg aagtcaccgt ggccaaaccc aatgtgctga ttgctttaaa aatggtgaag
27841 cggcaaagct acggaactaa ttccggcgtt gccatttacc atagatataa ggcaggtaat
27901 tacaggagtc cgcctattac ggcggatatt gaacttgcat tgcttcgagc ttaggctctt
27961 tagtaagagt atcttaattg attttaacga atctcaattt cattgttatg gcatcccctg
28021 ctgcacctcg tgctgtttcc tttgccgata acaatgatat aacaaataca aacctgtctc
28081 gaggtagagg acgtaatcca aaaccacgag ctgcaccaaa taacactgtc tcttggtaca
28141 ctgggcttac ccaacacggg aaagtccctc ttacctttcc acctgggcag ggtgtacctc
28201 ttaatgccaa ttccacccct gcgcaaaatg ctgggtattg gcggagacag gacagaaaaa
28261 ttaataccgg gaatggaatt aagcaactgg ctcccaggtg gtacttctac tacactggaa
28321 ctggacccga agcagcactc ccattccggg ctgttaagga tggcatcgtt tgggtccatg
28381 aagatggcgc cactgatgct ccttcaactt ttgggacgcg gaaccctaac aatgattcag
28441 ctattgttac acaattcgcg cccggtacta agcttcctaa aaacttccac attgagggga
28501 ctggaggcaa tagtcaatca tcttcaagag cctctagcgt aagcagaaac tcttccagat
28561 ctagttcaca aggttcaaga tcaggaaact ctacccgcgg cacttctcca ggtccatctg
28621 gaatcggagc agtaggaggt gatctacttt accttgatct tctgaacaga ctacaagccc
28681 ttgagtctgg caaagtaaag caatcgcagc caaaagtaat cactaagaaa gatgctgctg
28741 ctgctaaaaa taagatgcgc cacaagcgca cttccaccaa aagtttcaac atggtgcaag
28801 cttttggtct tcgcggacca ggagacctcc agggaaactt tggtgatctt caattgaata
28861 aactcggcac tgaggaccca cgttggcccc aaattgctga gcttgctcct acagccagtg
28921 cttttatggg tatgtcgcaa tttaaactta cccatcagaa caatgatgat catggcaacc
28981 ctgtgtactt ccttcggtac agtggagcca ttaaacttga cccaaagaat cccaactaca
29041 ataagtggtt ggagcttctt gagcaaaata ttgatgccta caaaaccttc cctaagaagg
29101 aaaagaaaca aaaggcacca aaagaagaat caacagacca aatgtctgaa cctccaaagg
29161 agcagcgtgt gcaaggtagc atcactcagc gcactcgcac ccgtccaagt gttcagcctg
29221 gtccaatgat tgatgttaac actgattagt gtcactcaaa gtaacaagat cgcggcaatc
29281 gtttgtgttt ggtaacccca tctcaccatc gcttgtccac tcttgcacag aatggaatca
29341 tgttgtaatt acagtgcaat aaggtaatta taacccattt aattgatagc tatgctttat
29401 taaagtgtgt agctgtagag agaatgttaa agactgtcac ctctgcgtga ttgcaagtga
29461 acagtgcccc ccgggaagag ctctacagtg tgaaatgtaa ataaaaatag ctat

_________________
www.twitter.com/hniman


Top
 Profile  
 
Display posts from previous:  Sort by  
Post new topic Reply to topic  [ 7 posts ] 

All times are UTC - 5 hours [ DST ]


Who is online

Users browsing this forum: Google [Bot], HilarioR, Majestic-12 [Bot] and 63 guests


You cannot post new topics in this forum
You cannot reply to topics in this forum
You cannot edit your posts in this forum
You cannot delete your posts in this forum
You cannot post attachments in this forum

Search for:
Jump to:  
cron
Powered by phpBB® Forum Software © phpBB Group