Rhiza Labs FluTracker Forum

The place to discuss the flu
It is currently Thu Oct 19, 2017 6:42 am

All times are UTC - 5 hours [ DST ]




Post new topic Reply to topic  [ 4 posts ] 
Author Message
PostPosted: Tue Jun 09, 2015 3:01 pm 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
Korea CDC Release Full MERS-CoV/KOR/KNIH/002_05_2015 Seq

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Tue Jun 09, 2015 3:05 pm 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
LOCUS KT029139 30108 bp RNA linear VRL 09-JUN-2015
DEFINITION Middle East respiratory syndrome coronavirus isolate
MERS-CoV/KOR/KNIH/002_05_2015, complete genome.
ACCESSION KT029139
VERSION KT029139.1 GI:829021049
KEYWORDS .
SOURCE Middle East respiratory syndrome coronavirus (MERS-CoV)
ORGANISM Middle East respiratory syndrome coronavirus
Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA
stage; Nidovirales; Coronaviridae; Coronavirinae; Betacoronavirus;
unclassified Betacoronavirus.
REFERENCE 1 (bases 1 to 30108)
AUTHORS Kim,S.S., Nam,J.-G., Kang,H.J., Kim,Y.-J., Cheong,H.-M.,
Yang,J.-S., Cho,Y.-J., Chun,J., Kim,N., Yoon,S.-H., Yun,M.-R. and
Kim,D.-W.
TITLE Isolation and analysis of complete genome of MERS-CoV in South
Korea
JOURNAL Unpublished
REFERENCE 2 (bases 1 to 30108)
AUTHORS Kim,S.S., Nam,J.-G., Kang,H.J., Kim,Y.-J., Cheong,H.-M.,
Yang,J.-S., Cho,Y.-J., Chun,J., Kim,N., Yoon,S.-H., Yun,M.-R. and
Kim,D.-W.
TITLE Direct Submission
JOURNAL Submitted (06-JUN-2015) Korea National Institute of Health, Korea
Centers for Disease Control and Prevention, #187
Osongsaengmyeong2(i)-ro, Osong-eup, Heungdeok-gu, Cheongju-si,
Chungcheongbuk-do 363-700, South Korea
FEATURES Location/Qualifiers
source 1..30108
/organism="Middle East respiratory syndrome coronavirus"
/mol_type="genomic RNA"
/isolate="MERS-CoV/KOR/KNIH/002_05_2015"
/isolation_source="sputum"
/host="Homo sapiens"
/db_xref="taxon:1335626"
/country="South Korea"
/collection_date="20-May-2015"
CDS join(279..13433,13433..21514)
/ribosomal_slippage
/codon_start=1
/product="orf1ab"
/protein_id="AKL59399.1"
/db_xref="GI:829021050"
/translation="MSFVAGVIAQGARGTYRAALNSEKHQDHVSLTVPLCGSGNLVEK
LSPWFMDGENAYEVVKAMLLKKEPLLYVPIRLAGHTRHLPGPRVYLVERLIACENPFM
VNQLAYSSSANGSLVGTTLQGKPIGMFFPYDIELVTGKQNILLRKYGRGGYHYTPVHY
ERDNTSCPEWMDDFEADPKGKYAQNLLKKLIGGDVTPVDQYMCGVDGKPISAYAFLMA
KDGITKLADVEADVAARADDEGFITLKNNLYRLVWHVERKDVPYPKQSIFTINSVVQK
DGVENTPPHYFTLGCKILTLTPRNKWSGVSDLSLKQKLLYTFYGKESLENPTYIYHSA
FIECGSCGNDSWLTGNAIQGFACGCGASYTANDVEVQSSGMIKPNALLCATCPFAKGD
SCSSNCKHSVAQLVSYLSERCNVIADSKSFTLIFGGVAYAYFGCEEGTMYFVPRAKSV
VSRIGDSIFTGCTGSWNKVTQIANMFLEQTQHSLNFVGEFVVNDVVLAILSGTTTNVD
KIRQLLKGVTIDKLRDYLADYDVAVTAGPFMDNAINVGGTGLQYAAITAPYVVLTGLG
ESFKKVATIPYKVCNSVKDTLTYYAHSVLYRVFPYDMDSGVSSFSELLFDCVDLSVAS
TYFLVRLLQDKTGDFMSTIITSCQTAVSKLLDTCFEATEATFNFLLDLAGLFRIFLRN
AYVYTSQGFVVVNGKVSTLVKQVLDLLNKGMQLLHTKVSWAGSNISAVIYSGRESLIF
PSGTYYCVTTKAKSVQQDLDVILPGEFSKKQLGLLQPTDNSTTVSVTVSSNMVETVVG
QLEQTNMHSPDVIVGDYVIISEKLFVRSKEEDGFAFYPACTNGHAVPTLFRLKGGAPV
KKVAFGGDQVHEVAAVRSVTVEYNIHAVLDTLLASSSLRTFVVDKSLSIEEFADVVKE
QVSDLLVKLLRGMPIPDFDLDDFIDAPCYCFNAEGDASWSSTMIFSLHPVECDEECSE
VEASGLEEGESECISETSTEQVDVSHEVSDDEWAAAVDEAFPLDEAEDVTESVQEEAQ
PVEVPVEDIAQVVIADTLQETPVVSDTVEVPPQVVKLPSEPQTIQPEVKEVAPVYEAD
TEQTQSVTVKPKRLRKKRNVDPLSNFEHKVITECVTIVLGDAIQVAKCYGESVLVNAA
NTHLKHGGGIAGAINAASKGAVQKESDEYILAKGPLQVGDSVLLQGHSLAKNILHVVG
PDARAKQDVSLLSKCYKAMNAYPLVVTPLVSTGIFGVKPAVSFDYLIREAKTRVLVVV
NSQDVYKSLTIVDIPQSLTFSYDGLRGAIRKAKDYGFTVFVCTDNSANTKVLRNKGVD
YTKKFLTVDGVQYYCYTSKDTLDDILQQANKSVGIISMPLGYVSHGLDLIQAGSVVRR
VNVPYVCLLANKEQEAILMSEDVKLNPSEDFIKHVRTNGGYNSWHLVEGELLVQDLRL
NKLLHWSDQTICYKDSVFYVVKNSTAFPFETLSACRAYLDSRTTQQLTIEVLVTVDGV
NFRTVVLNNKNTYRSQLGCVFFNGADISDTIPDEKQNGHSLYLADNLTADETKALKEL
YGPVDPTFLHRFYSLKAAVHKWKMVVCDKVRSLKLSDNNCYLNAVIMTLDLLKDIKFV
IPALQHAFMKHKGGDSTDFIALIMAYGNCTFGAPDDASRLLHTVLAKAELCCSARMVW
REWCNVCGIKDVVLQGLKACCYVGVQTVEDLRARMTYVCQCGGERHRQIVEHTTPWLL
LSGTPNEKLVTTSTAPDFVAFNVFQGIETAVGHYVHACLKGGLILKFDSGTVSKTSDW
KCKVTDVLFPGQKYSSDCNVVRYSLDGNFRTEVDPDLSAFYVKDGKYFTSEPPVTYSP
ATILAGSVYTNSCLVSSDGQPGGDAISLSFNNLLGFDSSKPVTKKYTYSFLPKEDGDV
LLAEFDTYDPIYKNGAMYKGKPILWVNKASYDTNLNKFNRASLRQIFDVAPIELENKF
TPLSVASTPVEPPTVDVVALQQEMTIVKCKGLNKPFVKDNVSFVADDSGTPVVEYLSK
EDLHTLYVDPKYQVIVLKDNVLSSMLRLHTVESGDINVVAASGSLTRKVKLLFRASFY
FKEFATRTFTATTAVGSCIKSVVRHLGVTKGILTGCFSFVKMLFILPLAYFSDSKLGT
TEVKVSALKTAGVVTGNVVKQCCTAAVDLSMDKLRRVDWKSTLRLLLMLCTTMVLLSS
VYHLYVFNQVLSSDVMFEDAQGLKKFYKEVRAYLGISSACDGLASAYRANSFDVPTFC
ANRSAMCNWCLISQDSITHYPALKMVQTHLSHYVLNIDWLWFAFETGLAYMLYTSAFN
WLLLAGTLHYFFAQTSIFVDWRSYNYAVSSAFWLFTHIPMAGLVRMYNLLACLWLLRK
FYQHVINGCKDTACLLCYKRNRLTRVEASTVVCGGKRTFYITANGGISFCRRHNWNCV
DCDIAGVGNTFICEEVANDLTTALRRPINATDRSHYYVDSVTVKETVVQFNYRRDGQP
FYERFPLCAFTNLDKLKFKEVCKTTTGIPEYNFIIYDSSDRGQESLARSACVYYSQVL
CKSILLVDSSLVTSVGDSSEIATKMFDSFVNSFVSLYNVTRDKLEKLISTARDGVRRG
DNFHSVLTTFIDAARGPAGVESDVETNEIVDSVQYAHKHDIQITNESYNNYVPSYVKP
DSVSTSDLGSLIDCNAASVNQIVLRNSNGACIWNAAAYMKLSDALKRQIRIACRKCNL
AFRLTTSKLRANDNILSVRFTANKIVGGAPTWFNVLRDFTLKGYVLATIIVFLCAVLM
YLCLPTFSMVPVEFYEDRILDFKVLDNGIIRDVNPDDKCFANKHRSFTQWYHEHVGGV
YDNSITCPLTVAVIAGVAGARIPDVPTTLAWVNNQIIFFVSRVFANTGSVCYTPIDEI
PYKSFSDSGCILPSECTMFRDAEGRMTPYCHDPTVLPGAFAYSQMRPHVRYDLYDGNM
FIKFPEVVFESTLRITRTLSTQYCRFGSCEYAQEGVCITTNGSWAIFNDHHLNRPGVY
CGSDFIDIVRRLAVSLFQPITYFQLTTSLVLGIGLCAFLTLLFYYINKVKRAFADYTQ
CAVIAVVAAVLNSLCICFVASIPLCIVPYTALYYYATFYFTNEPAFIMHVSWYIMFGP
IVPIWMTCVYTVAMCFRHFFWVLAYFSKKHVEVFTDGKLNCSFQDAASNIFVINKDTY
AALRNSLTNDAYSRFLGLFNKYKYFSGAMETAAYREAAACHLAKALQTYSETGSDLLY
QPPNCSITSGVLQSGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCP
ADQLSDPNYDALLISMTNHSFSVQKHIGAPANLRVVGHAMQGTLLKLTVDVANPSTPA
YTFTTVKPGAAFSVLACYNGRPTGTFTVVMRPNYTIKGSFLCGSCGSVGYTKEGSVIN
FCYMHQMELANGTHTGSAFDGTMYGAFMDKQVHQVQLTDKYCSVNVVAWLYAAILNGC
AWFVKPNRTSVVSFNEWALANQFTEFVGTQSVDMLAVKTGVAIEQLLYAIQQLYTGFQ
GKQILGSTMLEDEFTPEDVNMQIMGVVMQSGVRKVTYGTAHWLFATLVSTYVIILQAT
KFTLWNYLFETIPTQLFPLLFVTMAFVMLLVKHKHTFLTLFLLPVAICLTYANIVYEP
TTPISSALIAVANWLAPTNAYMRTTHTDIGVYISMSLVLVIVVKRLYNPSLSNFALAL
CSGVMWLYTYSIGEASSPIAYLVFVTTLTSDYTITVFVTVNLAKVCTYAIFAYSPQLT
LVFPEVKMILLLYTCLGFMCTCYFGVFSFLNLKLRAPMGVYDFKVSTQEFRFMTANNL
TAPRNSWEAMALNFKLIGIGGTPCIKVAAMQSKLTDLKCTSVVLLSVLQQLHLEANSR
AWAFCVKCHNDILAATDPSEAFEKFVSLFATLMTFSGNVDLDALASDIFDTPSVLQAT
LSEFSHLATFAELEAAQKAYQEAMDSGDTSPQVLKALQKAVNIAKNAYEKDKAVARKL
ERMADQAMTSMYKQARAEDKKAKIVSAMQTMLFGMIKKLDNDVLNGIISNARNGCIPL
SVIPLCASNKLRVVIPDFTVWNQVVTYPSLNYAGALWDITVINNVDNEIVKSSDVVDS
NENLTWPLVLECTRASTSAVKLQNNEIKPSGLKTMVVSAGQEQTNCNTSSLAYYEPVQ
GRKMLMALLSDNAYLKWARVEGKDGFVSVELQPPCKFLIAGPKGPEIRYLYFVKNLNN
LHRGQVLGHIAATVRLQAGSNTEFASNSSVLSLVNFTVDPQKAYLDFVNAGGAPLTNC
VKMLTPKTGTGIAISVKPESTADQETYGGASVCLYCRAHIEHPDVSGVCKYKGKFVQI
PAQCVRDPVGFCLSNTPCNVCQYWIGYGCNCDSLRQVALPQSKDSNFLNRVRGSIVNA
RIEPCSSGLSTDVVFRAFDICNYKAKVAGIGKYYKTNTCRFVELDDQGHHLDSYFVVK
RHTMENYELEKHCYDLLRDCDAVAPHDFFIFDVDKVKTPHIVRQRLTEYTMMDLVYAL
RHFDQNSEVLKAILVKYGCCDVTYFENKLWFDFVENPSVIGVYHKLGERVRQAILNTV
KFCDHMVKAGLVGVLTLDNQDLNGKWYDFGDFVITQPGSGVAIVDSYYSYLMPVLSMT
DCLAAETHRDCDFNKPLIEWPLTEYDFTDYKVQLFEKYFKYWDQTYHANCVNCTDDRC
VLHCANFNVLFAMTMPKTCFGPIVRKIFVDGVPFVVSCGYHYKELGLVMNMDVSLHRH
RLSLKELMMYAADPAMHIASSNAFLDLRTSCFSVAALTTGLTFQTVRPGNFNQDFYDF
VVSKGFFKEGSSVTLKHFFFAQDGNAAITDYNYYSYNLPTMCDIKQMLFCMEVVNKYF
EIYDGGCLNASEVVVNNLDKSAGHPFNKFGKARVYYESMSYQEQDELFAMTKRNVIPT
MTQMNLKYAISAKNRARTVAGVSILSTMTNRQYHQKMLKSMAATRGATCVIGTTKFYG
GWDFMLKTLYKDVDNPHLMGWDYPKCDRAMPNMCRIFASLILARKHGTCCTTRDRFYR
LANECAQVLSEYVLCGGGYYVKPGGTSSGDATTAYANSVFNILQATTANVSALMGANG
NKIVDKEVKDMQFDLYVNVYRSTSPDPKFVDKYYAFLNKHFSMMILSDDGVVCYNSDY
AAKGYIAGIQNFKETLYYQNNVFMSEAKCWVETDLKKGPHEFCSQHTLYIKDGDDGYF
LPYPDPSRILSAGCFVDDIVKTDGTLMVERFVSLAIDAYPLTKHEDIEYQNVFWVYLQ
YIEKLYKDLTGHMLDSYSVMLCGDNSAKFWEEAFYRDLYSSPTTLQAVGSCVVCHSQT
SLRCGTCIRRPFLCCKCCYDHVIATPHKMVLSVSPYVCNAPGCGVSDVTKLYLGGMSY
FCVDHRPVCSFPLCANGLVFGLYKNMCTGSPSIVEFNRLATCDWTESGDYTLANTTTE
PLKLFAAETLRATEEASKQSYAIATIKEIVGERQLLLVWEAGKSKPPLNRNYVFTGYH
ITKNSKVQLGEYIFERIDYSDAVSYKSSTTYKLTVGDIFVLTSHSVATLTAPTIVNQE
RYVKITGLYPTITVPEEFASHVANFQKSGYSKYVTVQGPPGTGKSHFAIGLAIYYPTA
RVVYTACSHAAVDALCEKAFKYLNIAKCSRIIPAKARVECYDRFKVNETNSQYLFSTI
NALPETSADILVVDEVSMCTNYDLSIINARIKAKHIVYVGDPAQLPAPRTLLTRGTLE
PENFNSVTRLMCNLGPDIFLSMCYRCPKEIVSTVSALVYNNKLLAKKELSGQCFKILY
KGNVTHDASSAINRPQLTFVKNFITANPAWSKAVFISPYNSQNAVARSMLGLTTQTVD
SSQGSEYQYVIFCQTADTAHANNINRFNVAITRAQKGILCVMTSQALFESLEFTELSF
TNYKLQSQIVTGLFKDCSRETSGLSPAYAPTYVSVDDKYKTSDELCVNLNLPANIPYS
RVISRMGFKLDATVPGYPKLFITREEAVRQVRSWIGFDVEGAHASRNACGTNVPLQLG
FSTGVNFVVQPVGVVDTEWGNMLTGIAARPPPGEQFKHLVPLMHKGAAWPIVRRRIVQ
MLSDTLDKLSDYCTFVCWAHGFELTSASYFCKIGKEQKCCMCNRRAAAYSSPLQSYAC
WTHSCGYDYVYNPFFVDVQQWGYVGNLATNHDRYCSVHQGAHVASNDAIMTRCLAIHS
CFIERVDWDIEYPYISHEKKLNSCCRIVERNVVRAALLAGSFDKVYDIGNPKGIPIVD
DPVVDWHYFDAQPLTRKVQQLFYTEDMASRFADGLCLFWNCNVPKYPNNAIVCRFDTR
VHSEFNLPGCDGGSLYVNKHAFHTPAYDVSAFRDLKPLPFFYYSTTPCEVHGNGSMIE
DIDYVPLKSAVCITACNLGGAVCRKHATEYREYMEAYNLVSASGFRLWCYKTFDIYNL
WSTFTKVQGLENIAFNVVKQGHFIGVEGELPVAVVNDKIFTKSGVNDICMFENKTTLP
TNIAFELYAKRAVRSHPDFKLLHNLQADICYKFVLWDYERSNIYGTATIGVCKYTDID
VNSALNICFDIRDNGSLEKFMSTPNAIFISDRKIKKYPCIVGPDYAYFNGAIIRDSDV
VKQPVKFYLYKKVNNEFIDPTECIYTQSRSCSDFLPLSDMEKDFLSFDSDVFIKKYGL
ENYAFEHVVYGDFSHTTLGGLHLLIGLYKKQQEGHIIMEEMLKGSSTIHNYFITETNT
AAFKAVCSVIDLKLDDFVMILKSQDLGVVSKVVKVPIDLTMIEFMLWCKDGQVQTFYP
RLQASADWKPGHAMPSLFKVQNVNLERCELANYKQSIPMPRGVHMNIAKYMQLCQYLN
TCTLAVPANMRVIHFGAGSDKGIAPGTSVLRQWLPTDAIIIDNDLNEFVSDADITLFG
DCVTVRVSQQVDLVISDMYDPTTKNVTGSNESKALFFTYLCNLINNNLALGGSVAIKI
TEHSWSVELYELMGKFAWWTVFCTNANASSSEGFLLGINYLGTIKENIDGGAMHANYI
FWRNSTPMNLSTYSLFDLSKFQLKLKGTPVLQLKESQINELVISLLSQGKLLIRDNDT
LSVSTDVLVNTYRKLR"
CDS 279..13454
/codon_start=1
/product="orf1a"
/protein_id="AKL59400.1"
/db_xref="GI:829021051"
/translation="MSFVAGVIAQGARGTYRAALNSEKHQDHVSLTVPLCGSGNLVEK
LSPWFMDGENAYEVVKAMLLKKEPLLYVPIRLAGHTRHLPGPRVYLVERLIACENPFM
VNQLAYSSSANGSLVGTTLQGKPIGMFFPYDIELVTGKQNILLRKYGRGGYHYTPVHY
ERDNTSCPEWMDDFEADPKGKYAQNLLKKLIGGDVTPVDQYMCGVDGKPISAYAFLMA
KDGITKLADVEADVAARADDEGFITLKNNLYRLVWHVERKDVPYPKQSIFTINSVVQK
DGVENTPPHYFTLGCKILTLTPRNKWSGVSDLSLKQKLLYTFYGKESLENPTYIYHSA
FIECGSCGNDSWLTGNAIQGFACGCGASYTANDVEVQSSGMIKPNALLCATCPFAKGD
SCSSNCKHSVAQLVSYLSERCNVIADSKSFTLIFGGVAYAYFGCEEGTMYFVPRAKSV
VSRIGDSIFTGCTGSWNKVTQIANMFLEQTQHSLNFVGEFVVNDVVLAILSGTTTNVD
KIRQLLKGVTIDKLRDYLADYDVAVTAGPFMDNAINVGGTGLQYAAITAPYVVLTGLG
ESFKKVATIPYKVCNSVKDTLTYYAHSVLYRVFPYDMDSGVSSFSELLFDCVDLSVAS
TYFLVRLLQDKTGDFMSTIITSCQTAVSKLLDTCFEATEATFNFLLDLAGLFRIFLRN
AYVYTSQGFVVVNGKVSTLVKQVLDLLNKGMQLLHTKVSWAGSNISAVIYSGRESLIF
PSGTYYCVTTKAKSVQQDLDVILPGEFSKKQLGLLQPTDNSTTVSVTVSSNMVETVVG
QLEQTNMHSPDVIVGDYVIISEKLFVRSKEEDGFAFYPACTNGHAVPTLFRLKGGAPV
KKVAFGGDQVHEVAAVRSVTVEYNIHAVLDTLLASSSLRTFVVDKSLSIEEFADVVKE
QVSDLLVKLLRGMPIPDFDLDDFIDAPCYCFNAEGDASWSSTMIFSLHPVECDEECSE
VEASGLEEGESECISETSTEQVDVSHEVSDDEWAAAVDEAFPLDEAEDVTESVQEEAQ
PVEVPVEDIAQVVIADTLQETPVVSDTVEVPPQVVKLPSEPQTIQPEVKEVAPVYEAD
TEQTQSVTVKPKRLRKKRNVDPLSNFEHKVITECVTIVLGDAIQVAKCYGESVLVNAA
NTHLKHGGGIAGAINAASKGAVQKESDEYILAKGPLQVGDSVLLQGHSLAKNILHVVG
PDARAKQDVSLLSKCYKAMNAYPLVVTPLVSTGIFGVKPAVSFDYLIREAKTRVLVVV
NSQDVYKSLTIVDIPQSLTFSYDGLRGAIRKAKDYGFTVFVCTDNSANTKVLRNKGVD
YTKKFLTVDGVQYYCYTSKDTLDDILQQANKSVGIISMPLGYVSHGLDLIQAGSVVRR
VNVPYVCLLANKEQEAILMSEDVKLNPSEDFIKHVRTNGGYNSWHLVEGELLVQDLRL
NKLLHWSDQTICYKDSVFYVVKNSTAFPFETLSACRAYLDSRTTQQLTIEVLVTVDGV
NFRTVVLNNKNTYRSQLGCVFFNGADISDTIPDEKQNGHSLYLADNLTADETKALKEL
YGPVDPTFLHRFYSLKAAVHKWKMVVCDKVRSLKLSDNNCYLNAVIMTLDLLKDIKFV
IPALQHAFMKHKGGDSTDFIALIMAYGNCTFGAPDDASRLLHTVLAKAELCCSARMVW
REWCNVCGIKDVVLQGLKACCYVGVQTVEDLRARMTYVCQCGGERHRQIVEHTTPWLL
LSGTPNEKLVTTSTAPDFVAFNVFQGIETAVGHYVHACLKGGLILKFDSGTVSKTSDW
KCKVTDVLFPGQKYSSDCNVVRYSLDGNFRTEVDPDLSAFYVKDGKYFTSEPPVTYSP
ATILAGSVYTNSCLVSSDGQPGGDAISLSFNNLLGFDSSKPVTKKYTYSFLPKEDGDV
LLAEFDTYDPIYKNGAMYKGKPILWVNKASYDTNLNKFNRASLRQIFDVAPIELENKF
TPLSVASTPVEPPTVDVVALQQEMTIVKCKGLNKPFVKDNVSFVADDSGTPVVEYLSK
EDLHTLYVDPKYQVIVLKDNVLSSMLRLHTVESGDINVVAASGSLTRKVKLLFRASFY
FKEFATRTFTATTAVGSCIKSVVRHLGVTKGILTGCFSFVKMLFILPLAYFSDSKLGT
TEVKVSALKTAGVVTGNVVKQCCTAAVDLSMDKLRRVDWKSTLRLLLMLCTTMVLLSS
VYHLYVFNQVLSSDVMFEDAQGLKKFYKEVRAYLGISSACDGLASAYRANSFDVPTFC
ANRSAMCNWCLISQDSITHYPALKMVQTHLSHYVLNIDWLWFAFETGLAYMLYTSAFN
WLLLAGTLHYFFAQTSIFVDWRSYNYAVSSAFWLFTHIPMAGLVRMYNLLACLWLLRK
FYQHVINGCKDTACLLCYKRNRLTRVEASTVVCGGKRTFYITANGGISFCRRHNWNCV
DCDIAGVGNTFICEEVANDLTTALRRPINATDRSHYYVDSVTVKETVVQFNYRRDGQP
FYERFPLCAFTNLDKLKFKEVCKTTTGIPEYNFIIYDSSDRGQESLARSACVYYSQVL
CKSILLVDSSLVTSVGDSSEIATKMFDSFVNSFVSLYNVTRDKLEKLISTARDGVRRG
DNFHSVLTTFIDAARGPAGVESDVETNEIVDSVQYAHKHDIQITNESYNNYVPSYVKP
DSVSTSDLGSLIDCNAASVNQIVLRNSNGACIWNAAAYMKLSDALKRQIRIACRKCNL
AFRLTTSKLRANDNILSVRFTANKIVGGAPTWFNVLRDFTLKGYVLATIIVFLCAVLM
YLCLPTFSMVPVEFYEDRILDFKVLDNGIIRDVNPDDKCFANKHRSFTQWYHEHVGGV
YDNSITCPLTVAVIAGVAGARIPDVPTTLAWVNNQIIFFVSRVFANTGSVCYTPIDEI
PYKSFSDSGCILPSECTMFRDAEGRMTPYCHDPTVLPGAFAYSQMRPHVRYDLYDGNM
FIKFPEVVFESTLRITRTLSTQYCRFGSCEYAQEGVCITTNGSWAIFNDHHLNRPGVY
CGSDFIDIVRRLAVSLFQPITYFQLTTSLVLGIGLCAFLTLLFYYINKVKRAFADYTQ
CAVIAVVAAVLNSLCICFVASIPLCIVPYTALYYYATFYFTNEPAFIMHVSWYIMFGP
IVPIWMTCVYTVAMCFRHFFWVLAYFSKKHVEVFTDGKLNCSFQDAASNIFVINKDTY
AALRNSLTNDAYSRFLGLFNKYKYFSGAMETAAYREAAACHLAKALQTYSETGSDLLY
QPPNCSITSGVLQSGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCP
ADQLSDPNYDALLISMTNHSFSVQKHIGAPANLRVVGHAMQGTLLKLTVDVANPSTPA
YTFTTVKPGAAFSVLACYNGRPTGTFTVVMRPNYTIKGSFLCGSCGSVGYTKEGSVIN
FCYMHQMELANGTHTGSAFDGTMYGAFMDKQVHQVQLTDKYCSVNVVAWLYAAILNGC
AWFVKPNRTSVVSFNEWALANQFTEFVGTQSVDMLAVKTGVAIEQLLYAIQQLYTGFQ
GKQILGSTMLEDEFTPEDVNMQIMGVVMQSGVRKVTYGTAHWLFATLVSTYVIILQAT
KFTLWNYLFETIPTQLFPLLFVTMAFVMLLVKHKHTFLTLFLLPVAICLTYANIVYEP
TTPISSALIAVANWLAPTNAYMRTTHTDIGVYISMSLVLVIVVKRLYNPSLSNFALAL
CSGVMWLYTYSIGEASSPIAYLVFVTTLTSDYTITVFVTVNLAKVCTYAIFAYSPQLT
LVFPEVKMILLLYTCLGFMCTCYFGVFSFLNLKLRAPMGVYDFKVSTQEFRFMTANNL
TAPRNSWEAMALNFKLIGIGGTPCIKVAAMQSKLTDLKCTSVVLLSVLQQLHLEANSR
AWAFCVKCHNDILAATDPSEAFEKFVSLFATLMTFSGNVDLDALASDIFDTPSVLQAT
LSEFSHLATFAELEAAQKAYQEAMDSGDTSPQVLKALQKAVNIAKNAYEKDKAVARKL
ERMADQAMTSMYKQARAEDKKAKIVSAMQTMLFGMIKKLDNDVLNGIISNARNGCIPL
SVIPLCASNKLRVVIPDFTVWNQVVTYPSLNYAGALWDITVINNVDNEIVKSSDVVDS
NENLTWPLVLECTRASTSAVKLQNNEIKPSGLKTMVVSAGQEQTNCNTSSLAYYEPVQ
GRKMLMALLSDNAYLKWARVEGKDGFVSVELQPPCKFLIAGPKGPEIRYLYFVKNLNN
LHRGQVLGHIAATVRLQAGSNTEFASNSSVLSLVNFTVDPQKAYLDFVNAGGAPLTNC
VKMLTPKTGTGIAISVKPESTADQETYGGASVCLYCRAHIEHPDVSGVCKYKGKFVQI
PAQCVRDPVGFCLSNTPCNVCQYWIGYGCNCDSLRQVALPQSKDSNFLNESGVLL"
CDS 21456..25517
/note="S"
/codon_start=1
/product="spike protein"
/protein_id="AKL59401.1"
/db_xref="GI:829021052"
/translation="MIHSVFLLMFLLTPTESYVDVGPDSVKSACIEVDIQQTFFDKTW
PRPIDVSKADGIIYPQGRTYSNITITYQGLFPYQGDHGDMYVYSAGHATGTTPQKLFV
ANYSQDVKQFANGFVVRIGAAANSTGTVIISPSTRATIRKIYPAFMLGSSVGNFSDGK
MGRFFNHTLVLLPDGCGTLLRAFYCILEPRSGNHCPAGNSYTSFATYHTPATDCSDGN
YNRNASLNSFKEYFNLRNCTFMYTYNITEDEILEWFGITQTAQGVHLFSSRYVDLYGG
NMFQFATLPVYDTIKYYSIIPHSIRSIQSDRKAWAAFYVYKLQPLTFLLDFSVDGYIR
RAIDCGFNDLSQLHCSYESFDVESGVYSVSSFEAKPSGSVVEQAEGVECDFSPLLSGT
PPQVYNFKRLVFTNCNYNLTKLLSLFSVNDFTCSQISPAAIASNCYSSLILDYFSYPL
SMKSDLSVSSAGPISQFNYKQSFSNPTCLILATVPHNLTTITKPLKYSYINKCSRLLS
DDRTEVPQLVNANQYSPCVSILPSTVWEDGDYYRKQLSPLEGGGWLVASGSTVAMTEQ
LQMGFGITVQYGTDTNSVCPKLEFANDTKIASQLGNCVEYSLYGVSGRGVFQNCTAVG
VRQQRFVYDAYQNLVGYYSDDGNYYCLRACVSVPVSVIYDKETKTHATLFGSVACEHI
SSTMSQYSRSTRSMLKRRDSTYGPLQTPVGCVLGLVNSSLFVEDCKLPLGQSLCALPD
TPSTLTPRSVRSVPGEMRLASIAFNHPIQVDQLNSSYFKLSIPTNFSFGVTQEYIQTT
IQKVTVDCKQYVCNGFQKCEQLLREYGQFCSKINQALHGANLRQDDSVRNLFASVKSS
QSSPIIPGFGGDFNLTLLEPVSISTGSRSARSAIEDLLFDKVTIADPGYMQGYDDCMQ
QGPASARDLICAQYVAGYKVLPPLMDVNMEAAYTSSLLGSIAGVGWTAGLSSFAAIPF
AQSIFYRLNGVGITQQVLSENQKLIANKFNQALGAMQTGFTTTNEAFRKVQDAVNNNA
QALSKLASELSNTFGAISASIGDIIQRLDVLEQDAQIDRLINGRLTTLNAFVAQQLVR
SESAALSAQLAKDKVNECVKAQSKRSGFCGQGTHIVSFVVNAPNGLYFMHVGYYPSNH
IEVVSAYGLCDAANPTNCIAPVNGYFIKTNNTRIVDEWSYTGSSFYAPEPITSLNTKY
VAPQVTYQNISTNLPPPLLGNSTGIDFQDELDEFFKNVSTSIPNFGSLTQINTTLLDL
TYEMLSLQQVVKALNESYIDLKELGNYTYYNKWPWYIWLGFIAGLVALALCVFFILCC
TGCGTNCMGKLKCNRCCDRYEEYDLEPHKVHVH"
CDS 25532..25843
/codon_start=1
/product="orf3"
/protein_id="AKL59402.1"
/db_xref="GI:829021053"
/translation="MRVQRPPTLLLVFSLSFLVTAFSKPLYVPEHCQNYSGCMLRACI
KTAQADTAGLYTNFRIDVPSAESTGTQSVSVDRESTSTHDGLTEHVTSVNLFDVGYSV
N"
CDS 25852..26181
/codon_start=1
/product="orf4a"
/protein_id="AKL59403.1"
/db_xref="GI:829021054"
/translation="MDYVSLLNQIWQKYLNSPYTTCLYIPKPTAKYTPLVGTSLHPVL
WNCQLSFAGYTESAVNSTKALAKQDAAQRIAWLLHKDGGIPDGCSLYLRHSSLFAQSE
EEESFSN"
CDS 26093..26833
/codon_start=1
/product="orf4b"
/protein_id="AKL59404.1"
/db_xref="GI:829021055"
/translation="MEESLMDVPSTSGTQVYSRKARKRSHSPTKKLRYVKRRFSLLRP
EDLSVIVQPTHYVRVTFSDPNMWYLRSGHHLHSVHNWLKPYGGQPVSEYHITLALLNL
TDEDLARDFSPIALFLRNVRFELHEFALLRKTLVLNASEIYCANIHRFKPVYRVNTAI
PTIKDWLLVQGFSLYHSGLPLHMSISKLHALDDVTRNYIITMPCFRTYPQQMFVTPLA
VDVVSIRSSNQGNKQIVHSYPILHHPGF"
CDS 26840..27514
/codon_start=1
/product="orf5"
/protein_id="AKL59405.1"
/db_xref="GI:829021056"
/translation="MAFSASLFKPVQLVPVSPAFHRIESTDSIVFTYIPASGYVAALA
VNVCLIPLLLLLRQDTCRRSIIRTMVLYFLVLYNFLLAIVLVNGVHYPTGSCLIAFLV
ILIILWFVDRIRFCLMLNSYIPLFDMRSHFIRVSTVSSHGMVPVIHTKPLFIRNFDQR
CSCSRCFYLHSSTYIECTYISRFSKISLVSVTDFSLNGNVSTVFVPATRDSVPLHIIA
PSSLIV"
CDS 27590..27838
/note="E"
/codon_start=1
/product="envelope protein"
/protein_id="AKL59406.1"
/db_xref="GI:829021057"
/translation="MLPFVQERIGLFIVNFFIFTVVCAITLLVCMAFLTATRLCVQCM
TGFNTLLVQPALYLYNTGRSVYVKFQDSKPPLPPDEWV"
CDS 27853..28512
/note="M"
/codon_start=1
/product="membrane protein"
/protein_id="AKL59407.1"
/db_xref="GI:829021058"
/translation="MSNMTQLTEAQIIAIIKDWNFAWSLIFLLITIVLQYGYPSRSMT
VYVFKMFVLWLLWPSSMALSIFSAIYPIDLASQIISGIVAAVSAMMWISYFVQSIRLF
MRTGSWWSFNPETNCLLNVPIGGTTVVRPLVEDSTSVTAVVTNGHLKMAGMHFGACDY
DRLPNEVTVAKPNVLIALKMVKRQSYGTNSGVAIYHRYKAGNYRSPPITADIELALLR
A"
CDS 28566..29807
/note="N"
/codon_start=1
/product="nucleoprotein"
/protein_id="AKL59408.1"
/db_xref="GI:829021059"
/translation="MASPAAPRAVSFADNNDITNTNLSRGRGRNPKPRAAPNNTVSWY
TGLTQHGKVPLTFPPGQGVPLNANSTPAQNAGYWRRQDRKINTGNGIKQLAPRWYFYY
TGTGPEAALPFRAVKDGIVWVHEDGATDAPSTFGTRNPNNDSAIVTQFAPGTKLPKNF
HIEGTGGNSQSSSRASSVSRNSSRSSSQGSRSGNSTRGTSPGPSGIGAVGGDLLYLDL
LNRLQALESGKVKQSQPKVITKKDAAAAKNKMRHKRTSTKSFNMVQAFGLRGPGDLQG
NFGDLQLNKLGTEDPRWPQIAELAPTASAFMGMSQFKLTHQNNDDHGNPVYFLRYSGA
IKLDPKNPNYNKWLELLEQNIDAYKTFPKKEKKQKAPKEESTDQMSEPPKEQRVQGSI
TQRTRTRPSVQPGPMIDVNTD"

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Tue Jun 09, 2015 3:05 pm 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
1 gatttaagtg aatagcttgg ctatctcact tcccctcgtt ctcttgcaga actttgattt
61 taacgaactt aaataaaagc cctgttgttt agcgtattgt tgcacttgtc tggtgggatt
121 gtggcattaa tttgcctgct catctaggca gtggacatat gctcaacact gggtataatt
181 ctaattgaat actatttttc agttagagcg tcgtgtctct tgtacgtctc ggtcacaata
241 tacggtttcg tccggtgcgt ggcaattcgg ggcacatcat gtctttcgtg gctggtgtga
301 tcgcgcaagg tgcgcgcggt acgtatcgag cagcgctcaa ctctgaaaaa catcaagacc
361 atgtgtctct aactgtgcca ctctgtggtt caggaaacct ggttgaaaaa ctttcaccat
421 ggttcatgga tggcgaaaat gcctatgaag tggtgaaggc catgttactt aaaaaagagc
481 cacttctcta tgtgcccatc cggctggctg gacacactag acacctccca ggtcctcgtg
541 tgtacctggt tgagaggctc attgcttgtg aaaatccatt catggttaac caattggctt
601 atagctctag tgcaaatggc agcctggttg gcacaacttt gcagggcaag cctattggta
661 tgttcttccc ttatgacatc gaacttgtca caggaaagca aaatattctc ctgcgcaagt
721 atggccgtgg tggttatcac tacaccccag tccactatga gcgagacaac acctcttgcc
781 ctgagtggat ggacgatttt gaggcggatc ctaaaggcaa atatgcccag aatctgctta
841 agaagttgat tggcggtgat gtcactccag ttgaccaata catgtgtggc gttgatggaa
901 aacccattag tgcctacgca tttttaatgg ccaaggatgg aataaccaaa ctggctgatg
961 ttgaagcgga cgtcgcagca cgtgctgatg acgaaggctt catcacatta aagaacaatc
1021 tatatagatt ggtttggcat gttgagcgta aagacgttcc atatcctaag caatctattt
1081 ttactattaa tagtgtggtc caaaaggatg gtgttgaaaa cactcctcct cactatttta
1141 ctcttggatg caaaatttta acgctcaccc cacgcaacaa gtggagtggc gtttctgact
1201 tgtccctcaa acaaaaactc ctttacacct tctatggtaa ggagtcactt gagaacccaa
1261 cctacattta ccactccgca ttcattgagt gtggaagttg tggtaatgat tcctggctta
1321 cagggaatgc tatccaaggg tttgcctgtg gatgtggggc atcatataca gctaatgatg
1381 tcgaagtcca atcatctggc atgattaagc caaatgctct tctttgtgct acttgcccct
1441 ttgctaaggg tgacagctgt tcttctaatt gcaaacattc agttgctcag ttggttagtt
1501 acctttctga acgctgtaat gttattgctg attctaagtc cttcacactt atctttggtg
1561 gcgtagctta cgcctacttt ggatgtgagg aaggtactat gtactttgtg cctagagcta
1621 agtctgttgt ctcaaggatt ggagactcca tctttacagg ctgtactggc tcttggaaca
1681 aggtcactca aattgctaac atgttcttgg aacagactca gcattccctt aactttgtgg
1741 gagagttcgt tgtcaacgat gttgtcctcg caattctctc tggaaccaca actaatgttg
1801 acaaaatacg ccagcttctc aaaggtgtca ccattgacaa gttgcgtgat tatttagctg
1861 actatgacgt agcagtcact gccggcccat tcatggataa tgctattaat gttggtggta
1921 caggattaca gtatgccgcc attactgcac cttatgtagt tctcactggc ttaggtgagt
1981 cctttaagaa agttgcaacc ataccgtaca aggtttgcaa ctctgttaag gatactctga
2041 cttattatgc tcacagcgtg ttgtacagag tttttcctta tgacatggat tctggtgtgt
2101 catcctttag tgaactactt tttgattgcg ttgatctttc agtagcttct acctattttt
2161 tagtccgcct cttgcaagat aagactggcg actttatgtc tacaattatt acttcctgcc
2221 aaactgctgt tagtaagctt ctagatacat gttttgaagc tacagaagca acatttaact
2281 tcttgttaga tttggcagga ttgttcagaa tctttcttcg caatgcctat gtgtacactt
2341 cacaagggtt tgtggtggtc aatggcaaag tttctacact tgtcaaacaa gtgttagact
2401 tgcttaataa gggtatgcaa cttttgcata caaaggtctc ctgggctggt tctaatatca
2461 gtgctgttat ctacagcggc agggagtctc taatattccc atcgggaacc tattactgtg
2521 tcaccactaa ggctaagtcc gttcaacaag atcttgacgt tattttgcct ggtgagtttt
2581 ccaagaagca gttaggactg ctccaaccta ctgacaattc tacaactgtt agtgttactg
2641 tatccagtaa catggttgaa actgttgtgg gtcaacttga gcaaactaat atgcatagtc
2701 ctgatgttat agtaggtgac tatgtcatta ttagtgaaaa attgtttgtg cgtagtaagg
2761 aagaagacgg attcgccttc taccctgctt gcactaatgg tcatgctgta ccgactctct
2821 ttagacttaa gggaggtgca cctgtaaaaa aagtagcctt tggcggtgat caagtacatg
2881 aggttgctgc tgtaagaagt gttactgtcg agtacaacat tcatgctgta ttagacacac
2941 tacttgcttc ttctagtctt agaacctttg ttgtagataa gtctttgtca attgaggagt
3001 ttgctgacgt agtaaaggaa caagtctcag acttgcttgt taaattactg cgtggaatgc
3061 cgattccaga ttttgattta gacgatttta ttgacgcacc atgctattgc tttaacgctg
3121 agggtgatgc atcttggtct tctactatga tcttctctct tcaccccgtc gagtgtgacg
3181 aggagtgttc tgaagtagag gcttcaggtt tagaagaagg tgaatcagag tgcatttctg
3241 agacttcaac tgaacaagtt gacgtttctc atgaggtttc tgacgacgag tgggctgctg
3301 cagttgatga agcgttcccc ctcgatgaag cagaagatgt tactgaatct gtgcaagaag
3361 aagcacaacc agtagaagta cctgttgaag atattgcgca ggttgtcata gctgacacct
3421 tacaggaaac tcctgttgtg tctgatactg ttgaagtccc accgcaagtg gtgaaacttc
3481 cgtctgaacc tcagactatc cagcccgagg taaaagaagt tgcacctgtc tatgaggctg
3541 ataccgaaca gacacagagt gttactgtta aacctaagag gttacgcaaa aagcgtaatg
3601 ttgacccttt gtccaatttt gaacataagg ttattacaga gtgcgttacc atagttttag
3661 gtgacgcaat tcaagtagcc aagtgctatg gggagtctgt gttagttaat gctgctaaca
3721 cacatcttaa gcatggcggt ggtatcgctg gtgctattaa tgcggcttca aaaggggctg
3781 tccaaaaaga gtcagatgag tatattctgg ctaaagggcc gttacaagta ggagattcag
3841 ttctcttgca aggccattct ctagctaaga atatcctgca tgtcgtaggc ccagatgccc
3901 gcgctaaaca ggatgtttct ctccttagta agtgctataa ggctatgaat gcatatcctc
3961 ttgtagtcac tcctcttgtt tcaacaggca tatttggtgt aaaaccagct gtgtcttttg
4021 attatcttat tagagaggct aagactagag ttttagtcgt cgttaattcc caagatgtct
4081 ataagagtct taccatagtt gacattccac agagtttgac tttttcatat gatgggttac
4141 gtggcgcaat acgtaaagct aaagattatg gttttactgt ttttgtgtgc acagacaact
4201 ctgctaacac taaagttctt aggaacaagg gtgttgatta tactaagaag tttcttacag
4261 ttgacggtgt gcaatattat tgctacacgt ctaaggacac tttagatgat atcttacaac
4321 aggctaataa gtctgttggt attatatcta tgcctttggg atatgtgtct catggtttag
4381 acttaattca agcagggagt gtcgtgcgta gagttaacgt gccctacgtg tgtctcctag
4441 ctaataaaga gcaagaagct attttgatgt ctgaagacgt taagttaaac ccttcagaag
4501 attttataaa gcacgtccgc actaatggtg gttacaattc ttggcattta gtcgagggtg
4561 aactattggt gcaagactta cgcttaaata agctcctgca ttggtctgat caaaccatat
4621 gctacaagga tagtgtgttt tatgttgtaa agaatagtac agcttttcca tttgaaacac
4681 tttcagcatg tcgtgcgtat ttggattcac gcacgacaca gcagttaaca atcgaagtct
4741 tagtgactgt cgatggtgta aattttagaa cagtcgttct aaataataag aacacttata
4801 gatcacagct tggatgcgtt ttctttaatg gtgctgatat ttctgatacc attcctgatg
4861 agaaacagaa tggtcacagt ttatatctag cagacaattt gactgctgat gaaacaaagg
4921 cgcttaaaga gttatatggc cccgttgatc ctactttctt acacagattc tattcactta
4981 aggctgcagt ccataagtgg aagatggttg tgtgtgataa ggtacgttct ctcaaattga
5041 gtgataataa ttgttatctt aatgcagtta ttatgacact tgatttattg aaggacatta
5101 aatttgttat acctgctcta cagcatgcat ttatgaaaca taagggcggt gattcaactg
5161 acttcatagc cctcattatg gcttatggca attgcacatt tggtgctcca gatgatgcct
5221 ctcggttact tcataccgtg cttgcaaagg ctgagttatg ctgttctgca cgcatggttt
5281 ggagagagtg gtgcaatgtc tgtggcataa aagatgttgt tctacaaggc ttaaaagctt
5341 gttgttacgt gggtgtgcaa actgttgaag atctgcgtgc tcgcatgaca tatgtatgcc
5401 agtgtggtgg tgaacgtcat cggcaaatag tcgaacacac caccccctgg ttgctgctct
5461 caggcacacc aaatgaaaaa ttggtgacaa cctccacggc gcctgatttt gtagcgttta
5521 atgtctttca gggcattgaa acggctgttg gccattatgt tcatgcttgc ctgaagggtg
5581 gtcttatttt aaagtttgac tctggcaccg ttagcaagac ttcagactgg aagtgcaagg
5641 tgacagatgt acttttcccc ggccaaaaat acagtagcga ttgtaatgtc gtacggtatt
5701 ctttggacgg taatttcaga acagaggttg atcccgacct atctgctttc tatgttaagg
5761 atggtaaata ctttacaagt gaaccacccg taacatattc accagctaca attttagctg
5821 gtagtgtcta cactaatagc tgccttgtat cgtctgatgg acaacctggc ggtgatgcta
5881 ttagtttgag ttttaataac cttttagggt ttgattctag taaaccagtc actaagaaat
5941 acacttactc cttcttgcct aaagaagacg gcgatgtgtt gttggctgag tttgacactt
6001 atgaccctat ttataagaat ggtgccatgt ataaaggcaa accaattctt tgggtcaaca
6061 aagcatctta tgatactaat cttaataagt tcaatagagc tagtttgcgt caaatttttg
6121 acgtagcccc cattgaactc gaaaataaat tcacaccttt gagtgtggcg tccacaccag
6181 ttgaacctcc aactgtagat gtggtagcac ttcaacagga aatgacaatt gtcaaatgta
6241 agggtttaaa taaacctttc gtgaaggaca atgtcagttt cgttgctgat gactcaggta
6301 ctcccgttgt tgagtatctg tctaaagaag atctacatac attgtatgta gaccctaagt
6361 atcaagtcat tgtcttaaaa gacaatgtac tttcttctat gcttagattg cacaccgttg
6421 agtcaggtga tattaacgtt gttgcagctt ccggatcttt gacacgtaaa gtgaagttac
6481 tatttagggc ttcattttat ttcaaagaat ttgctacccg cactttcact gctaccactg
6541 ctgtaggtag ttgtataaag agtgtagtgc ggcatctagg tgttactaaa ggcatattga
6601 caggctgttt tagttttgtc aagatgttat ttattcttcc actagcttac tttagtgatt
6661 caaaactcgg caccacagag gttaaagtga gtgctttgaa aacagctggc gttgtgacag
6721 gtaatgttgt aaaacagtgt tgcactgctg ctgttgattt aagtatggat aagttgcgcc
6781 gtgtggattg gaaatcaacc ctacggttgt tacttatgtt atgcacaact atggtattgt
6841 tgtcttctgt gtatcacttg tatgtcttca atcaggtctt atcaagtgat gttatgtttg
6901 aagatgccca aggtttgaaa aagttctaca aagaagttag agcttaccta ggaatctctt
6961 ctgcttgtga cggtcttgct tcagcttata gggcgaattc atttgatgta cctacattct
7021 gcgcaaaccg ttctgcaatg tgtaattggt gcttgattag ccaagattcc ataactcact
7081 acccagctct taagatggtt caaacacatc ttagccacta tgttcttaac atagattggt
7141 tgtggtttgc attcgagact ggtttggcat acatgctcta tacctcggcc ttcaactggt
7201 tgttgttggc aggtacattg cattatttct ttgcacagac ttccatattt gtagactggc
7261 ggtcatacaa ttatgctgtg tctagtgcct tctggttatt tacccacatt ccaatggcgg
7321 gtttggtacg aatgtataat ttgttagcat gcctttggct tttacgcaag ttttatcagc
7381 atgtaatcaa tggttgcaaa gatacggcat gcttgctctg ctataagagg aaccgactta
7441 ctagagttga agcttctacc gttgtctgtg gtggaaaacg tacgttttat atcacagcaa
7501 atggcggtat ttcattctgt cgtaggcata attggaattg tgtggattgt gacattgcag
7561 gtgtggggaa taccttcatc tgtgaagaag tcgcaaatga cctcactacc gccctacgca
7621 ggcctattaa cgctacggat agatcacatt attatgtgga ttccgttaca gttaaagaga
7681 ctgttgttca gtttaattat cgtagagacg gtcaaccatt ctacgagcgg tttcccctct
7741 gcgcttttac aaatctagat aagttgaagt tcaaagaggt ctgtaaaact actactggta
7801 tacctgaata caactttatc atctacgact catcagatcg tggccaggaa agtttagcta
7861 ggtctgcatg tgtttattat tctcaagtct tgtgtaaatc aattcttttg gttgactcaa
7921 gtttggttac ttctgttggt gattctagtg aaatcgccac taaaatgttt gattcctttg
7981 ttaatagttt cgtctcgctg tataatgtca cacgcgataa gttggaaaaa cttatctcta
8041 ctgctcgtga tggcgtaagg cgaggcgata acttccatag tgtcttaaca acattcattg
8101 acgcagcacg aggccccgca ggtgtggagt ctgatgttga gaccaatgaa attgttgact
8161 ctgtgcagta tgctcataaa catgacatac aaattactaa tgagagttac aataattatg
8221 taccctcata tgttaaacct gatagtgtgt ctaccagtga tttaggtagt ctcattgatt
8281 gtaatgcggc ttcagttaac caaattgtct tgcgtaattc taatggtgct tgtatttgga
8341 acgctgctgc atatatgaaa ctctcggatg cacttaaacg acagattcgc attgcatgcc
8401 gtaagtgtaa tttagctttc cggttaacca cctcaaagct acgcgctaat gataatatct
8461 tatcagttag attcactgct aacaaaattg ttggtggtgc tcctacatgg tttaatgtgt
8521 tgcgtgactt tacgttaaag ggttacgttc ttgctaccat tattgtgttt ctgtgtgctg
8581 tactgatgta tttgtgttta cctacatttt ctatggtacc tgttgaattt tatgaagacc
8641 gcatcttgga ctttaaagtt cttgataatg gtatcattag ggatgtaaat cctgatgata
8701 agtgctttgc taataagcac cggtccttca cacaatggta tcatgagcat gttggtggtg
8761 tctatgacaa ctctatcaca tgcccattga cagttgcagt aattgctgga gttgctggtg
8821 ctcgcattcc agacgtacct actacattgg cttgggtgaa caatcagata attttctttg
8881 tttctcgagt ctttgctaat acaggcagtg tttgctacac tcctatagat gagataccct
8941 ataagagttt ctctgatagt ggttgcattc ttccatctga gtgcactatg tttagggatg
9001 cagagggccg tatgacacca tactgccatg atcctactgt tttgcctggg gcttttgcgt
9061 acagtcagat gaggcctcat gttcgttacg acttgtatga tggtaacatg tttattaaat
9121 ttcctgaagt agtatttgaa agtacactta ggattactag aactctgtca actcagtact
9181 gccggttcgg tagttgtgag tatgcacaag agggtgtttg tattaccaca aatggctcgt
9241 gggccatttt taatgaccac catcttaata gacctggtgt ctattgtggc tctgatttta
9301 ttgacattgt caggcggtta gcagtatcac tgttccagcc tattacttat ttccaattga
9361 ctacctcatt ggtcttgggt ataggtttgt gtgcattcct gactttgctc ttctattata
9421 ttaataaagt aaaacgtgct tttgcagatt acacccagtg tgctgtaatt gctgttgttg
9481 ctgctgttct taatagcttg tgcatctgct ttgttgcctc tataccattg tgtatagtac
9541 cttacactgc attgtactat tatgctacat tctattttac taatgagcct gcatttatta
9601 tgcatgtttc ttggtacatt atgttcgggc ctatcgttcc catatggatg acctgcgtct
9661 atacagttgc aatgtgcttt agacacttct tctgggtttt agcttatttt agtaagaaac
9721 atgtagaagt ttttactgat ggtaagctta attgtagttt ccaggacgct gcctctaata
9781 tctttgttat taacaaggac acttatgcag ctcttagaaa ctctttaact aatgatgcct
9841 attcacgatt tttggggttg tttaacaagt ataagtactt ctctggtgct atggaaacag
9901 ccgcttatcg tgaagctgca gcatgtcatc ttgctaaagc cttacaaaca tacagtgaga
9961 ctggtagtga tcttctttac caaccaccca actgtagcat aacctctggc gtgttgcaaa
10021 gcggtttggt gaaaatgtca catcccagtg gagatgttga ggcttgtatg gttcaggtta
10081 cctgcggtag catgactctt aatggtcttt ggcttgacaa cacagtctgg tgcccacgac
10141 acgtaatgtg cccggctgac cagttgtctg atcctaatta tgatgccttg ttgatttcta
10201 tgactaatca tagtttcagt gtgcaaaaac acattggcgc tccagcaaac ttgcgtgttg
10261 ttggtcatgc catgcaaggc actcttttga agttgactgt cgatgttgct aaccctagca
10321 ctccagccta cacttttaca acagtgaaac ctggcgcagc atttagtgtg ttagcatgct
10381 ataatggtcg tccgactggt acattcactg ttgtaatgcg ccctaactac acaattaagg
10441 gttcctttct gtgtggttct tgtggtagtg ttggttacac caaggagggt agtgtgatca
10501 atttttgtta catgcatcaa atggaacttg ctaatggtac acataccggt tcagcatttg
10561 atggtactat gtatggtgcc tttatggata aacaagtgca ccaagttcag ttaacagaca
10621 aatactgcag tgttaatgta gtagcttggc tttacgcagc aatacttaat ggttgcgctt
10681 ggtttgtaaa acctaatcgc actagtgttg tttcttttaa tgaatgggct cttgccaacc
10741 aattcactga atttgttggc actcaatccg ttgacatgtt agctgtcaaa acaggcgttg
10801 ctattgaaca gctgctttat gcgatccaac aactttatac tgggttccag ggaaagcaaa
10861 tccttggcag tactatgttg gaagatgaat tcacacctga ggatgttaat atgcagatta
10921 tgggtgtggt tatgcagagt ggtgtgagaa aagttacata tggtactgcg cattggttgt
10981 tcgcgaccct tgtttcaacc tatgtgataa tcttacaagc cactaaattt actttgtgga
11041 actacttgtt tgagactatt cccacacagt tgttcccact cttatttgtg actatggcct
11101 tcgttatgtt gttggttaaa cacaaacaca cctttttgac acttttcttg ttgcctgtgg
11161 ctatttgttt gacttatgca aacatagtct acgagcccac tactcccatt tcgtcagcgc
11221 tgattgcagt tgcaaattgg cttgccccca ctaatgctta tatgcgcact acacatactg
11281 atattggtgt ctacattagt atgtcacttg tattagtcat tgtagtgaag agattgtaca
11341 acccatcact ttctaacttt gcgttagcat tgtgcagtgg tgtaatgtgg ttgtacactt
11401 atagcattgg agaagcctca agccccattg cctatctggt ttttgtcact acactcacta
11461 gtgattatac gattacagtc tttgttactg tcaaccttgc aaaagtttgc acttatgcca
11521 tctttgctta ctcaccacag cttacacttg tgtttccgga agtgaagatg atacttttat
11581 tatacacatg tttaggtttc atgtgtactt gctattttgg tgtcttctct tttttgaacc
11641 ttaagcttag agcacctatg ggtgtctatg actttaaggt ctcaacacaa gagttcagat
11701 tcatgactgc taacaatcta actgcaccta gaaattcttg ggaggctatg gctctgaact
11761 ttaagttaat aggtattggc ggtacacctt gtataaaggt tgctgctatg cagtctaaac
11821 ttacagatct taaatgcaca tctgtggttc tcctctctgt gctccaacag ttacacttag
11881 aggctaatag tagggcctgg gctttctgtg ttaaatgcca taatgacata ttggcagcaa
11941 cagaccccag tgaggctttc gagaaattcg taagtctctt tgccacttta atgacttttt
12001 ctggtaatgt agatcttgat gcgttagcta gtgatatttt tgacactcct agcgtacttc
12061 aagctactct ttctgagttt tcacacttag ctacctttgc tgagttggaa gctgcgcaga
12121 aagcctatca ggaagctatg gactctggtg acacctcacc acaagttctt aaggctttgc
12181 agaaggctgt taatatagct aaaaacgcct atgagaagga taaggcagtg gcccgtaagt
12241 tagaacgtat ggctgatcag gctatgactt ctatgtataa gcaagcacgt gctgaagaca
12301 agaaagcaaa aattgtcagt gctatgcaaa ctatgttgtt tggtatgatt aagaagctcg
12361 acaacgatgt tcttaatggt atcatttcta acgctaggaa tggttgtata cctcttagtg
12421 tcattccact gtgtgcttca aataaacttc gcgttgtaat tcctgacttc accgtctgga
12481 atcaggtagt cacatatccc tcgcttaact acgctggggc tttgtgggac attacagtta
12541 taaacaatgt ggacaatgaa attgttaagt cttcagatgt tgtagacagc aatgaaaatt
12601 taacatggcc acttgtttta gaatgcacta gggcatccac ttctgccgtt aagttgcaaa
12661 ataatgagat caaaccttca ggtttaaaaa ccatggttgt gtctgcaggt caagagcaaa
12721 ctaactgtaa tactagttcc ttagcttatt acgaacctgt gcagggtcgt aaaatgctga
12781 tggctcttct ttctgataat gcctatctca aatgggcgcg tgttgaaggt aaggacggat
12841 ttgttagtgt agagctacaa cctccttgca aattcttgat tgcgggacca aaaggacctg
12901 aaatccgata tctctatttt gttaaaaatc ttaacaacct tcatcgcggg caagtgttag
12961 ggcacattgc tgcgactgtt agattgcaag ctggttctaa caccgagttt gcctctaatt
13021 cttcggtgtt gtcacttgtt aacttcaccg ttgatcctca aaaagcttat ctcgatttcg
13081 tcaatgcggg aggtgcccca ttgacaaatt gtgttaagat gcttactcct aaaactggta
13141 caggtatagc tatatctgtt aaaccagaga gtacagctga tcaagagact tatggtggag
13201 cttcagtgtg tctctattgc cgtgcgcata tagaacatcc tgatgtctct ggtgtttgta
13261 aatataaggg taagtttgtc caaatccctg ctcagtgtgt ccgtgaccct gtgggatttt
13321 gtttgtcaaa taccccctgt aatgtctgtc aatattggat tggatatggg tgcaattgtg
13381 actcgcttag gcaagtagca ctgccccaat ctaaagattc caatttttta aacgagtccg
13441 gggttctatt gtaaatgccc gaatagaacc ctgttcaagt ggtttgtcca ctgatgtcgt
13501 ctttagggca tttgacatct gcaactataa ggctaaggtt gctggtattg gaaaatacta
13561 caagactaat acttgtaggt ttgtagaatt agatgaccaa gggcatcatt tagactccta
13621 ttttgtcgtt aagaggcata ctatggagaa ttatgaacta gagaagcact gttacgattt
13681 gttacgtgac tgtgatgctg tagctcccca tgatttcttc atctttgatg tagacaaagt
13741 taaaacacct catattgtac gtcagcgttt aactgagtac actatgatgg atcttgtata
13801 tgccctgagg cactttgatc aaaatagcga agtgcttaag gctatcttag tgaagtatgg
13861 ttgctgtgat gttacctact ttgaaaataa actctggttt gattttgttg aaaatcccag
13921 tgttattggt gtttatcata aacttggaga acgtgtacgc caagctatct taaacactgt
13981 taaattttgt gaccacatgg tcaaggctgg tttagtcggt gtgctcacac tagacaacca
14041 ggaccttaat ggcaagtggt atgattttgg tgacttcgta atcactcaac ctggttcagg
14101 agtagctata gttgatagct actattctta tttgatgcct gtgctctcaa tgaccgattg
14161 tctggccgct gagacacata gggattgtga ttttaataaa ccactcattg agtggccact
14221 tactgagtat gattttactg attataaggt acaactcttt gagaagtact ttaaatattg
14281 ggatcagacg tatcacgcaa attgcgttaa ttgtactgat gaccgttgtg tgttacattg
14341 tgctaatttc aatgtattgt ttgctatgac catgcctaag acttgtttcg gacccatagt
14401 ccgaaagatc tttgttgatg gcgtgccatt tgtagtatct tgtggttatc actacaaaga
14461 attaggttta gtcatgaata tggatgttag tctccataga cataggctct ctcttaagga
14521 gttgatgatg tatgccgctg atccagccat gcacattgcc tcctctaacg cttttcttga
14581 tttgaggaca tcatgtttta gtgtcgctgc acttacaact ggtttgactt ttcaaactgt
14641 gcggcctggc aattttaacc aagacttcta tgatttcgtg gtatctaaag gtttctttaa
14701 ggagggctct tcagttacgc tcaaacattt tttctttgct caagatggta atgctgctat
14761 tacagattat aattactatt cttataatct gcctactatg tgtgacatca aacaaatgtt
14821 gttctgcatg gaagttgtaa acaagtactt cgaaatctat gacggtggtt gtcttaatgc
14881 ttctgaagtg gttgttaata atttagacaa gagtgctggc catcctttta ataagtttgg
14941 caaagctcgt gtctattatg agagcatgtc ttaccaggag caagatgaac tctttgccat
15001 gacaaagcgt aacgtcattc ctaccatgac tcaaatgaat ctaaaatatg ctattagtgc
15061 taagaataga gctcgcactg ttgcaggcgt gtccatactt agcacaatga ctaatcgcca
15121 gtaccatcag aaaatgctta agtccatggc tgcaactcgt ggagcgactt gcgtcattgg
15181 tactacaaag ttctatggtg gctgggattt catgcttaaa acattgtaca aagatgttga
15241 taatccgcat cttatgggtt gggattaccc taagtgtgat agagctatgc ctaatatgtg
15301 tagaatcttc gcttcactca tattagctcg taaacatggc acttgttgta ctacaaggga
15361 cagattttat cgcttggcaa atgagtgtgc tcaggtgcta agcgaatatg ttctatgtgg
15421 tggtggttac tacgtcaaac ctggaggtac cagtagcgga gatgccacca ctgcatatgc
15481 caatagtgtc tttaacattt tgcaggcgac aactgctaat gtcagtgcac ttatgggtgc
15541 taatggcaac aagattgttg acaaagaagt taaagacatg cagtttgatt tgtatgtcaa
15601 tgtttacagg agcactagcc cagaccccaa atttgttgat aaatactatg cttttcttaa
15661 taagcacttt tctatgatga tactgtctga tgacggtgtc gtttgctata atagtgatta
15721 tgcagctaag ggttacattg ctggaataca gaattttaag gaaacgctgt attatcagaa
15781 caatgtcttt atgtctgaag ctaaatgctg ggtggaaacc gatctgaaga aagggccaca
15841 tgaattctgt tcacagcata cgctttatat taaggatggc gacgatggtt acttccttcc
15901 ttatccagac ccttcaagaa ttttgtctgc cggttgcttt gtagatgata tcgttaagac
15961 tgacggtaca ctcatggtag agcggtttgt gtctttggct atagatgctt accctctcac
16021 aaagcatgaa gatatagaat accagaatgt attctgggtc tacttacagt atatagaaaa
16081 actgtataaa gaccttacag gacacatgct tgacagttat tctgtcatgc tatgtggtga
16141 taattctgct aagttttggg aagaggcatt ctacagagat ctctatagtt cgcctaccac
16201 tttgcaggct gtcggttcat gcgttgtatg ccattcacag acttccctac gctgtgggac
16261 atgcatccgt agaccatttc tctgctgtaa atgctgctat gatcatgtta tagcaactcc
16321 acataagatg gttttgtctg tttctcctta cgtttgtaat gcccctggtt gtggcgtttc
16381 agacgttact aagctatatt taggtggtat gagctacttt tgtgtagatc atagacctgt
16441 gtgtagtttt ccactttgcg ctaatggtct tgtattcggc ttatacaaga atatgtgcac
16501 aggtagtcct tctatagttg aatttaatag gttggctacc tgtgactgga ctgaaagtgg
16561 tgattacacc cttgccaata ctacaacaga accactcaaa ctttttgctg ctgagacttt
16621 acgtgccact gaagaggcgt ctaagcagtc ttatgctatt gccaccatca aagaaattgt
16681 tggtgagcgc caactattac ttgtgtggga ggctggcaag tccaaaccac cactcaatcg
16741 taattatgtt tttactggtt atcatataac caaaaatagt aaagtgcagc tcggtgagta
16801 catcttcgag cgcattgatt atagtgatgc tgtatcctac aagtctagta caacgtataa
16861 actgactgta ggtgacatct tcgtacttac ctctcactct gtggctacct tgacggcgcc
16921 cacaattgtg aatcaagaga ggtatgttaa aattactggg ttgtacccaa ccattacggt
16981 acctgaagag ttcgcaagtc atgttgccaa cttccaaaaa tcaggttata gtaaatatgt
17041 cactgttcag ggaccacctg gcactggcaa aagtcatttt gctatagggt tagcgattta
17101 ctaccctaca gcacgtgttg tttatacagc atgttcacac gcagctgttg atgctttgtg
17161 tgaaaaagct tttaaatatt tgaacattgc taaatgttcc cgtatcattc ctgcaaaggc
17221 acgtgttgag tgctatgaca ggtttaaagt taatgagaca aattctcaat atttgtttag
17281 tactattaat gctctaccag aaacttctgc cgatattctg gtggttgatg aggttagtat
17341 gtgcactaat tatgatcttt caattattaa tgcacgtatt aaagctaagc acattgtcta
17401 tgtaggagat ccagcacagt tgccagctcc taggactttg ttgactagag gcacattgga
17461 accagaaaat ttcaatagtg tcactagatt gatgtgtaac ttaggtcctg acatattttt
17521 aagtatgtgc tacaggtgtc ctaaggaaat agtaagcact gtgagcgctc ttgtctacaa
17581 taataaattg ttagccaaga aggagctttc aggccagtgc tttaaaatac tctataaggg
17641 caatgtgacg catgatgcta gctctgccat taatagacca caactcacat ttgtgaagaa
17701 ttttattact gccaatccgg catggagtaa ggcagtcttt atttcgcctt ataattcaca
17761 gaatgctgtg gctcgttcaa tgctgggtct tactactcag actgttgatt cctcacaggg
17821 ttcagaatac cagtacgtta tcttctgtca aacagcagat acggcacatg ctaacaacat
17881 taacagattt aatgttgcaa tcactcgtgc ccaaaaaggt attctttgtg ttatgacatc
17941 tcaggcactc tttgagtcct tagagtttac tgaattgtct tttactaatt acaagctcca
18001 gtctcagatt gtaactggcc tttttaaaga ttgctctaga gaaacttctg gcctctcacc
18061 tgcttatgca ccaacatacg ttagtgttga tgacaagtat aagacgagtg atgagctttg
18121 cgtgaatctt aatttacccg caaatatccc atactctcgt gttatttcca ggatgggctt
18181 taaactcgat gcaacagttc ctggatatcc taagcttttc attactcgtg aagaggctgt
18241 aaggcaagtt cgaagctgga taggcttcga tgttgagggt gctcatgctt cccgtaatgc
18301 atgtggcacc aatgtgcctc tacaattagg attttcaact ggtgtgaact ttgttgttca
18361 gccagttggt gttgtagaca ctgagtgggg taacatgtta acgggcattg ctgcccgtcc
18421 tccaccaggt gaacagttta agcacctcgt gcctcttatg cataaggggg ctgcgtggcc
18481 tattgttaga cgacgtatag tgcaaatgtt gtcagacact ttagacaaat tgtctgatta
18541 ctgtacgttt gtttgttggg ctcatggctt tgaattaacg tctgcatcat acttttgcaa
18601 gataggtaag gaacagaagt gttgcatgtg caatagacgc gctgcagcgt actcttcacc
18661 tctgcaatct tatgcctgct ggactcattc ctgcggttat gattatgtct acaacccttt
18721 ctttgtcgat gttcaacagt ggggttatgt aggcaatctt gctactaatc acgatcgtta
18781 ttgctctgtc catcaaggag ctcatgtggc ttctaatgat gcaataatga ctcgttgttt
18841 agctattcat tcttgtttta tagaacgtgt ggattgggat atagagtatc cttatatctc
18901 acatgaaaag aaattgaatt cctgttgtag aatcgttgag cgcaacgtcg tacgtgctgc
18961 tcttcttgcc ggttcatttg acaaagtcta tgatattggc aatcctaaag gaattcctat
19021 tgttgatgac cctgtggttg attggcatta ttttgatgca cagcccttga ccaggaaggt
19081 acaacagctt ttctatacag aggacatggc ctcaagattt gctgatgggc tctgcttatt
19141 ttggaactgt aatgtaccaa aatatcctaa taatgcaatt gtatgcaggt ttgacacacg
19201 tgtgcattct gagttcaatt tgccaggttg tgatggcggt agtttgtatg ttaacaagca
19261 cgcttttcat acaccagcat atgatgtgag tgcattccgt gatctgaaac ctttaccatt
19321 cttttattat tctactacac catgtgaagt gcatggtaat ggtagtatga tagaggatat
19381 tgattatgta cccctaaaat ctgcagtctg tattacagct tgtaatttag ggggcgctgt
19441 ttgtaggaag catgctacag agtacagaga gtatatggaa gcatataatc ttgtctctgc
19501 atcaggtttc cgcctttggt gttataagac ctttgatatt tataatctct ggtctacttt
19561 tacaaaagtt caaggtttgg aaaacattgc ttttaatgtt gttaaacaag gccattttat
19621 tggtgttgag ggtgaactac ctgtagctgt agtcaatgat aagatcttca ccaagagtgg
19681 cgttaatgac atttgtatgt ttgagaataa aaccactttg cctactaata tagcttttga
19741 actctatgct aagcgtgctg tacgctcgca tcccgatttc aaattgctac acaatttaca
19801 agcagacatt tgctacaagt tcgtcctttg ggattatgaa cgtagcaata tttatggtac
19861 tgctactatt ggtgtatgta agtacactga tattgatgtt aattcagctt tgaatatatg
19921 ttttgacata cgcgataatg gttcattgga gaagttcatg tctactccca atgccatctt
19981 tatttctgat agaaaaatta agaaataccc ttgtattgta ggtcctgatt atgcttactt
20041 caatggtgct atcatccgtg atagtgatgt tgttaaacaa ccagtgaagt tctacttgta
20101 taagaaagtc aataatgagt ttattgatcc tactgagtgt atttacactc agagtcgctc
20161 ttgtagtgac ttcctacccc tgtctgacat ggagaaagac tttctatctt ttgatagtga
20221 tgttttcatt aagaagtatg gcttggaaaa ctatgctttt gagcacgtag tctatggaga
20281 cttctctcat actacgttag gcggtcttca cttgcttatt ggtttataca agaagcaaca
20341 ggaaggtcat attattatgg aagaaatgct aaaaggtagc tcaactattc ataactattt
20401 tattactgag actaacacag cggcttttaa ggcggtgtgt tctgttatag atttaaagct
20461 tgacgacttt gttatgattt taaagagtca agaccttggc gtagtatcca aggttgtcaa
20521 ggttcctatt gacttaacaa tgattgagtt tatgttatgg tgtaaggatg gacaggttca
20581 aaccttctac cctcgactcc aggcttctgc agattggaaa cctggtcatg caatgccatc
20641 cctctttaaa gttcaaaatg taaaccttga acgttgtgag cttgctaatt acaagcaatc
20701 tattcctatg cctcgcggtg tgcacatgaa catcgctaaa tatatgcaat tgtgccagta
20761 tttaaatact tgcacattag ccgtgcctgc caatatgcgt gttatacatt ttggcgctgg
20821 ttctgataaa ggtatcgctc ctggtacatc agttttacga cagtggcttc ctacagatgc
20881 cattattata gataatgatt taaatgagtt cgtgtcagat gctgacataa ctttatttgg
20941 agattgtgta actgtacgtg tcagccaaca agtggatctt gttatttccg acatgtatga
21001 tcctactact aagaatgtaa caggtagtaa tgagtcaaag gctttattct ttacttacct
21061 gtgtaacctc attaataata atcttgctct tggtgggtct gttgctatta aaataacaga
21121 acactcttgg agcgttgaac tttatgaact tatgggaaaa tttgcttggt ggactgtttt
21181 ctgcaccaat gcaaatgcat cctcatctga aggattcctc ttaggtatta attacttggg
21241 tactattaaa gaaaatatag atggtggtgc tatgcacgcc aactatatat tttggagaaa
21301 ttccactcct atgaatctga gtacttactc actttttgat ttatccaagt ttcaattaaa
21361 attaaaagga acaccagttc ttcaattaaa ggagagtcaa attaacgaac tcgtaatatc
21421 tctcctgtcg cagggtaagt tacttatccg tgacaatgat acactcagtg tttctactga
21481 tgttcttgtt aacacctaca gaaagttacg ttgatgtagg gccagattct gttaagtctg
21541 cttgtattga ggttgatata caacagactt tctttgataa aacttggcct aggccaattg
21601 atgtttctaa ggctgacggt attatatacc ctcaaggccg tacatattct aacataacta
21661 tcacttatca aggtcttttt ccctatcagg gagaccatgg tgatatgtat gtctactctg
21721 caggacatgc tacaggcaca actccacaaa agttgtttgt agctaactat tctcaggacg
21781 tcaaacagtt tgctaatggg tttgtcgtcc gtataggagc agctgccaat tccactggca
21841 ctgttattat tagcccatct acccgcgcta ctatacgaaa aatttaccct gcttttatgc
21901 tgggttcttc agttggtaat ttctcagatg gtaaaatggg ccgcttcttc aatcatactc
21961 tagttctttt gcccgatgga tgtggcactt tacttagagc tttttattgt attctagagc
22021 ctcgctctgg aaatcattgt cctgctggca attcctatac ttcttttgcc acttatcaca
22081 ctcctgcaac agattgttct gatggcaatt acaatcgtaa tgccagtctg aactctttta
22141 aggagtattt taatttacgt aactgcacct ttatgtacac ttataacatt accgaagatg
22201 agattttaga gtggtttggc attacacaaa ctgctcaagg tgttcacctc ttctcatctc
22261 ggtatgttga tttgtacggc ggcaatatgt ttcaatttgc caccttgcct gtttatgata
22321 ctattaagta ttattctatc attcctcaca gtattcgttc tatccaaagt gatagaaaag
22381 cttgggctgc cttctacgta tataaacttc aaccgttaac tttcctgttg gatttttctg
22441 ttgatggtta tatacgcaga gctatagact gtggttttaa tgatttgtca caactccact
22501 gctcatatga atccttcgat gttgaatctg gagtttattc agtttcgtct ttcgaagcaa
22561 aaccttctgg ctcagttgtg gaacaggctg aaggtgttga atgtgatttt tcacctcttc
22621 tgtctggcac acctcctcag gtttataatt tcaagcgttt ggtttttacc aattgcaatt
22681 ataatcttac caaattgctt tcactttttt ctgtgaatga ttttacttgt agtcaaatat
22741 ctccagcagc aattgctagc aactgttatt cttcactgat tttggattat ttttcatacc
22801 cacttagtat gaaatccgat ctcagtgtta gttctgctgg tccaatatcc cagtttaatt
22861 ataaacagtc cttttctaat cccacatgtt tgattttagc gactgttcct cataacctta
22921 ctactattac taagcctctt aagtacagct atattaacaa gtgctctcgt cttctttctg
22981 atgatcgtac tgaagtacct cagttagtga acgctaatca atactcaccc tgtgtatcca
23041 ttctcccatc cactgtgtgg gaagacggtg attattatag gaaacaacta tctccacttg
23101 aaggtggtgg ctggcttgtt gctagtggct caactgttgc catgactgag caattacaga
23161 tgggctttgg tattacagtt caatatggta cagacaccaa tagtgtttgc cccaagcttg
23221 aatttgctaa tgacacaaaa attgcctctc aattaggcaa ttgcgtggaa tattccctct
23281 atggtgtttc gggccgtggt gtttttcaga attgcacagc tgtaggtgtt cgacagcagc
23341 gctttgttta tgatgcgtac cagaatttag ttggctatta ttctgatgat ggcaactact
23401 actgtttgcg tgcttgtgtt agtgttcctg tttctgtcat ctatgataaa gaaactaaaa
23461 cccacgctac tctatttggt agtgttgcat gtgaacacat ttcctctacc atgtctcaat
23521 actcccgttc tacgcgatca atgcttaaac ggcgagattc tacatatggt ccccttcaga
23581 cacctgttgg ttgtgtccta ggacttgtta attcctcttt gttcgtagag gactgcaagt
23641 tgcctcttgg tcaatctctc tgtgctcttc ctgacacacc tagtactctc acacctcgca
23701 gtgtgcgctc tgttccaggt gaaatgcgct tggcatccat tgcttttaat catcctattc
23761 aggttgatca acttaatagt agttatttta aattaagtat acctactaat ttttcctttg
23821 gtgtgactca ggagtacatt cagacaacca ttcagaaagt tactgttgat tgtaaacagt
23881 acgtttgcaa tggtttccag aagtgtgagc aattactgcg cgagtatggc cagttttgtt
23941 ccaaaataaa ccaggctctc catggtgcca atttacgcca ggatgattct gtacgtaatt
24001 tgtttgcgag cgtgaaaagc tctcaatcat ctcctatcat accaggtttt ggaggtgact
24061 ttaatttgac acttctagaa cctgtttcta tatctactgg cagtcgtagt gcacgtagtg
24121 ctattgagga tttgctattt gacaaagtca ctatagctga tcctggttat atgcaaggtt
24181 acgatgattg tatgcagcaa ggtccagcat cagctcgtga tcttatttgt gctcaatatg
24241 tggctggtta taaagtatta cctcctctta tggatgttaa tatggaagcc gcgtacactt
24301 catctttgct tggcagcata gcaggtgttg gctggactgc tggcttatcc tcctttgctg
24361 ctattccatt tgcacagagt atcttttata ggttaaacgg tgttggcatt actcaacagg
24421 ttctttcaga gaaccaaaag cttattgcca ataagtttaa tcaggctctg ggagctatgc
24481 aaacaggctt cactacaact aatgaagctt ttcggaaggt tcaggatgct gtgaacaaca
24541 atgcacaggc tctatccaaa ttagctagcg agctatctaa tacttttggt gctatttccg
24601 cctctattgg agacatcata caacgtcttg acgttctcga acaggacgcc caaatagaca
24661 gacttattaa tggccgtttg acaacactaa atgcttttgt tgcacagcag cttgttcgtt
24721 ctgaatcagc tgctctttcc gctcaattgg ctaaagataa agtcaatgag tgtgtcaagg
24781 cacaatccaa gcgttctgga ttttgcggtc aaggcacaca tatagtgtcc tttgttgtaa
24841 atgcccctaa tggcctttac tttatgcatg ttggttatta ccctagcaac cacattgagg
24901 ttgtttctgc ttatggtctt tgcgatgcag ctaaccctac taattgtata gcccctgtta
24961 atggctactt tattaaaact aataacacta ggattgttga tgagtggtca tatactggct
25021 cgtccttcta tgcacctgag cccatcacct ctcttaatac taagtatgtt gcaccacagg
25081 tgacatacca aaacatttct actaacctcc ctcctcctct tctcggcaat tccaccggga
25141 ttgacttcca agatgagttg gatgagtttt tcaaaaatgt tagcaccagt atacctaatt
25201 ttggttctct aacacagatt aatactacat tactcgatct tacctacgag atgttgtctc
25261 ttcaacaagt tgttaaagcc cttaatgagt cttacataga ccttaaagag cttggcaatt
25321 atacttatta caacaaatgg ccgtggtaca tttggcttgg tttcattgct gggcttgttg
25381 ccttagctct atgcgtcttc ttcatactgt gctgcactgg ttgtggcaca aactgtatgg
25441 gaaaacttaa gtgtaatcgt tgttgtgata gatacgagga atacgacctc gagccgcata
25501 aggttcatgt tcactaatta acgaactatc aatgagagtt caaagaccac ccactctctt
25561 gttagtgttc tcactctctt ttttggtcac tgcattttca aaacctctct atgtacctga
25621 gcattgtcag aattattctg gttgcatgct tagggcttgt attaaaactg cccaagctga
25681 tacagctggt ctttatacaa attttcgaat tgatgtccca tctgcagaat caactggtac
25741 tcaatcagtt tctgtcgatc gtgagtctac ttcaactcat gatggtctta ccgaacatgt
25801 tactagtgtg aatctttttg acgttggtta ctcagttaat taacgaactc tatggattac
25861 gtgtctctgc ttaatcaaat ttggcagaag taccttaatt caccgtatac tacttgtttg
25921 tatatcccta aacccacagc taagtataca cctttagttg gcacttcttt gcaccctgtg
25981 ctgtggaact gtcagctatc ctttgctggt tatactgaat ctgctgttaa ttctacaaaa
26041 gctttggcca aacaggacgc agctcagcga atcgcttggt tgctacataa ggatggagga
26101 atccctgatg gatgttccct ctacctccgg cactcaagtt tattcgcgca aagcgaggaa
26161 gaggagtcat tctccaacta agaaactgcg ctacgttaag cgtagatttt ctcttctgcg
26221 ccctgaagac cttagtgtta ttgtccaacc aacacactat gtcagggtta cattttcaga
26281 ccccaacatg tggtatctac gttcgggtca tcatttacac tcagttcaca attggcttaa
26341 accttatggc ggccaacctg tttctgagta ccatattact ctagctttgc taaatctcac
26401 tgatgaagat ttagctagag atttttcacc cattgcgctc tttttgcgca atgtcagatt
26461 tgagctacat gagttcgcct tgctgcgcaa aactcttgtt cttaatgcat cagagatcta
26521 ctgtgctaac atacatagat ttaagcctgt gtatagagtt aacacggcaa tccctactat
26581 taaggattgg cttctcgttc agggattttc cctttaccat agtggcctcc ctttacatat
26641 gtcaatctct aaattgcatg cactggatga tgttactcgc aattacatca ttacaatgcc
26701 atgctttaga acttatcctc aacaaatgtt tgttactcct ttggccgtag atgttgtctc
26761 catacggtct tccaatcagg gtaataaaca aattgttcat tcttacccca ttttacatca
26821 tccaggattt taacgaacta tggctttctc ggcgtcttta tttaaacccg tccagctagt
26881 cccagtttct cctgcatttc atcgcattga gtctactgac tctattgttt tcacatacat
26941 tcctgctagc ggctatgtag ctgctttagc tgtcaatgtg tgtctcattc ccctattatt
27001 actgctacgt caagatactt gtcgtcgcag cattatcaga actatggttc tctatttcct
27061 tgttctttat aactttttat tagccattgt actagtcaat ggtgtacatt atccaactgg
27121 aagttgcctg atagccttct tagttatcct cataatactt tggtttgtag atagaattcg
27181 tttctgtctc atgctgaatt cctacattcc actgtttgac atgcgttctc actttattcg
27241 tgttagtaca gtttcttctc atggtatggt ccctgtcata cacaccaaac cattatttat
27301 tagaaacttc gatcagcgtt gcagctgttc tcgttgtttt tatttgcact cttctactta
27361 tatagagtgc acttatatta gccgttttag taagattagc ctagtttctg taactgactt
27421 ctccttaaac ggcaatgttt ccactgtttt cgtgcctgca acgcgcgatt cagttcctct
27481 tcacataatc gccccgagct cgcttatcgt ttaagcagct ctgcgctact atgggtcccg
27541 tgtagaggct aatccattag tctctctttg gacatatgga aaacgaacta tgttaccctt
27601 tgtccaagaa cgaatagggt tgttcatagt aaactttttc atttttaccg tagtatgtgc
27661 tataacactc ttggtgtgta tggctttcct tacggctact agattatgtg tgcaatgtat
27721 gacaggcttc aataccctgt tagttcagcc cgcattatac ttgtataata ctggacgttc
27781 agtctatgta aaattccagg atagtaaacc ccctctacca cctgacgagt gggtttaacg
27841 aactccttca taatgtctaa tatgacgcaa ctcactgagg cgcagattat tgccattatt
27901 aaagactgga actttgcatg gtccctgatc tttctcttaa ttactatcgt actacagtat
27961 ggatacccat cccgtagtat gactgtctat gtctttaaaa tgtttgtttt atggctccta
28021 tggccatctt ccatggcgct atcaatattt agcgccattt atccaattga tctagcttcc
28081 cagataatct ctggcattgt agcagctgtt tcagctatga tgtggatttc ctactttgtg
28141 cagagtatcc ggctgtttat gagaactgga tcatggtggt cattcaatcc tgagactaat
28201 tgccttttga atgttccaat tggtggtaca actgtcgtac gtccactcgt agaggactct
28261 accagtgtaa ctgctgttgt aaccaatggt cacctcaaaa tggctggcat gcatttcggt
28321 gcttgtgact acgacagact tcctaatgaa gtcaccgtgg ccaaacccaa tgtgctgatt
28381 gctttaaaaa tggtgaagcg gcaaagctac ggaactaatt ccggcgttgc catttaccat
28441 agatataagg caggtaatta caggagtccg cctattacgg cggatattga acttgcattg
28501 cttcgagctt aggctcttta gtaagagtat cttaattgat tttaacgaat ctcaatttca
28561 ttgttatggc atcccctgct gcacctcgtg ctgtttcctt tgccgataac aatgatataa
28621 caaatacaaa cctgtctcga ggtagaggac gtaatccaaa accacgagct gcaccaaata
28681 acactgtctc ttggtacact gggcttaccc aacacgggaa agtccctctt acctttccac
28741 ctgggcaggg tgtacctctt aatgccaatt ccacccctgc gcaaaatgct gggtattggc
28801 ggagacagga cagaaaaatt aataccggga atggaattaa gcaactggct cccaggtggt
28861 acttctacta cactggaact ggacccgaag cagcactccc attccgggct gttaaggatg
28921 gcatcgtttg ggtccatgaa gatggcgcca ctgatgctcc ttcaactttt gggacgcgga
28981 accctaacaa tgattcagct attgttacac aattcgcgcc cggtactaag cttcctaaaa
29041 acttccacat tgaggggact ggaggcaata gtcaatcatc ttcaagagcc tctagcgtaa
29101 gcagaaactc ttccagatct agttcacaag gttcaagatc aggaaactct acccgcggca
29161 cttctccagg tccatctgga atcggagcag taggaggtga tctactttac cttgatcttc
29221 tgaacagact acaagccctt gagtctggca aagtaaagca atcgcagcca aaagtaatca
29281 ctaagaaaga tgctgctgct gctaaaaata agatgcgcca caagcgcact tccaccaaaa
29341 gtttcaacat ggtgcaagct tttggtcttc gcggaccagg agacctccag ggaaactttg
29401 gtgatcttca attgaataaa ctcggcactg aggacccacg ttggccccaa attgctgagc
29461 ttgctcctac agccagtgct tttatgggta tgtcgcaatt taaacttacc catcagaaca
29521 atgatgatca tggcaaccct gtgtacttcc ttcggtacag tggagccatt aaacttgacc
29581 caaagaatcc caactacaat aagtggttgg agcttcttga gcaaaatatt gatgcctaca
29641 aaaccttccc taagaaggaa aagaaacaaa aggcaccaaa agaagaatca acagaccaaa
29701 tgtctgaacc tccaaaggag cagcgtgtgc aaggtagcat cactcagcgc actcgcaccc
29761 gtccaagtgt tcagcctggt ccaatgattg atgttaacac tgattagtgt cactcaaagt
29821 aacaagatcg cggcaatcgt ttgtgtttgg taaccccatc tcaccatcgc ttgtccactc
29881 ttgcacagaa tggaatcatg ttgtaattac agtgcaataa ggtaattata acccatttaa
29941 ttgatagcta tgctttatta aagtgtgtag ctgtagagag aatgttaaag actgtcacct
30001 ctgcgtgatt gcaagtgaac agtgcccccc gggaagagct ctacagtgtg aaatgtaaat
30061 aaaaaatagc tattattcaa ttagattagg ctaattagat gatttgca

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Tue Jun 09, 2015 3:16 pm 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
Select seq gb|KT006149.1|
Middle East respiratory syndrome coronavirus strain ChinaGD01, complete genome
54183 54183 99% 0.0 99% KT006149.1
Select seq gb|KF600628.1|
Middle East respiratory syndrome coronavirus isolate Hafr-Al-Batin_1_2013, complete genome
54035 54035 99% 0.0 99% KF600628.1
Select seq gb|KJ650098.1|
Middle East respiratory syndrome coronavirus isolate Camel/Qatar_2_2014, complete genome
53985 53985 99% 0.0 99% KJ650098.1
Select seq gb|KJ829365.1|
Middle East respiratory syndrome coronavirus strain Florida/USA-2_Saudi Arabia_2014, complete genome
53981 53981 100% 0.0 99% KJ829365.1
Select seq gb|KF961222.1|
Middle East respiratory syndrome coronavirus isolate Qatar4, complete genome
53976 53976 99% 0.0 99% KF961222.1
Select seq gb|KP223131.1|
Middle East respiratory syndrome coronavirus isolate Florida/USA-2_Saudi Arabia_2014, complete genome
53972 53972 100% 0.0 99% KP223131.1
Select seq gb|KF961221.1|
Middle East respiratory syndrome coronavirus isolate Qatar3, complete genome
53959 53959 99% 0.0 99% KF961221.1
Select seq gb|KJ713295.1|
Middle East respiratory syndrome coronavirus isolate KSA-CAMEL-505, complete genome
53954 53954 100% 0.0 99% KJ713295.1
Select seq gb|KJ713296.1|
Middle East respiratory syndrome coronavirus isolate KSA-CAMEL-378, complete genome
53950 53950 100% 0.0 99% KJ713296.1
Select seq gb|KC667074.1|
Human betacoronavirus 2c England-Qatar/2012, complete genome
53941 53941 100% 0.0 99% KC667074.1

_________________
www.twitter.com/hniman


Top
 Profile  
 
Display posts from previous:  Sort by  
Post new topic Reply to topic  [ 4 posts ] 

All times are UTC - 5 hours [ DST ]


Who is online

Users browsing this forum: Google [Bot], HilarioR and 53 guests


You cannot post new topics in this forum
You cannot reply to topics in this forum
You cannot edit your posts in this forum
You cannot delete your posts in this forum
You cannot post attachments in this forum

Search for:
Jump to:  
cron
Powered by phpBB® Forum Software © phpBB Group