Rhiza Labs FluTracker Forum

The place to discuss the flu
It is currently Tue Oct 17, 2017 1:40 am

All times are UTC - 5 hours [ DST ]




Post new topic Reply to topic  [ 13 posts ]  Go to page 1, 2  Next
Author Message
PostPosted: Mon Jun 08, 2015 5:29 pm 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
Korea CDC has released a series of partial sequences from MERS case(s).

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Mon Jun 08, 2015 5:30 pm 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
LOCUS KT001382 247 bp RNA linear VRL 08-JUN-2015
DEFINITION Middle East respiratory syndrome coronavirus strain
MERS-CoV/KOR/KNIH/001_05_2015 N protein (N) gene, partial cds.
ACCESSION KT001382
VERSION KT001382.1 GI:827342868
KEYWORDS .
SOURCE Middle East respiratory syndrome coronavirus (MERS-CoV)
ORGANISM Middle East respiratory syndrome coronavirus
Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA
stage; Nidovirales; Coronaviridae; Coronavirinae; Betacoronavirus;
unclassified Betacoronavirus.
REFERENCE 1 (bases 1 to 247)
AUTHORS Yang,J.-S., Cheong,H.-M., Kim,Y.-J., Kang,H.J., Park,S.H.,
Han,Y.W., Lee,H.S., Kim,J.A., Kim,H., Kim,A.-R., Heo,D.R.,
Jung,H.-D., Kim,S.J., Nam,J.-G. and Kim,S.S.
TITLE Laboratory findings the first imported Middle East Respiratory
Syndrome Coronavirus (MERS-CoV) cases in South Korea
JOURNAL Unpublished
REFERENCE 2 (bases 1 to 247)
AUTHORS Yang,J.-S., Cheong,H.-M., Kim,Y.-J., Kang,H.J., Park,S.H.,
Han,Y.W., Lee,H.S., Kim,J.A., Kim,H., Kim,A.-R., Heo,D.R.,
Jung,H.-D., Kim,S.J., Nam,J.-G. and Kim,S.S.
TITLE Direct Submission
JOURNAL Submitted (01-JUN-2015) Division of Respiratory Viruses, Korea
National Institute of Health, KCDC, Osong Health Technology
Administration Complex, 187 Osongsaengmyeong2(i)-ro, Osong-eup,
Heungdeok-gu, Cheongju-si 363-951, Korea
COMMENT ##Assembly-Data-START##
Sequencing Technology :: Sanger dideoxy sequencing
##Assembly-Data-END##
FEATURES Location/Qualifiers
source 1..247
/organism="Middle East respiratory syndrome coronavirus"
/mol_type="genomic RNA"
/strain="MERS-CoV/KOR/KNIH/001_05_2015"
/isolation_source="aspirate"
/host="Homo sapiens"
/db_xref="taxon:1335626"
/country="South Korea"
/collection_date="19-May-2015"
gene <1..210
/gene="N"
CDS <1..210
/gene="N"
/codon_start=1
/product="N protein"
/protein_id="AKJ75495.1"
/db_xref="GI:827342869"
/translation="NKWLELLEQNIDAYKTFPKKEKKQKAPKEESTDQMSEPPKEQRV
QGSITQRTRTRPSVQPGPMIDVNTD"
ORIGIN
1 aataagtggt tggagcttct tgagcaaaat attgatgcct acaaaacctt ccctaagaag
61 gaaaagaaac aaaaggcacc aaaagaagaa tcaacagacc aaatgtctga acctccaaag
121 gagcagcgtg tgcaaggtag catcactcag cgcactcgca cccgtccaag tgttcagcct
181 ggtccaatga ttgatgttaa cactgattag tgtcactcaa agtaacaaga tcgcggcaat
241 cgtttgt

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Mon Jun 08, 2015 5:35 pm 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
LOCUS KT001383 247 bp RNA linear VRL 08-JUN-2015
DEFINITION Middle East respiratory syndrome coronavirus strain
MERS-CoV/KOR/KNIH/002_05_2015 N protein (N) gene, partial cds.
ACCESSION KT001383
VERSION KT001383.1 GI:827342870
KEYWORDS .
SOURCE Middle East respiratory syndrome coronavirus (MERS-CoV)
ORGANISM Middle East respiratory syndrome coronavirus
Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA
stage; Nidovirales; Coronaviridae; Coronavirinae; Betacoronavirus;
unclassified Betacoronavirus.
REFERENCE 1 (bases 1 to 247)
AUTHORS Yang,J.-S., Cheong,H.-M., Kim,Y.-J., Kang,H.J., Park,S.H.,
Han,Y.W., Lee,H.S., Kim,J.A., Kim,H., Kim,A.-R., Heo,D.R.,
Kim,S.J., Jung,H.-D., Nam,J.-G. and Kim,S.S.
TITLE The first imported Middle east respiratory syndrome coronavirus
cases in South Korea
JOURNAL Unpublished
REFERENCE 2 (bases 1 to 247)
AUTHORS Yang,J.-S., Cheong,H.-M., Kim,Y.-J., Kang,H.J., Park,S.H.,
Han,Y.W., Lee,H.S., Kim,J.A., Kim,H., Kim,A.-R., Heo,D.R.,
Kim,S.J., Jung,H.-D., Nam,J.-G. and Kim,S.S.
TITLE Direct Submission
JOURNAL Submitted (01-JUN-2015) Division of Respiratory Viruses, Korea
National Institute of Health, KCDC, Osong Health Technology
Administration Complex, 187 Osongsaengmyeong2(i)-ro, Osong-eup,
Heungdeok-gu, Cheongju-si 363-951, Korea
COMMENT ##Assembly-Data-START##
Sequencing Technology :: Sanger dideoxy sequencing
##Assembly-Data-END##
FEATURES Location/Qualifiers
source 1..247
/organism="Middle East respiratory syndrome coronavirus"
/mol_type="genomic RNA"
/strain="MERS-CoV/KOR/KNIH/002_05_2015"
/isolation_source="sputum"
/host="Homo sapiens"
/db_xref="taxon:1335626"
/country="South Korea"
/collection_date="20-May-2015"
gene <1..210
/gene="N"
CDS <1..210
/gene="N"
/codon_start=1
/product="N protein"
/protein_id="AKJ75496.1"
/db_xref="GI:827342871"
/translation="NKWLELLEQNIDAYKTFPKKEKKQKAPKEESTDQMSEPPKEQRV
QGSITQRTRTRPSVQPGPMIDVNTD"
ORIGIN
1 aataagtggt tggagcttct tgagcaaaat attgatgcct acaaaacctt ccctaagaag
61 gaaaagaaac aaaaggcacc aaaagaagaa tcaacagacc aaatgtctga acctccaaag
121 gagcagcgtg tgcaaggtag catcactcag cgcactcgca cccgtccaag tgttcagcct
181 ggtccaatga ttgatgttaa cactgattag tgtcactcaa agtaacaaga tcgcggcaat
241 cgtttgt

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Mon Jun 08, 2015 5:37 pm 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
LOCUS KT001384 247 bp RNA linear VRL 08-JUN-2015
DEFINITION Middle East respiratory syndrome coronavirus strain
MERS-CoV/KOR/KNIH/003_05_2015 N protein (N) gene, partial cds.
ACCESSION KT001384
VERSION KT001384.1 GI:827342872
KEYWORDS .
SOURCE Middle East respiratory syndrome coronavirus (MERS-CoV)
ORGANISM Middle East respiratory syndrome coronavirus
Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA
stage; Nidovirales; Coronaviridae; Coronavirinae; Betacoronavirus;
unclassified Betacoronavirus.
REFERENCE 1 (bases 1 to 247)
AUTHORS Yang,J.-S., Cheong,H.-M., Kim,Y.-J., Kang,H.J., Park,S.H.,
Han,Y.W., Lee,H.S., Kim,J.A., Kim,H., Kim,A.-R., Heo,D.-R.,
Kim,S.J., Jung,H.-D., Nam,J.-G. and Kim,S.S.
TITLE The first imported Middle east respiratory syndrome coronavirus
cases in South Korea
JOURNAL Unpublished
REFERENCE 2 (bases 1 to 247)
AUTHORS Yang,J.-S., Cheong,H.-M., Kim,Y.-J., Kang,H.J., Park,S.H.,
Han,Y.W., Lee,H.S., Kim,J.A., Kim,H., Kim,A.-R., Heo,D.-R.,
Kim,S.J., Jung,H.-D., Nam,J.-G. and Kim,S.S.
TITLE Direct Submission
JOURNAL Submitted (01-JUN-2015) Division of Respiratory Viruses, Korea
National Institute of Health, KCDC, Osong Health Technology
Administration Complex, 187 Osongsaengmyeong2(i)-ro, Osong-eup,
Heungdeok-gu, Cheongju-si 363-951, Korea
COMMENT ##Assembly-Data-START##
Sequencing Technology :: Sanger dideoxy sequencing
##Assembly-Data-END##
FEATURES Location/Qualifiers
source 1..247
/organism="Middle East respiratory syndrome coronavirus"
/mol_type="genomic RNA"
/strain="MERS-CoV/KOR/KNIH/003_05_2015"
/isolation_source="sputum"
/host="Homo sapiens"
/db_xref="taxon:1335626"
/country="South Korea"
/collection_date="20-May-2015"
gene <1..210
/gene="N"
CDS <1..210
/gene="N"
/codon_start=1
/product="N protein"
/protein_id="AKJ75497.1"
/db_xref="GI:827342873"
/translation="NKWLELLEQNIDAYKTFPKKEKKQKAPKEESTDQMSEPPKEQRV
QGSITQRTRTRPSVQPGPMIDVNTD"
ORIGIN
1 aataagtggt tggagcttct tgagcaaaat attgatgcct acaaaacctt ccctaagaag
61 gaaaagaaac aaaaggcacc aaaagaagaa tcaacagacc aaatgtctga acctccaaag
121 gagcagcgtg tgcaaggtag catcactcag cgcactcgca cccgtccaag tgttcagcct
181 ggtccaatga ttgatgttaa cactgattag tgtcactcaa agtaacaaga tcgcggcaat
241 cgtttgt

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Mon Jun 08, 2015 5:38 pm 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
LOCUS KT001385 247 bp RNA linear VRL 08-JUN-2015
DEFINITION Middle East respiratory syndrome coronavirus strain
MERS-CoV/KOR/KNIH/004_05_2015 N protein (N) gene, partial cds.
ACCESSION KT001385
VERSION KT001385.1 GI:827342874
KEYWORDS .
SOURCE Middle East respiratory syndrome coronavirus (MERS-CoV)
ORGANISM Middle East respiratory syndrome coronavirus
Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA
stage; Nidovirales; Coronaviridae; Coronavirinae; Betacoronavirus;
unclassified Betacoronavirus.
REFERENCE 1 (bases 1 to 247)
AUTHORS Yang,J.-S., Cheong,H.-M., Kim,Y.-J., Kang,H.J., Park,S.H.,
Han,Y.W., Lee,H.S., Kim,J.A., Kim,H., Kim,A.-R., Heo,D.-R.,
Kim,S.J., Jung,H.-D., Nam,J.-G. and Kim,S.S.
TITLE The first imported Middle east respiratory syndrome coronavirus
cases in South Korea
JOURNAL Unpublished
REFERENCE 2 (bases 1 to 247)
AUTHORS Yang,J.-S., Cheong,H.-M., Kim,Y.-J., Kang,H.J., Park,S.H.,
Han,Y.W., Lee,H.S., Kim,J.A., Kim,H., Kim,A.-R., Heo,D.-R.,
Kim,S.J., Jung,H.-D., Nam,J.-G. and Kim,S.S.
TITLE Direct Submission
JOURNAL Submitted (01-JUN-2015) Division of Respiratory Viruses, Korea
National Institute of Health, KCDC, Osong Health Technology
Administration Complex, 187 Osongsaengmyeong2(i)-ro, Osong-eup,
Heungdeok-gu, Cheongju-si 363-951, Korea
COMMENT ##Assembly-Data-START##
Sequencing Technology :: Sanger dideoxy sequencing
##Assembly-Data-END##
FEATURES Location/Qualifiers
source 1..247
/organism="Middle East respiratory syndrome coronavirus"
/mol_type="genomic RNA"
/strain="MERS-CoV/KOR/KNIH/004_05_2015"
/isolation_source="sputum"
/host="Homo sapiens"
/db_xref="taxon:1335626"
/country="South Korea"
/collection_date="25-May-2015"
gene <1..210
/gene="N"
CDS <1..210
/gene="N"
/codon_start=1
/product="N protein"
/protein_id="AKJ75498.1"
/db_xref="GI:827342875"
/translation="NKWLELLEQNIDAYKTFPKKEKKQKAPKEESTDQMSEPPKEQRV
QGSITQRTRTRPSVQPGPMIDVNTD"
ORIGIN
1 aataagtggt tggagcttct tgagcaaaat attgatgcct acaaaacctt ccctaagaag
61 gaaaagaaac aaaaggcacc aaaagaagaa tcaacagacc aaatgtctga acctccaaag
121 gagcagcgtg tgcaaggtag catcactcag cgcactcgca cccgtccaag tgttcagcct
181 ggtccaatga ttgatgttaa cactgattag tgtcactcaa agtaacaaga tcgcggcaat
241 cgtttgt

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Mon Jun 08, 2015 5:40 pm 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
LOCUS KT001386 247 bp RNA linear VRL 08-JUN-2015
DEFINITION Middle East respiratory syndrome coronavirus strain
MERS-CoV/KOR/KNIH/005_05_2015 N protein (N) gene, partial cds.
ACCESSION KT001386
VERSION KT001386.1 GI:827342876
KEYWORDS .
SOURCE Middle East respiratory syndrome coronavirus (MERS-CoV)
ORGANISM Middle East respiratory syndrome coronavirus
Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA
stage; Nidovirales; Coronaviridae; Coronavirinae; Betacoronavirus;
unclassified Betacoronavirus.
REFERENCE 1 (bases 1 to 247)
AUTHORS Yang,J.-S., Cheong,H.-M., Kim,Y.-J., Kang,H.J., Park,S.H.,
Han,Y.W., Lee,H.S., Kim,J.A., Kim,H., Kim,A.-R., Heo,D.-R.,
Kim,S.J., Jung,H.-D., Nam,J.-G. and Kim,S.S.
TITLE The first imported Middle east respiratory syndrome coronavirus
cases in South Korea
JOURNAL Unpublished
REFERENCE 2 (bases 1 to 247)
AUTHORS Yang,J.-S., Cheong,H.-M., Kim,Y.-J., Kang,H.J., Park,S.H.,
Han,Y.W., Lee,H.S., Kim,J.A., Kim,H., Kim,A.-R., Heo,D.-R.,
Kim,S.J., Jung,H.-D., Nam,J.-G. and Kim,S.S.
TITLE Direct Submission
JOURNAL Submitted (01-JUN-2015) Division of Respiratory Viruses, Korea
National Institute of Health, KCDC, Osong Health Technology
Administration Complex, 187 Osongsaengmyeong2(i)-ro, Osong-eup,
Heungdeok-gu, Cheongju-si 363-951, Korea
COMMENT ##Assembly-Data-START##
Sequencing Technology :: Sanger dideoxy sequencing
##Assembly-Data-END##
FEATURES Location/Qualifiers
source 1..247
/organism="Middle East respiratory syndrome coronavirus"
/mol_type="genomic RNA"
/strain="MERS-CoV/KOR/KNIH/005_05_2015"
/isolation_source="sputum"
/host="Homo sapiens"
/db_xref="taxon:1335626"
/country="South Korea"
/collection_date="26-May-2015"
gene <1..210
/gene="N"
CDS <1..210
/gene="N"
/codon_start=1
/product="N protein"
/protein_id="AKJ75499.1"
/db_xref="GI:827342877"
/translation="NKWLELLEQNIDAYKTFPKKEKKQKAPKEESTDQMSEPPKEQRV
QGSITQRTRTRPSVQPGPMIDVNTD"
ORIGIN
1 aataagtggt tggagcttct tgagcaaaat attgatgcct acaaaacctt ccctaagaag
61 gaaaagaaac aaaaggcacc aaaagaagaa tcaacagacc aaatgtctga acctccaaag
121 gagcagcgtg tgcaaggtag catcactcag cgcactcgca cccgtccaag tgttcagcct
181 ggtccaatga ttgatgttaa cactgattag tgtcactcaa agtaacaaga tcgcggcaat
241 cgtttgt

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Mon Jun 08, 2015 5:42 pm 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
LOCUS KT001387 247 bp RNA linear VRL 08-JUN-2015
DEFINITION Middle East respiratory syndrome coronavirus strain
MERS-CoV/KOR/KNIH/006_05_2015 N protein (N) gene, partial cds.
ACCESSION KT001387
VERSION KT001387.1 GI:827342878
KEYWORDS .
SOURCE Middle East respiratory syndrome coronavirus (MERS-CoV)
ORGANISM Middle East respiratory syndrome coronavirus
Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA
stage; Nidovirales; Coronaviridae; Coronavirinae; Betacoronavirus;
unclassified Betacoronavirus.
REFERENCE 1 (bases 1 to 247)
AUTHORS Yang,J.-S., Cheong,H.-M., Kim,Y.-J., Kang,H.J., Park,S.H.,
Han,Y.W., Lee,H.S., Kim,J.A., Kim,H., Kim,A.-R., Heo,D.-R.,
Kim,S.J., Jung,H.-D., Nam,J.-G. and Kim,S.S.
TITLE The first imported Middle east respiratory syndrome coronavirus
cases in South Korea
JOURNAL Unpublished
REFERENCE 2 (bases 1 to 247)
AUTHORS Yang,J.-S., Cheong,H.-M., Kim,Y.-J., Kang,H.J., Park,S.H.,
Han,Y.W., Lee,H.S., Kim,J.A., Kim,H., Kim,A.-R., Heo,D.-R.,
Kim,S.J., Jung,H.-D., Nam,J.-G. and Kim,S.S.
TITLE Direct Submission
JOURNAL Submitted (02-JUN-2015) Division of Respiratory Viruses, Korea
National Institute of Health, KCDC, Osong Health Technology
Administration Complex, 187 Osongsaengmyeong2(i)-ro, Osong-eup,
Heungdeok-gu, Cheongju-si 363-951, Korea
COMMENT ##Assembly-Data-START##
Sequencing Technology :: Sanger dideoxy sequencing
##Assembly-Data-END##
FEATURES Location/Qualifiers
source 1..247
/organism="Middle East respiratory syndrome coronavirus"
/mol_type="genomic RNA"
/strain="MERS-CoV/KOR/KNIH/006_05_2015"
/isolation_source="sputum"
/host="Homo sapiens"
/db_xref="taxon:1335626"
/country="South Korea"
/collection_date="27-May-2015"
gene <1..210
/gene="N"
CDS <1..210
/gene="N"
/codon_start=1
/product="N protein"
/protein_id="AKJ75500.1"
/db_xref="GI:827342879"
/translation="NKWLELLEQNIDAYKTFPKKEKKQKAPKEESTDQMSEPPKEQRV
QGSITQRTRTRPSVQPGPMIDVNTD"
ORIGIN
1 aataagtggt tggagcttct tgagcaaaat attgatgcct acaaaacctt ccctaagaag
61 gaaaagaaac aaaaggcacc aaaagaagaa tcaacagacc aaatgtctga acctccaaag
121 gagcagcgtg tgcaaggtag catcactcag cgcactcgca cccgtccaag tgttcagcct
181 ggtccaatga ttgatgttaa cactgattag tgtcactcaa agtaacaaga tcgcggcaat
241 cgtttgt

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Mon Jun 08, 2015 5:44 pm 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
LOCUS KT001388 247 bp RNA linear VRL 08-JUN-2015
DEFINITION Middle East respiratory syndrome coronavirus strain
MERS-CoV/KOR/KNIH/007_05_2015 N protein (N) gene, partial cds.
ACCESSION KT001388
VERSION KT001388.1 GI:827342880
KEYWORDS .
SOURCE Middle East respiratory syndrome coronavirus (MERS-CoV)
ORGANISM Middle East respiratory syndrome coronavirus
Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA
stage; Nidovirales; Coronaviridae; Coronavirinae; Betacoronavirus;
unclassified Betacoronavirus.
REFERENCE 1 (bases 1 to 247)
AUTHORS Yang,J.-S., Cheong,H.-M., Kim,Y.-J., Kang,H.J., Park,S.H.,
Han,Y.W., Lee,H.S., Kim,J.A., Kim,H., Kim,A.-R., Heo,D.-R.,
Kim,S.J., Jung,H.-D., Nam,J.-G. and Kim,S.S.
TITLE The first imported Middle east respiratory syndrome coronavirus
cases in South Korea
JOURNAL Unpublished
REFERENCE 2 (bases 1 to 247)
AUTHORS Yang,J.-S., Cheong,H.-M., Kim,Y.-J., Kang,H.J., Park,S.H.,
Han,Y.W., Lee,H.S., Kim,J.A., Kim,H., Kim,A.-R., Heo,D.-R.,
Kim,S.J., Jung,H.-D., Nam,J.-G. and Kim,S.S.
TITLE Direct Submission
JOURNAL Submitted (02-JUN-2015) Division of Respiratory Viruses, Korea
National Institute of Health, KCDC, Osong Health Technology
Administration Complex, 187 Osongsaengmyeong2(i)-ro, Osong-eup,
Heungdeok-gu, Cheongju-si 363-951, Korea
COMMENT ##Assembly-Data-START##
Sequencing Technology :: Sanger dideoxy sequencing
##Assembly-Data-END##
FEATURES Location/Qualifiers
source 1..247
/organism="Middle East respiratory syndrome coronavirus"
/mol_type="genomic RNA"
/strain="MERS-CoV/KOR/KNIH/007_05_2015"
/isolation_source="sputum"
/host="Homo sapiens"
/db_xref="taxon:1335626"
/country="South Korea"
/collection_date="27-May-2015"
gene <1..210
/gene="N"
CDS <1..210
/gene="N"
/codon_start=1
/product="N protein"
/protein_id="AKJ75501.1"
/db_xref="GI:827342881"
/translation="NKWLELLEQNIDAYKTFPKKEKKQKAPKEESTDQMSEPPKEQRV
QGSITQRTRTRPSVQPGPMIDVNTD"
ORIGIN
1 aataagtggt tggagcttct tgagcaaaat attgatgcct acaaaacctt ccctaagaag
61 gaaaagaaac aaaaggcacc aaaagaagaa tcaacagacc aaatgtctga acctccaaag
121 gagcagcgtg tgcaaggtag catcactcag cgcactcgca cccgtccaag tgttcagcct
181 ggtccaatga ttgatgttaa cactgattag tgtcactcaa agtaacaaga tcgcggcaat
241 cgtttgt

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Mon Jun 08, 2015 5:45 pm 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
LOCUS KT001389 208 bp RNA linear VRL 08-JUN-2015
DEFINITION Middle East respiratory syndrome coronavirus strain
MERS-CoV/KOR/KNIH/001_05_2015 RNA-dependent RNA polymerase (ORF1ab)
gene, partial cds.
ACCESSION KT001389
VERSION KT001389.1 GI:827342858
KEYWORDS .
SOURCE Middle East respiratory syndrome coronavirus (MERS-CoV)
ORGANISM Middle East respiratory syndrome coronavirus
Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA
stage; Nidovirales; Coronaviridae; Coronavirinae; Betacoronavirus;
unclassified Betacoronavirus.
REFERENCE 1 (bases 1 to 208)
AUTHORS Yang,J.-S., Cheong,H.-M., Kim,Y.-J., Kang,H.J., Park,S.H.,
Han,Y.W., Lee,H.S., Kim,J.A., Kim,H., Kim,A.-R., Heo,D.-R.,
Kim,S.J., Jung,H.-D., Nam,J.-G. and Kim,S.S.
TITLE The first imported Middle east respiratory syndrome coronavirus
cases in South Korea
JOURNAL Unpublished
REFERENCE 2 (bases 1 to 208)
AUTHORS Yang,J.-S., Cheong,H.-M., Kim,Y.-J., Kang,H.J., Park,S.H.,
Han,Y.W., Lee,H.S., Kim,J.A., Kim,H., Kim,A.-R., Heo,D.-R.,
Kim,S.J., Jung,H.-D., Nam,J.-G. and Kim,S.S.
TITLE Direct Submission
JOURNAL Submitted (02-JUN-2015) Division of Respiratory Viruses, Korea
National Institute of Health, KCDC, Osong Health Technology
Administration Complex, 187 Osongsaengmyeong2(i)-ro, Osong-eup,
Heungdeok-gu, Cheongju-si 363-951, Korea
COMMENT ##Assembly-Data-START##
Sequencing Technology :: Sanger dideoxy sequencing
##Assembly-Data-END##
FEATURES Location/Qualifiers
source 1..208
/organism="Middle East respiratory syndrome coronavirus"
/mol_type="genomic RNA"
/strain="MERS-CoV/KOR/KNIH/001_05_2015"
/isolation_source="aspirate"
/host="Homo sapiens"
/db_xref="taxon:1335626"
/country="South Korea"
/collection_date="19-May-2015"
gene <1..>208
/gene="ORF1ab"
CDS <1..>208
/gene="ORF1ab"
/codon_start=2
/product="RNA-dependent RNA polymerase"
/protein_id="AKJ75490.1"
/db_xref="GI:827342859"
/translation="ISAKNRARTVAGVSILSTMTNRQYHQKMLKSMAATRGATCVIGT
TKFYGGWDFMLKTLYKDVDNPHLMG"
ORIGIN
1 tattagtgct aagaatagag ctcgcactgt tgcaggcgtg tccatactta gcacaatgac
61 taatcgccag taccatcaga aaatgcttaa gtccatggct gcaactcgtg gagcgacttg
121 cgtcattggt actacaaagt tctatggtgg ctgggatttc atgcttaaaa cattgtacaa
181 agatgttgat aatccgcatc ttatgggt

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Mon Jun 08, 2015 5:47 pm 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
LOCUS KT001390 179 bp RNA linear VRL 08-JUN-2015
DEFINITION Middle East respiratory syndrome coronavirus strain
MERS-CoV/KOR/KNIH/002_05_2015 RNA-dependent RNA polymerase (ORF1ab)
gene, partial cds.
ACCESSION KT001390
VERSION KT001390.1 GI:827342860
KEYWORDS .
SOURCE Middle East respiratory syndrome coronavirus (MERS-CoV)
ORGANISM Middle East respiratory syndrome coronavirus
Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA
stage; Nidovirales; Coronaviridae; Coronavirinae; Betacoronavirus;
unclassified Betacoronavirus.
REFERENCE 1 (bases 1 to 179)
AUTHORS Yang,J.-S., Cheong,H.-M., Kim,Y.-J., Kang,H.J., Park,S.H.,
Han,Y.W., Lee,H.S., Kim,J.A., Kim,H., Kim,A.-R., Heo,D.-R.,
Kim,S.J., Jung,H.-D., Nam,J.-G. and Kim,S.S.
TITLE The first imported Middle east respiratory syndrome coronavirus
cases in South Korea
JOURNAL Unpublished
REFERENCE 2 (bases 1 to 179)
AUTHORS Yang,J.-S., Cheong,H.-M., Kim,Y.-J., Kang,H.J., Park,S.H.,
Han,Y.W., Lee,H.S., Kim,J.A., Kim,H., Kim,A.-R., Heo,D.-R.,
Kim,S.J., Jung,H.-D., Nam,J.-G. and Kim,S.S.
TITLE Direct Submission
JOURNAL Submitted (02-JUN-2015) Division of Respiratory Viruses, Korea
National Institute of Health, KCDC, Osong Health Technology
Administration Complex, 187 Osongsaengmyeong2(i)-ro, Osong-eup,
Heungdeok-gu, Cheongju-si 363-951, Korea
COMMENT ##Assembly-Data-START##
Sequencing Technology :: Sanger dideoxy sequencing
##Assembly-Data-END##
FEATURES Location/Qualifiers
source 1..179
/organism="Middle East respiratory syndrome coronavirus"
/mol_type="genomic RNA"
/strain="MERS-CoV/KOR/KNIH/002_05_2015"
/isolation_source="sputum"
/host="Homo sapiens"
/db_xref="taxon:1335626"
/country="South Korea"
/collection_date="20-May-2015"
gene <1..>179
/gene="ORF1ab"
CDS <1..>179
/gene="ORF1ab"
/codon_start=3
/product="RNA-dependent RNA polymerase"
/protein_id="AKJ75491.1"
/db_xref="GI:827342861"
/translation="AGVSILSTMTNRQYHQKMLKSMAATRGATCVIGTTKFYGGWDFM
LKTLYKDVDNPHLMG"
ORIGIN
1 ttgcaggcgt gtccatactt agcacaatga ctaatcgcca gtaccatcag aaaatgctta
61 agtccatggc tgcaactcgt ggagcgactt gcgtcattgg tactacaaag ttctatggtg
121 gctgggattt catgcttaaa acattgtaca aagatgttga taatccgcat cttatgggt

_________________
www.twitter.com/hniman


Top
 Profile  
 
Display posts from previous:  Sort by  
Post new topic Reply to topic  [ 13 posts ]  Go to page 1, 2  Next

All times are UTC - 5 hours [ DST ]


Who is online

Users browsing this forum: Yahoo [Bot] and 62 guests


You cannot post new topics in this forum
You cannot reply to topics in this forum
You cannot edit your posts in this forum
You cannot delete your posts in this forum
You cannot post attachments in this forum

Search for:
Jump to:  
cron
Powered by phpBB® Forum Software © phpBB Group