Rhiza Labs FluTracker Forum

The place to discuss the flu
It is currently Tue Oct 17, 2017 12:55 pm

All times are UTC - 5 hours [ DST ]




Post new topic Reply to topic  [ 17 posts ]  Go to page 1, 2  Next
Author Message
PostPosted: Tue Jun 09, 2015 9:48 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
CDC has released full MERS sequences (direct and VERO isolates) from Feb (2959) and Mar (4050) human cases in Riyadh - closely related to GD01.

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Tue Jun 09, 2015 9:53 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
LOCUS KT026456 30120 bp RNA linear VRL 09-JUN-2015
DEFINITION Middle East respiratory syndrome coronavirus isolate
Hu/Riyadh_KSA_4050_2015, complete genome.
ACCESSION KT026456
VERSION KT026456.1 GI:828436887
KEYWORDS .
SOURCE Middle East respiratory syndrome coronavirus (MERS-CoV)
ORGANISM Middle East respiratory syndrome coronavirus
Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA
stage; Nidovirales; Coronaviridae; Coronavirinae; Betacoronavirus;
unclassified Betacoronavirus.
REFERENCE 1 (bases 1 to 30120)
AUTHORS Queen,K., Tamin,A., Bin Saeed,A., Paden,C., Zhang,J., Li,Y.,
Tao,Y., Erdman,D. and Tong,S.
TITLE Direct Submission
JOURNAL Submitted (06-JUN-2015) Division of Viral Diseases, Centers for
Disease Control and Prevention, 1600 Clifton Rd NE, Atlanta, GA
30033, USA
COMMENT ##Assembly-Data-START##
Assembly Method :: CLC Genomics Workbench v. 7.0.3
Sequencing Technology :: Illumina; Sanger dideoxy sequencing
##Assembly-Data-END##
FEATURES Location/Qualifiers
source 1..30120
/organism="Middle East respiratory syndrome coronavirus"
/mol_type="genomic RNA"
/isolate="Hu/Riyadh_KSA_4050_2015"
/isolation_source="respiratory swab"
/host="Homo sapiens"
/db_xref="taxon:1335626"
/country="Saudi Arabia"
/collection_date="01-Mar-2015"
/note="passaged in Vero cells"
gene 279..21511
/gene="orf1ab"
CDS join(279..13430,13430..21511)
/gene="orf1ab"
/ribosomal_slippage
/codon_start=1
/product="ORF1ab protein"
/protein_id="AKK52620.1"
/db_xref="GI:828436897"
/translation="MSFVAGVIAQGARGTYRAALNSEKHQDHVSLTVPLCGSGNLVEK
LSPWFMDGENAYEVVKAMLLKKEPLLYVPIRLAGHTRHLPGPRVYLVERLIACENPFM
VNQLAYSSSANGSLVGTTLQGKPIGMFFPYDIELVTGKQNILLRKYGRGGYHYTPVHY
ERDNTSCPEWMDDFEADPKGKYAQNLLKKLIGGDVTPVDQYMCGVDGKPISAYAFLMA
KDGITKLADVEADVAARADDEGFITLKNNLYRLVWHVERKDVPYPKQSIFTINSVVQK
DGVENTPPHYFTLGCKILTLTPRNKWSGVSDLSLKQKLLYTFYGKESLENPTYIYHSA
FIECGSCGNDSWLTGNAIQGFACGCGASYTANDVEVQSSGMIKPNALLCATCPFAKGD
SCSSNCKHSVAQLVSYLSERCNVIADSKSFTLIFGGVAYAYFGCEEGTMYFVPRAKSV
VSRIGDSIFTGCTGSWNKVTQIANMFLEQTQHSLNFVGEFVVNDVVLAILSGTTTNVD
KIRQLLKGVTIDKLRDYLADYDVAVTAGPFMDNAINVGGTGLQYAAITAPYVVLTGLG
ESFKKVATIPYKVCNSVKDTLTYYAHSVLYRVFPYDMDSGVSSFSELLFDCVDLSVAS
TYFLVRLLQDKTGDFMSTIITSCQTAVSKLLDTCFEATEATFNFLLDLAGLFRIFLRN
AYVYTSQGFVVVNGKVSTLVKQVLDLLNKGMQLLHTKVSWAGSNISAVIYSGRESLIF
PSGTYYCVTTKAKSVQQDLDVILPGEFSKKQLGLLQPTDNSTTVSVTVSSNMVETVVG
QLEQTNMHSPDVVGDYVIISEKLFVRSKEEDGFAFYPACTNGHAVPTLFRLKGGAPVK
KVAFGGDQVHEVAAVRSVTVEYNIHAVLDTLLASSSLRTFVVDKSLSIEEFADVVKEQ
VSDLLVKLLRGMPIPDFDLDDFIDAPCYCFNAEGDASWSSTMIFSLHPVECDEECSEV
EASDLEEGESECISETSTEQVDVSHEVSDDEWAAAVDEAFPLDEAEDVTESVQEEAQP
VEVPVEDIAQVVIADTLQETPVVSDTVEVPPQVVKLPSEPQTIQPEVKEVAPVYEADT
EQTQSVTVKPKRLRKKRNVDPLSNFEHKVITECVTIVLGDAIQVAKCYGESVLVNAAN
THLKHGGGIAGAINAASKGAVQKESDEYILAKGPLQVGDSVLLQGHSLAKNILHVVGP
DARAKQDVSLLSKCYKAMNAYPLVVTPLVSTGIFGVKPAVSFDYLIREAKTRVLVVVN
SQDVYKSLTIVDIPQSLTFSYDGLRGAIRKAKDYGFTVFVCTDNSANTKVLRNKGVDY
TKKFLTVDGVQYYCYTSKDTLDDILQQANKSVGIISMPLGYVSHGLDLIQAGSVVRRV
NVPYVCLLANKEQEAILMSEDVKLNPSEDFIKHVRTNGGYNSWHLVEGELLVQDLRFN
KLLHWSDQTICYKDSVFYVVKNSTAFPFETLSACRAYLDSRTTQQLTIEVLVTVDGVN
FRTVVLNNKNTYRSQLGCVFFNGADISDTIPDEKQNGHSLYLADNLTADETKALKELY
GPVDPTFLHRFYSLKAAVHKWKMVVCDKVRSLKLSDNNCYLNAVIMTLDLLKDIKFVI
PALQHAFMKHKGGDSTDFIALIMAYGNCTFGAPDDASRLLHTVLAKAELCCSARMVWR
EWCNVCGIKDVVLQGLKACCYVGVQTVEDLRARMTYVCQCGGERHRQIVEHTTPWLLL
SGTPNEKLVTTSTAPDFVAFNVFQGIETAVGHYVHARLKGGLILKFDSGTVSKTSDWK
CKVTDVLFPGQKYSSDCNVVRYSLDGNFRTEVDPDLSAFYVKDGKYFTSEPPVTYSPA
TILAGSVYTNSCLVSSDGQPGGDAISLSFNNLLGFDSSKPVTKKYTYSFLPKEDGDVL
LAEFDTYDPIYKNGAMYKGKPILWVNKASYDTNLNKFNRASLRQIFDVAPIELENKFT
PLSVASTPVEPPTVDVVALQQEMTIVKCKGLNKPFVKDNVSFVVDDSGTPVVEYLSKE
DLHTLYVDPKYQVIVLKDNVLSSMLRLHTVESGDINVVAASGSLTRKVKLLFRASFYF
KEFATRTFTATTAVGSCIKSVVRHLGVTKGILTGCFSFVKMLFILPLAYFSDSKLGTT
EVKVSALKTAGVVTGNVVKQCCTAAVDLSMDKLRRVDWKSTLRLLLMLCTTMVLLSSV
YHLYVFNQVLSSDVMFEDAQGLKKFYKEVRAYLGISSACDGLASAYRANSFDVPTFCA
NRSAMCNWCLISQDSITHYPALKMVQTHLSHYVLNIDWLWFAFETGLAYMLYTSAFNW
LLLAGTLHYFFAQTSIFVDWRSYNYAVSSAFWLFTHIPMAGLVRMYNLLACLWLLRKF
YQHVINGCKDTACLLCYKRNRLTRVEASTVVCGGKRTFYITANGGISFCRRHNWNCVD
CDIAGVGNTFICEEVANDLTTALRRPINATDRSHYYVDSVTVKETVVQFNYRRDGQPF
YERFPLCAFTNLDKLKFKEVCKTTTGIPEYNFIIYDSSDRGQESLARSACVYYSQVLC
KSILLVDSSLVTSVGDSSEIATKMFDSFVNSFVSLYNVTRDKLEKLISTARDGVRRGD
NFHSVLTTFIDAARGPAGVESDVETNEIVDSVQYAHKHDIQITNESYNNYVPSYVKPD
SVSTSDLGSLIDCNAASVNQIVLRNSNGACIWNAAAYMKLSDALKRQIRIACRKCNLA
FRLTTSKLRANDNILSVRFTANKIVGGAPTWFNVLRDFTLKGYVLATIIVFLCAVLMY
LCLPTFSMVPVEFYEDRILDFKVLDNGIIRDVNPDDKCFANKHRSFTQWYHEHVGGVY
DNSITCPLTVAVIAGVAGARIPDVPTTLAWVNNQIIFFVSRVFANTGSVCYTPIDEIP
YKSFSDSGCILPSECTMFRDAEGRMTPYCHDPTVLPGAFAYSQMRPHVRYDLYDGNMF
IKFPEVVFESTLRITRTLSTQYCRFGSCEYAQEGVCITTNGSWAIFNDHHLNRPGVYC
GSDFIDIVRRLAVSLFQPITYFQLTTSLVLGIGLCAFLTLLFYYINKVKRAFADYTQC
AVIAVVAAVLNSLCICFVASIPLCIVPYTALYYYATFYFTNEPAFIMHVSWYIMFGPI
VPIWMTCVYTVAMCFRHFFWVLAYFSKKHVEVFTDGKLNCSFQDAASNIFVINKDTYA
ALRNSLTNDAYSRFLGLFNKYKYFSGAMETAAYREAAACHLAKALQTYSETGSDLLYQ
PPNCSITSGVLQSGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCPA
DQLSDPNYDALLISMTNHSFSVQKHIGAPANLRVVGHAMQGTLLKLTVDVANPSTPAY
TFTTVKPGAAFSVLACYNGRPTGTFTVVMRPNYTIKGSFLCGSCGSVGYTKEGSVINF
CYMHQMELANGTHTGSAFDGTMYGAFMDKQVHQVQLTDKYCSVNVVAWLYAAILNGCA
WFVKPNRTSVVSFNEWALANQFTEFVGTQSVDMLAVKTGVAIEQLLYAIQQLYTGFQG
KQILGSTMLEDEFTPEDVNMQIMGVVMQSGVRKVTYGTAHWLFATLVSTYVIILQATK
FTLWNYLFETIPTQLFPLLFVTMAFVMLLVKHKHTFLTLFLLPVAICLTYANIVYEPT
TPISSALIAVANWLAPTNAYMRTTHTDIGVYISMSLVLVIVVKRLYNPSLSNFALALC
SGVMWLYTYSIGEASSPIAYLVFVTTLTSDYTITVFVTVNLAKVCTYAIFAYSPQLTL
VFPEVKMILLLYTCLGFMCTCYFGVFSLLNLKLRAPMGVYDFKVSTQEFRFMTANNLT
APRNSWEAMALNFKLIGIGGTPCIKVAAMQSKLTDLKCTSVVLLSVLQQLHLEANSRA
WAFCVKCHNDILAATDPSEAFEKFVSLFATLMTFSGNVDLDALASDIFDTPSVLQATL
SEFSHLATFAELEAAQKAYQEAMDSGDTSPQVLKALQKAVNIAKNAYEKDKAVARKLE
RMADQAMTSMYKQARAEDKKAKIVSAMQTMLFGMIKKLDNDVLNGIISNARNGCIPLS
VIPLCASNKLRVVIPDFTVWNQVVTYPSLNYAGALWDITVINNVDNEIVKSSDVVDSN
ENLTWPLVLECTRASTSAVKLQNNEIKPSGLKTMVVSAGQEQTNCNTSSLAYYEPVQG
RKMLMALLSDNAYLKWARVEGKDGFVSVELQPPCKFLIAGPKGPEIRYLYFVKNLNNL
HRGQVLGHIAATVRLQAGSNTEFASNSSVLSLVNFTVDPQKAYLDFVNAGGAPLTNCV
KMLTPKTGTGIAISVKPESTADQETYGGASVCLYCRAHIEHPDVSGVCKYKGKFVQIP
AQCVRDPVGFCLSNTPCNVCQYWIGYGCNCDSLRQVALPQSKDSNFLNRVRGSIVNAR
IEPCSSGLSTDVVFRAFDICNYKAKVAGIGKYYKTNTCRFVELDDQGHHLDSYFVVKR
HTMENYELEKHCYDLLRDCDAVAPHDFFIFDVDKVKTPHIVRQRLTEYTMMDLVYALR
HFDQNSEVLKAILVKYGCCDVTYFENKLWFDFVENPSVIGVYHKLGERVRQAILNTVK
FCDHMVKAGLVGVLTLDNQDLNGKWYDFGDFVITQPGSGVAIVDSYYSYLMPVLSMTD
CLAAETHRDCDFNKPLIEWPLTEYDFTDYKVQLFEKYFKYWDQTYHANCVNCTDDRCV
LHCANFNVLFAMTMPKTCFGPIVRKIFVDGVPFVVSCGYHYKELGLVMNMDVSLHRHR
LSLKELMMYAADPAMHIASSNAFLDLRTSCFSVAALTTGLTFQTVRPGNFNQDFYDFV
VSKGFFKEGSSVTLKHFFFAQDGNAAITDYNYYSYNLPTMCDIKQMLFCMEVVNKYFE
IYDGGCLNASEVVVNNLDKSAGHPFNKFGKARVYYESMSYQEQDELFAMTKRNVIPTM
TQMNLKYAISAKNRARTVAGVSILSTMTNRQYHQKMLKSMAATRGATCVIGTTKFYGG
WDFMLKTLYKDVDNPHLMGWDYPKCDRAMPNMCRIFASLILARKHGTCCTTRDRFYRL
ANECAQVLSEYVLCGGGYYVKPGGTSSGDATTAYANSVFNILQATTANVSALMGANGN
KIVDKEVKDMQFDLYVNVYRSTSPDPKFVDKYYAFLNKHFSMMILSDDGVVCYNSDYA
AKGYIAGIQNFKETLYYQNNVFMSEAKCWVETDLKKGPHEFCSQHTLYIKDGDDGYFL
PYPDPSRILSAGCFVDDIVKTDGTLMVERFVSLAIDAYPLTKHEDIEYQNVFWVYLQY
IEKLYKDLTGHMLDSYSVMLCGDNSAKFWEEAFYRDLYSSPTTLQAVGSCVVCHSQTS
LRCGTCIRRPFLCCKCCYDHVIATPHKMVLSVSPYVCNAPGCGVSDVTKLYLGGMSYF
CVDHRPVCSFPLCANGLVFGLYKNMCTGSPSIVEFNRLATCDWTESGDYTLANTTTEP
LKLFAAETLRATEEASKQSYAIATIKEIVGERQLLLVWEAGKSKPPLNRNYVFTGYHI
TKNSKVQLGEYIFERIDYSDAVSYKSSTTYKLTVGDIFVLTSHSVATLTAPTIVNQER
YVKITGLYPTITVPEEFASHVANFQKSGYSKYVTVQGPPGTGKSHFAIGLAIYYPTAR
VVYTACSHAAVDALCEKAFKYLNIAKCSRIIPAKARVECYDRFKVNETNSQYLFSTIN
ALPETSADILVVDEVSMCTNYDLSIINARIKAKHIVYVGDPAQLPAPRTLLTRGTLEP
ENFNSVTRLMCNLGPDIFLSMCYRCPKEIVSTVSALVYNNKLLAKKELSGQCFKILYK
GNVTHDASSAINRPQLTFVKNFITANPAWSKAVFISPYNSQNAVARSMLGLTTQTVDS
SQGSEYQYVIFCQTADTAHANNINRFNVAITRAQKGILCVMTSQALFESLEFTELSFT
NYKLQSQIVTGLFKDCSRETSGLSPAYAPTYVSVDDKYKTSDELCVNLNLPANIPYSR
VISRMGFKLDATVPGYPKLFITREEAVRQVRSWIGFDVEGAHASRNACGTNVPLQLGF
STGVNFVVQPVGVVDTEWGNMLTGIAARPPPGEQFKHLVPLMHKGAAWPIVRRRIVQM
LSDTLDKLSDYCTFVCWAHGFELTSASYFCKIGKEQKCCMCNRRAAAYSSPLQSYACW
THSCGYDYVYNPFFVDVQQWGYVGNLATNHDRYCSVHQGAHVASNDAIMTRCLAIHSC
FIERVDWDIEYPYISHEKKLNSCCRIVERNVVRAALLAGSFDKVYDIGNPKGIPIVDD
PVVDWHYFDAQPLTRKVQQLFYTEDMASRFADGLCLFWNCNVPKYPNNAIVCRFDTRV
HSEFNLPGCDGGSLYVNKHAFHTPAYDVSAFRDLKPLPFFYYSTTPCEVHGNGSMIED
IDYVPLKSAVCITACNLGGAVCRKHATEYREYMEAYNLVSASGFRLWCYKTFDIYNLW
STFTKVQGLENIAFNVVKQGHFIGVEGELPVAVVNDKIFTKSGVNDICMFENKTTLPT
NIAFELYAKRAVRSHPDFKLLHNLQADICYKFVLWDYERSNIYGTATIGVCKYTDIDV
NSALNICFDIRDNGSLEKFMSTPNAIFISDRKIKKYPCIVGPDYAYFNGAIIRDSDVV
KQPVKFYLYKKVNNEFIDPTECIYTQSRSCSDFLPLSDMEKDFLSFDSDVFIKKYGLE
NYAFEHVVYGDFSHTTLGGLHLLIGLYKKQQEGHIIMEEMLKGSSTIHNYFITETNTA
AFKAVCSVIDLKLDDFVMILKSQDLGVVSKVVKVPIDLTMIEFMLWCKDGQVQTFYPR
LQASADWKPGHAMPSLFKVQNVNLERCELANYKQSIPMPRGVHMNIAKYMQLCQYLNT
CTLAVPANMRVIHFGAGSDKGIAPGTSVLRQWLPTDAIIIDNDLNEFVSDADITLFGD
CVTVRVGQQVDLVISDMYDPTTKNVTGSNESKALFFTYLCNLINNNLALGGSVAIKIT
EHSWSVELYELMGKFAWWTVFCTNANASSSEGFLLGINYLGTIKENIDGGAMHANYIF
WRNSTPMNLSTYSLFDLSKFQLKLKGTPVLQLKESQINELVISLLSQGKLLIRDNDTL
SVSTDVLVNTYRKLR"
CDS 279..13451
/gene="orf1ab"
/codon_start=1
/product="ORF1a protein"
/protein_id="AKK52611.1"
/db_xref="GI:828436888"
/translation="MSFVAGVIAQGARGTYRAALNSEKHQDHVSLTVPLCGSGNLVEK
LSPWFMDGENAYEVVKAMLLKKEPLLYVPIRLAGHTRHLPGPRVYLVERLIACENPFM
VNQLAYSSSANGSLVGTTLQGKPIGMFFPYDIELVTGKQNILLRKYGRGGYHYTPVHY
ERDNTSCPEWMDDFEADPKGKYAQNLLKKLIGGDVTPVDQYMCGVDGKPISAYAFLMA
KDGITKLADVEADVAARADDEGFITLKNNLYRLVWHVERKDVPYPKQSIFTINSVVQK
DGVENTPPHYFTLGCKILTLTPRNKWSGVSDLSLKQKLLYTFYGKESLENPTYIYHSA
FIECGSCGNDSWLTGNAIQGFACGCGASYTANDVEVQSSGMIKPNALLCATCPFAKGD
SCSSNCKHSVAQLVSYLSERCNVIADSKSFTLIFGGVAYAYFGCEEGTMYFVPRAKSV
VSRIGDSIFTGCTGSWNKVTQIANMFLEQTQHSLNFVGEFVVNDVVLAILSGTTTNVD
KIRQLLKGVTIDKLRDYLADYDVAVTAGPFMDNAINVGGTGLQYAAITAPYVVLTGLG
ESFKKVATIPYKVCNSVKDTLTYYAHSVLYRVFPYDMDSGVSSFSELLFDCVDLSVAS
TYFLVRLLQDKTGDFMSTIITSCQTAVSKLLDTCFEATEATFNFLLDLAGLFRIFLRN
AYVYTSQGFVVVNGKVSTLVKQVLDLLNKGMQLLHTKVSWAGSNISAVIYSGRESLIF
PSGTYYCVTTKAKSVQQDLDVILPGEFSKKQLGLLQPTDNSTTVSVTVSSNMVETVVG
QLEQTNMHSPDVVGDYVIISEKLFVRSKEEDGFAFYPACTNGHAVPTLFRLKGGAPVK
KVAFGGDQVHEVAAVRSVTVEYNIHAVLDTLLASSSLRTFVVDKSLSIEEFADVVKEQ
VSDLLVKLLRGMPIPDFDLDDFIDAPCYCFNAEGDASWSSTMIFSLHPVECDEECSEV
EASDLEEGESECISETSTEQVDVSHEVSDDEWAAAVDEAFPLDEAEDVTESVQEEAQP
VEVPVEDIAQVVIADTLQETPVVSDTVEVPPQVVKLPSEPQTIQPEVKEVAPVYEADT
EQTQSVTVKPKRLRKKRNVDPLSNFEHKVITECVTIVLGDAIQVAKCYGESVLVNAAN
THLKHGGGIAGAINAASKGAVQKESDEYILAKGPLQVGDSVLLQGHSLAKNILHVVGP
DARAKQDVSLLSKCYKAMNAYPLVVTPLVSTGIFGVKPAVSFDYLIREAKTRVLVVVN
SQDVYKSLTIVDIPQSLTFSYDGLRGAIRKAKDYGFTVFVCTDNSANTKVLRNKGVDY
TKKFLTVDGVQYYCYTSKDTLDDILQQANKSVGIISMPLGYVSHGLDLIQAGSVVRRV
NVPYVCLLANKEQEAILMSEDVKLNPSEDFIKHVRTNGGYNSWHLVEGELLVQDLRFN
KLLHWSDQTICYKDSVFYVVKNSTAFPFETLSACRAYLDSRTTQQLTIEVLVTVDGVN
FRTVVLNNKNTYRSQLGCVFFNGADISDTIPDEKQNGHSLYLADNLTADETKALKELY
GPVDPTFLHRFYSLKAAVHKWKMVVCDKVRSLKLSDNNCYLNAVIMTLDLLKDIKFVI
PALQHAFMKHKGGDSTDFIALIMAYGNCTFGAPDDASRLLHTVLAKAELCCSARMVWR
EWCNVCGIKDVVLQGLKACCYVGVQTVEDLRARMTYVCQCGGERHRQIVEHTTPWLLL
SGTPNEKLVTTSTAPDFVAFNVFQGIETAVGHYVHARLKGGLILKFDSGTVSKTSDWK
CKVTDVLFPGQKYSSDCNVVRYSLDGNFRTEVDPDLSAFYVKDGKYFTSEPPVTYSPA
TILAGSVYTNSCLVSSDGQPGGDAISLSFNNLLGFDSSKPVTKKYTYSFLPKEDGDVL
LAEFDTYDPIYKNGAMYKGKPILWVNKASYDTNLNKFNRASLRQIFDVAPIELENKFT
PLSVASTPVEPPTVDVVALQQEMTIVKCKGLNKPFVKDNVSFVVDDSGTPVVEYLSKE
DLHTLYVDPKYQVIVLKDNVLSSMLRLHTVESGDINVVAASGSLTRKVKLLFRASFYF
KEFATRTFTATTAVGSCIKSVVRHLGVTKGILTGCFSFVKMLFILPLAYFSDSKLGTT
EVKVSALKTAGVVTGNVVKQCCTAAVDLSMDKLRRVDWKSTLRLLLMLCTTMVLLSSV
YHLYVFNQVLSSDVMFEDAQGLKKFYKEVRAYLGISSACDGLASAYRANSFDVPTFCA
NRSAMCNWCLISQDSITHYPALKMVQTHLSHYVLNIDWLWFAFETGLAYMLYTSAFNW
LLLAGTLHYFFAQTSIFVDWRSYNYAVSSAFWLFTHIPMAGLVRMYNLLACLWLLRKF
YQHVINGCKDTACLLCYKRNRLTRVEASTVVCGGKRTFYITANGGISFCRRHNWNCVD
CDIAGVGNTFICEEVANDLTTALRRPINATDRSHYYVDSVTVKETVVQFNYRRDGQPF
YERFPLCAFTNLDKLKFKEVCKTTTGIPEYNFIIYDSSDRGQESLARSACVYYSQVLC
KSILLVDSSLVTSVGDSSEIATKMFDSFVNSFVSLYNVTRDKLEKLISTARDGVRRGD
NFHSVLTTFIDAARGPAGVESDVETNEIVDSVQYAHKHDIQITNESYNNYVPSYVKPD
SVSTSDLGSLIDCNAASVNQIVLRNSNGACIWNAAAYMKLSDALKRQIRIACRKCNLA
FRLTTSKLRANDNILSVRFTANKIVGGAPTWFNVLRDFTLKGYVLATIIVFLCAVLMY
LCLPTFSMVPVEFYEDRILDFKVLDNGIIRDVNPDDKCFANKHRSFTQWYHEHVGGVY
DNSITCPLTVAVIAGVAGARIPDVPTTLAWVNNQIIFFVSRVFANTGSVCYTPIDEIP
YKSFSDSGCILPSECTMFRDAEGRMTPYCHDPTVLPGAFAYSQMRPHVRYDLYDGNMF
IKFPEVVFESTLRITRTLSTQYCRFGSCEYAQEGVCITTNGSWAIFNDHHLNRPGVYC
GSDFIDIVRRLAVSLFQPITYFQLTTSLVLGIGLCAFLTLLFYYINKVKRAFADYTQC
AVIAVVAAVLNSLCICFVASIPLCIVPYTALYYYATFYFTNEPAFIMHVSWYIMFGPI
VPIWMTCVYTVAMCFRHFFWVLAYFSKKHVEVFTDGKLNCSFQDAASNIFVINKDTYA
ALRNSLTNDAYSRFLGLFNKYKYFSGAMETAAYREAAACHLAKALQTYSETGSDLLYQ
PPNCSITSGVLQSGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCPA
DQLSDPNYDALLISMTNHSFSVQKHIGAPANLRVVGHAMQGTLLKLTVDVANPSTPAY
TFTTVKPGAAFSVLACYNGRPTGTFTVVMRPNYTIKGSFLCGSCGSVGYTKEGSVINF
CYMHQMELANGTHTGSAFDGTMYGAFMDKQVHQVQLTDKYCSVNVVAWLYAAILNGCA
WFVKPNRTSVVSFNEWALANQFTEFVGTQSVDMLAVKTGVAIEQLLYAIQQLYTGFQG
KQILGSTMLEDEFTPEDVNMQIMGVVMQSGVRKVTYGTAHWLFATLVSTYVIILQATK
FTLWNYLFETIPTQLFPLLFVTMAFVMLLVKHKHTFLTLFLLPVAICLTYANIVYEPT
TPISSALIAVANWLAPTNAYMRTTHTDIGVYISMSLVLVIVVKRLYNPSLSNFALALC
SGVMWLYTYSIGEASSPIAYLVFVTTLTSDYTITVFVTVNLAKVCTYAIFAYSPQLTL
VFPEVKMILLLYTCLGFMCTCYFGVFSLLNLKLRAPMGVYDFKVSTQEFRFMTANNLT
APRNSWEAMALNFKLIGIGGTPCIKVAAMQSKLTDLKCTSVVLLSVLQQLHLEANSRA
WAFCVKCHNDILAATDPSEAFEKFVSLFATLMTFSGNVDLDALASDIFDTPSVLQATL
SEFSHLATFAELEAAQKAYQEAMDSGDTSPQVLKALQKAVNIAKNAYEKDKAVARKLE
RMADQAMTSMYKQARAEDKKAKIVSAMQTMLFGMIKKLDNDVLNGIISNARNGCIPLS
VIPLCASNKLRVVIPDFTVWNQVVTYPSLNYAGALWDITVINNVDNEIVKSSDVVDSN
ENLTWPLVLECTRASTSAVKLQNNEIKPSGLKTMVVSAGQEQTNCNTSSLAYYEPVQG
RKMLMALLSDNAYLKWARVEGKDGFVSVELQPPCKFLIAGPKGPEIRYLYFVKNLNNL
HRGQVLGHIAATVRLQAGSNTEFASNSSVLSLVNFTVDPQKAYLDFVNAGGAPLTNCV
KMLTPKTGTGIAISVKPESTADQETYGGASVCLYCRAHIEHPDVSGVCKYKGKFVQIP
AQCVRDPVGFCLSNTPCNVCQYWIGYGCNCDSLRQVALPQSKDSNFLNESGVLL"
gene 21453..25514
/gene="S"
CDS 21453..25514
/gene="S"
/codon_start=1
/product="S protein"
/protein_id="AKK52612.1"
/db_xref="GI:828436889"
/translation="MIHSVFLLMFLLTPTESYVDVGPDSVKSACIEVDIQQTFFDKTW
PRPIDVSKADGIIYPQGRTYSNITITYQGLFPYQGDHGDMYVYSAGHATGTTPQKLFV
ANYSQDVKQFANGFVVRIGAAANSTGTVIISPSTSATIRKIYPAFMLGSSVGNFSDGK
MGRFFNHTLVLLPDGCGTLLRAFYCILEPRSGNHCPAGNSYTSFATYHTPATDCSDGN
YNRNASLNSFKEYFNLRNCTFMYTYNITEDEILEWFGITQTAQGVHLFSSRYVDLYGG
NMFQFATLPVYDTIKYYSIIPHSIRSIQSDRKAWAAFYVYKLQPLTFLLDFSVDGYIR
RAIDCGFNDLSQLHCSYESFDVESGVYSVSSFEAKPSGSVVEQAEGVECDFSPLLSGT
PPQVYNFKRLVFTNCNYNLTKLLSLFSVNDFTCSQISPAAIASNCYSSLILDYFSYPL
SMKSDLSVSSAGPISQFNYKQSFSNPTCLILATVPHNLTTITKPLKYSYINKCSRLLS
DDRTEVPQLVNANQYSPCVSIVPSTVWEDGDYYRKQLSPLEGGGWLVASGSTVAMTEQ
LQMGFGITVQYGTDTNSVCPKLEFANDTKIASQLGNCVEYSLYGVSGRGVFQNCTAVG
VRQQRFVYDAYQNLVGYYSDDGNYYCLRACVSVPVSVIYDKETKTHATLFGSVACEHI
SSTMSQYSRSTRSMLKRRDSTYGPLQTPVGCVLGLVNSSLFVEDCKLPLGQSLCALPD
TPSTLTPRSVRSVPGEMRLASIAFNHPIQVDQLNSSYFKLSIPTNFSFGVTQEYIQTT
IQKVTVDCKQYVCNGFQKCEQLLREYGQFCSKINQALHGANLRQDDSVRNLFASVKSS
QSSPIIPGFGGDFNLTLLEPVSISTGSRSARSAIEDLLFDKVTIADPGYMQGYDDCMQ
QGPASARDLICAQYVAGYKVLPPLMDVNMEAAYTSSLLGSIAGVGWTAGLSSFAAIPF
AQSIFYRLNGVGITQQVLSENQKLIANKFNQALGAMQTGFTTTNEAFRKVQDAVNNNA
QALSKLASELSNTFGAISASIGDIIQRLDVLEQDAQIDRLINGRLTTLNAFVAQQLVR
SESAALSAQLAKDKVNECVKAQSKRSGFCGQGTHIVSFVVNAPNGLYFMHVGYYPSNH
IEVVSAYGLCDAANPTNCIAPVNGYFIKTNNTRIVDEWSYTGSSFYAPEPITSLNTKY
VAPQVTYQNISTNLPPPLLGNSTGIDFQDELDEFFKNVSTSIPNFGSLTQINTTLLDL
TYEMLSLQQVVKALNESYIDLKELGNYTYYNKWPWYIWLGFIAGLVALALCVFFILCC
TGCGTNCMGKLKCNRCCDRYEEYDLEPHKVHVH"
gene 25529..25840
/gene="ns3a"
CDS 25529..25840
/gene="ns3a"
/codon_start=1
/product="NS3a protein"
/protein_id="AKK52613.1"
/db_xref="GI:828436890"
/translation="MRVQRPPTLLLVFSLSFLVTAFSKPLYVPEHCQNYSGCMLRACI
KTAQADTAGLYTNFRIDVPSAESTGTQSVSVDRESTSTHDGLTEHVTSVNLFDVGYSV
N"
gene 25849..26178
/gene="ns3b"
CDS 25849..26178
/gene="ns3b"
/codon_start=1
/product="NS3b protein"
/protein_id="AKK52614.1"
/db_xref="GI:828436891"
/translation="MDYVSLLNQIWQKYLNSPYTTCLYIPKPTAKYTPLVGTSLHPVL
WNCQLSFAGYTESAVNSTKALAKQDAAQRIAWLLHKDGGIPDGCSLYLRHSSLFAQSE
EEESFSN"
gene 26090..26830
/gene="ns3c"
CDS 26090..26830
/gene="ns3c"
/codon_start=1
/product="NS3c protein"
/protein_id="AKK52615.1"
/db_xref="GI:828436892"
/translation="MEESLTDVPSTSGTQVYSRKARKRSHSPTKKLRYVKRRFSLLRP
EDLSVIVQPTHYVRVTFSDPNMWYLRSGHHLHSVHNWLKPYGGQPVSEYHITLALLNL
TDEDLARDFSPIALFLRNVRFELHEFALLRKTLVLNASEIYCANIHRFKPVYRVNTAI
PTIKDWLLVQGFSLYHSGLPLHMSISKLHALDDVTRNYIITMPCFRTYPQQMFVTPLA
VDVVSIRSSNQGNKQIVHSYPILHHPGF"
gene 26837..27511
/gene="ns3d"
CDS 26837..27511
/gene="ns3d"
/codon_start=1
/product="NS3d protein"
/protein_id="AKK52616.1"
/db_xref="GI:828436893"
/translation="MAFSASLFKPVQLVPVSPAFHRIESTDSIVFTYIPASGYVAALA
VNVCLIPLLLLLRQDTCRRSIIRTMVLYFLVLYNFLLAIVLVNGVHYPTGSCLIAFLV
ILIILWFVDRIRFCLMLNSYIPLFDMRSHFIRVSTVSSHGMVPVIHTKPLFIRNFDQR
CSCSRCFYLHSSTYIECTYISRFSKISLVSVTDFSLNGNVSTVFVPATRDSVPLHIIA
PSSLIV"
gene 27587..27835
/gene="E"
CDS 27587..27835
/gene="E"
/codon_start=1
/product="E protein"
/protein_id="AKK52617.1"
/db_xref="GI:828436894"
/translation="MLPFVQERIGLFIVNFFIFTVVCAITLLVCMAFLTATRLCVQCM
TGFNTLLVQPALYLYNTGRSVYVKFQDSKPPLPPDEWV"
gene 27850..28509
/gene="M"
CDS 27850..28509
/gene="M"
/codon_start=1
/product="M protein"
/protein_id="AKK52618.1"
/db_xref="GI:828436895"
/translation="MSNMTQLTEAQIIAIIKDWNFAWSLIFLLITIVLQYGYPSRSMT
VYVFKMFVLWLLWPSSMALSIFSAIYPIDLASQIISGIVAAVSAMMWISYFVQSIRLF
MRTGSWWSFNPETNCLLNVPIGGTTVVRPLVEDSTSVTAVVTNGHLKMAGMHFGACDY
DRLPNEVTVAKPNVLIALKMVKRQSYGTNSGVAIYHRYKAGNYRSPPITADIELALLR
A"
gene 28563..29804
/gene="N"
CDS 28563..29804
/gene="N"
/codon_start=1
/product="N protein"
/protein_id="AKK52619.1"
/db_xref="GI:828436896"
/translation="MASPAAPCAVSFADNNDITNTNLSRGRGRNPKPRAAPNNTVSWY
TGLTQHGKVPLTFPPGQGVPLNANSTPAQNAGYWRRQDRKINTGNGIKQLAPRWYFYY
TGTGPEAALPFRAVKDGIVWVHEDGATDAPSTFGTRNPNNDSAIVTQFAPGTKLPKNF
HIEGTGGNSQSSSRASSVSRNSSRSSSQGSRSGNSTRGTSPGPSGIGAVGGDLLYLDL
LNRLQALESGKVKQSQPKVITKKDAAAAKNKMRHKRTSTKSFNMVQAFGLRGPGDLQG
NFGDLQLNKLGTEDPRWPQIAELAPTASAFMGMSQFKLTHQNNDDHGNPVYFLRYSGA
IKLDPKNPNYNKWLELLEQNIDAYKTFPKKEKKQKAPKEESTDQMSEPPKEQRVQGSI
TQRTRTRPSVQPGPMIDVNTD"

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Tue Jun 09, 2015 9:55 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
ORIGIN
1 gatttaagtg aatagcttgg ctatctcact tcccctcgtt ctcttgcaga actttgattt
61 taacgaactt aaataaaagc cctgttgttt agcgtattgt tgcacttgtc tggtgggatt
121 gtggcactaa tttgcctgct catctaggca gtggacatat gctcaacact gggtataatt
181 ctaattgaat actatttttc agttagagcg tcgtgtctct tgtacgtctc ggtcacaata
241 tacggtttcg tccggtgcgt ggcaattcgg ggcacatcat gtctttcgtg gctggtgtga
301 tcgcgcaagg tgcgcgcggt acgtatcgag cagcgctcaa ctctgaaaaa catcaagacc
361 atgtgtctct aactgtgcca ctctgtggtt caggaaacct ggttgaaaaa ctttcaccat
421 ggttcatgga tggcgaaaat gcctatgaag tggtgaaggc catgttactt aaaaaagagc
481 cacttctcta tgtgcccatc cggctggctg gacacactag acacctccca ggtcctcgtg
541 tgtacctggt tgagaggctc attgcttgtg aaaatccatt catggttaac caattggctt
601 atagctctag tgcaaatggc agcctggttg gcacaacttt gcagggcaag cctattggta
661 tgttcttccc ttatgacatc gaacttgtca caggaaagca aaatattctc ctgcgcaagt
721 atggccgtgg tggttatcac tacaccccag tccactatga gcgagacaac acctcttgcc
781 ctgagtggat ggacgacttt gaggcggatc ctaaaggcaa atatgcccag aatctgctta
841 agaagttgat tggcggtgat gtcactccag ttgaccaata catgtgtggc gttgatggaa
901 aacccattag tgcctatgca tttttaatgg ccaaggatgg aataaccaaa ctggctgatg
961 ttgaagcgga cgtcgcagca cgtgctgatg acgaaggctt catcacatta aagaacaatc
1021 tatatagatt ggtttggcat gttgagcgta aagacgttcc atatcctaag caatctattt
1081 ttactattaa tagtgtggtc caaaaggatg gtgttgaaaa cactcctcct cactatttta
1141 ctcttggatg caaaatttta acgctcaccc cacgcaacaa gtggagtggc gtttctgact
1201 tgtccctcaa acaaaaactc ctttacacct tctatggtaa ggagtcactt gagaacccaa
1261 cctacattta ccactccgca ttcattgagt gtggaagttg tggtaatgat tcctggctta
1321 cagggaatgc tatccaaggg tttgcctgtg gatgtggggc atcatataca gctaatgatg
1381 tcgaagtcca atcatctggc atgattaagc caaatgctct tctttgtgct acttgcccct
1441 ttgctaaggg tgacagctgt tcttctaatt gcaaacattc agttgctcag ttggttagtt
1501 acctttctga acgctgtaat gttattgctg attctaagtc cttcacactt atctttggtg
1561 gcgtagctta cgcctacttt ggatgtgagg aaggtactat gtactttgtg cctagagcta
1621 agtctgttgt ctcaaggatt ggagactcca tctttacagg atgtactggc tcttggaaca
1681 aggtcactca aattgctaac atgttcttgg aacagactca gcattccctt aactttgtgg
1741 gagagttcgt tgtcaacgat gttgtcctcg caattctctc tggaaccaca actaatgttg
1801 acaaaatacg ccagcttctc aaaggtgtca ccattgacaa gttgcgtgat tatttagctg
1861 actatgacgt agcagtcact gccggcccat tcatggataa tgctattaat gttggtggta
1921 caggattaca gtatgccgcc attactgcac cttatgtagt tctcactggc ttaggtgagt
1981 cctttaagaa agttgcaacc ataccgtaca aggtttgcaa ctctgttaag gatactctga
2041 cttattatgc tcacagcgtg ttgtacagag tttttcctta tgacatggat tctggtgtgt
2101 catcctttag tgaactactt tttgattgcg ttgatctttc agtagcttct acctattttt
2161 tagtccgcct cttgcaagat aagactggcg actttatgtc tacaattatt acttcctgcc
2221 aaactgctgt tagtaagctt ctagatacat gttttgaagc tacagaagca acatttaact
2281 tcttgttaga tttggcagga ttgttcagaa tctttcttcg caatgcctat gtgtacactt
2341 cacaagggtt tgtggtggtc aatggcaaag tttctacact tgtcaaacaa gtgttagact
2401 tgcttaataa gggtatgcaa cttttgcata caaaggtctc ctgggctggt tctaatatca
2461 gtgctgttat ctacagcggc agggagtctc taatattccc atcgggaacc tattactgtg
2521 tcaccactaa ggctaagtcc gttcaacaag atcttgacgt tattttgcct ggtgagtttt
2581 ccaagaagca gttaggactg ctccaaccta ctgacaattc tacaactgtt agtgttactg
2641 tatccagtaa catggttgaa actgttgtgg gtcaacttga gcaaactaat atgcatagtc
2701 ctgatgttgt aggtgactat gtcattatta gtgaaaaatt gtttgtgcgt agtaaggaag
2761 aagacggatt cgccttctac cctgcttgca ctaatggtca tgctgtaccg actctcttta
2821 gacttaaggg aggtgcacct gtaaaaaaag tagcctttgg cggtgatcaa gtacatgagg
2881 ttgctgctgt aagaagtgtt actgtcgagt acaacattca tgctgtatta gacacactac
2941 ttgcttcttc tagtcttaga acctttgttg tagataagtc tttgtcaatt gaggagtttg
3001 ctgacgtagt aaaggaacaa gtctcagact tgcttgttaa attactgcgt ggaatgccga
3061 ttccagattt tgatttagac gattttattg acgcaccatg ctattgcttt aacgctgagg
3121 gtgatgcatc ttggtcttct actatgatct tctctcttca ccccgtcgag tgtgacgagg
3181 agtgttctga agtagaggct tcagatttag aagaaggtga atcagagtgc atttctgaga
3241 cttcaactga acaagttgac gtttctcatg aggtttctga cgacgagtgg gctgctgcag
3301 ttgatgaagc gttccccctc gatgaagcag aagatgttac tgaatctgtg caagaagaag
3361 cacaaccagt agaagtacct gttgaagata ttgcgcaggt tgtcatagct gacaccttac
3421 aggaaactcc tgttgtgtct gatactgttg aagtcccacc gcaagtggtg aaacttccgt
3481 ctgaacctca gactatccag cccgaggtaa aagaagttgc acctgtctat gaggctgata
3541 ccgaacagac acagagtgtt actgttaaac ctaagaggtt acgcaaaaag cgtaatgttg
3601 accctttgtc caattttgaa cataaggtta ttacagagtg cgttaccata gttttaggtg
3661 acgcaattca agtagccaag tgctatgggg agtctgtgtt agttaatgct gctaacacac
3721 atcttaagca tggcggtggt atcgctggtg ctattaatgc ggcttcaaaa ggggctgtcc
3781 aaaaagagtc agatgagtat attctggcta aagggccgtt acaagtagga gattcagttc
3841 tcttgcaagg ccattctcta gctaagaata tcctgcatgt cgtaggccca gatgcccgcg
3901 ctaaacagga tgtttctctc cttagtaagt gctataaggc tatgaatgca tatcctcttg
3961 tagtcactcc tcttgtttca acaggcatat ttggtgtaaa accagctgtg tcttttgatt
4021 atcttattag agaggctaag actagagttt tagtcgtcgt taattcccaa gatgtctata
4081 agagtcttac catagttgac attccacaga gtttgacttt ttcatatgat gggttacgtg
4141 gcgcaatacg taaagctaaa gattatggtt ttactgtttt tgtgtgcaca gacaactctg
4201 ctaacactaa agttcttagg aacaagggtg ttgattatac taagaagttt cttacagttg
4261 acggtgtgca atattattgc tacacgtcta aggacacttt agatgatatc ttacaacagg
4321 ctaataagtc tgttggtatt atatctatgc ctttgggata tgtgtctcat ggtttagact
4381 taattcaagc agggagtgtc gtgcgtagag ttaacgtgcc ctacgtgtgt ctcctagcta
4441 ataaagagca agaagctatt ttgatgtctg aagacgttaa gttaaaccct tcagaagatt
4501 ttataaagca cgtccgcact aatggtggtt acaattcttg gcatttagtc gagggtgaac
4561 tattggtgca agacttacgc tttaataagc tcctgcattg gtctgatcaa accatatgct
4621 acaaggatag tgtgttttat gttgtaaaga atagtacagc ttttccattt gaaacacttt
4681 cagcatgtcg tgcgtatttg gattcacgca cgacacagca gttaacaatc gaagtcttag
4741 tgactgtcga tggtgtaaat tttagaacag tcgttctaaa taataagaac acttatagat
4801 cacagcttgg atgcgttttc tttaatggtg ctgatatttc tgataccatt cctgatgaga
4861 aacagaatgg tcacagttta tatctagcag acaatttgac tgctgatgaa acaaaggcgc
4921 ttaaagagtt atatggcccc gttgatccta ctttcttaca cagattctat tcacttaagg
4981 ctgcagtcca taagtggaag atggttgtgt gtgataaggt acgttctctc aaattgagtg
5041 ataataattg ttatcttaat gcagttatta tgacacttga tttattgaag gacattaaat
5101 ttgttatacc tgctctacag catgcattta tgaaacataa gggcggtgat tcaactgact
5161 tcatagccct cattatggct tatggcaatt gcacatttgg tgctccagat gatgcctctc
5221 ggttacttca taccgtgctt gcaaaggctg agttatgctg ttctgcacgc atggtttgga
5281 gagagtggtg caatgtctgt ggcataaaag atgttgttct acaaggctta aaagcttgtt
5341 gttacgtggg tgtgcaaact gttgaagatc tgcgtgctcg catgacatat gtatgccagt
5401 gtggtggtga acgtcatcgg caaatagtcg aacacaccac cccctggttg ctgctctcag
5461 gcacaccaaa tgaaaaattg gtgacaacct ccacggcgcc tgattttgta gcgtttaatg
5521 tctttcaggg cattgaaacg gctgttggcc attatgttca tgctcgcctg aagggtggtc
5581 ttattttaaa gtttgactct ggcaccgtta gcaagacttc agactggaag tgcaaggtga
5641 cagatgtact tttccccggc caaaaataca gtagcgattg taatgtcgta cggtattctt
5701 tggacggtaa tttcagaaca gaggttgatc ccgacctatc tgctttctat gttaaggatg
5761 gtaaatactt tacaagtgaa ccacccgtaa catattcacc agctacaatt ttagctggta
5821 gtgtctacac taatagctgc cttgtatcgt ctgatggaca acctggcggt gatgctatta
5881 gtttgagttt taataacctt ttagggtttg attctagtaa accagtcact aagaaataca
5941 cttactcctt cttgcctaaa gaagacggcg atgtgttgtt ggctgagttt gacacttatg
6001 accctattta taagaatggt gccatgtata aaggcaaacc aattctttgg gtcaacaaag
6061 catcttatga tactaatctt aataagttca atagagctag tttgcgtcaa atttttgacg
6121 tagcccccat tgaactcgaa aataaattca cacctttgag tgtggcgtcc acaccagttg
6181 aacctccaac tgtagatgtg gtagcacttc aacaggaaat gacaattgtc aaatgtaagg
6241 gtttaaataa gcctttcgtg aaggacaatg tcagtttcgt tgttgatgac tcaggtactc
6301 ccgttgttga gtatctgtct aaagaagatc tacatacatt gtatgtagac cctaagtatc
6361 aagtcattgt cttaaaagac aatgtactct cttctatgct tagattgcac accgttgagt
6421 caggtgatat taacgttgtt gcagcttccg gatctttgac acgtaaagtg aagttactat
6481 ttagggcttc attttatttc aaagaatttg ctacccgcac tttcactgct accactgctg
6541 taggtagttg tataaagagt gtagtgcggc atctaggtgt tactaaaggc atattgacag
6601 gctgttttag ttttgtcaag atgttattta ttcttccact agcttacttt agtgattcaa
6661 aactcggcac cacagaggtt aaagtgagtg ctttgaaaac agctggcgtt gtgacaggta
6721 atgttgtaaa acagtgttgc actgctgctg ttgatttaag tatggataag ttgcgccgtg
6781 tggattggaa atcaacccta cggttgttac ttatgttatg cacaactatg gtattgttgt
6841 cttctgtgta tcacttgtat gtcttcaatc aggtcttatc aagtgatgtt atgtttgaag
6901 atgcccaagg tttgaaaaag ttctacaaag aagttagagc ttacctagga atctcttctg
6961 cttgtgacgg tcttgcttca gcttataggg cgaattcatt tgatgtacct acattctgcg
7021 caaaccgttc tgcaatgtgt aattggtgct tgattagcca agattccata actcactacc
7081 cagctcttaa gatggttcaa acacatctta gccactatgt tcttaacata gattggttgt
7141 ggtttgcatt tgagactggt ttggcataca tgctctatac ctcggccttc aactggttgt
7201 tgttggcagg tacattgcat tatttctttg cacagacttc catatttgta gactggcggt
7261 catacaatta tgctgtgtct agtgccttct ggttatttac ccacattcca atggcgggtt
7321 tggtacgaat gtataatttg ttagcatgcc tttggctttt acgcaagttt tatcagcatg
7381 taatcaatgg ttgcaaagat acggcatgct tgctctgcta taagaggaac cgacttacta
7441 gagttgaagc ttctaccgtt gtctgtggtg gaaaacgtac gttttatatc acagcaaatg
7501 gcggtatttc attctgtcgt aggcataatt ggaattgtgt ggattgtgac attgcaggtg
7561 tggggaatac cttcatctgt gaagaagtcg caaatgacct cactaccgcc ctacgcaggc
7621 ctattaacgc tacggataga tcacattatt atgtggattc cgttacagtt aaagagactg
7681 ttgttcagtt taattatcgt agagacggtc aaccattcta cgagcggttt cccctctgcg
7741 cttttacaaa tctagataag ttgaagttca aagaggtctg taaaactact actggtatac
7801 ctgaatacaa ctttatcatc tacgactcat cagatcgtgg ccaggaaagt ttagctaggt
7861 ctgcatgtgt ttattattct caagtcttgt gtaaatcaat tcttttggtt gactcaagtt
7921 tggttacttc tgttggtgat tctagtgaaa tcgccactaa aatgtttgat tcctttgtta
7981 atagtttcgt ctcgctgtat aatgtcacac gcgataagtt ggaaaaactt atctctactg
8041 ctcgtgatgg cgtaaggcga ggcgataact tccatagtgt cttaacaaca ttcattgacg
8101 cagcacgagg ccccgcaggt gtggagtctg atgttgagac caatgaaatt gttgactctg
8161 tgcagtatgc tcataaacat gacatacaaa ttactaatga gagttacaat aattatgtac
8221 cctcatatgt taaacctgat agtgtgtcta ccagtgattt aggtagtctc attgattgta
8281 atgcggcttc agttaaccaa attgtcttgc gtaattctaa tggtgcttgt atttggaacg
8341 ctgctgcata tatgaaactc tcggatgcac ttaaacgaca gattcgcatt gcatgccgta
8401 agtgtaattt agctttccgg ttaaccacct caaagctacg cgctaatgat aatatcttat
8461 cagttagatt cactgctaac aaaattgttg gtggtgctcc tacatggttt aatgtgttgc
8521 gtgactttac gttaaagggt tacgttcttg ctaccattat tgtgtttctg tgtgctgtac
8581 tgatgtattt gtgtttacct acattttcta tggtacctgt tgaattttat gaagaccgca
8641 tcttggactt taaagttctt gataatggta tcattaggga tgtaaatcct gatgataagt
8701 gctttgctaa taagcaccgg tccttcacac aatggtatca tgagcatgtt ggtggtgtct
8761 atgacaactc tatcacatgc ccattgacag ttgcagtaat tgctggagtt gctggtgctc
8821 gcattccaga cgtacctact acgttggctt gggtgaacaa tcagataatt ttctttgttt
8881 ctcgagtctt tgctaataca ggcagtgttt gctacactcc tatagatgag ataccctata
8941 agagtttctc tgatagtggt tgcattcttc catctgagtg cactatgttt agggatgcag
9001 agggccgtat gacaccatac tgccatgatc ctactgtttt gcctggggct tttgcgtaca
9061 gtcagatgag gcctcatgtt cgttacgact tgtatgatgg taacatgttt attaaatttc
9121 ctgaagtagt atttgaaagt acacttagga ttactagaac tctgtcaact cagtactgcc
9181 ggttcggtag ttgtgagtat gcacaagagg gtgtttgtat taccacaaat ggctcgtggg
9241 ccatttttaa tgaccaccat cttaatagac ctggtgtcta ttgtggctct gattttattg
9301 acattgtcag gcggttagca gtatcactgt tccagcctat tacttatttc caattgacta
9361 cctcattggt cttgggtata ggtttgtgtg cattcctgac tttgctcttc tattatatta
9421 ataaagtaaa acgtgctttt gcagattaca cccagtgtgc tgtaattgct gttgttgctg
9481 ctgttcttaa tagcttgtgc atctgctttg ttgcctctat accattgtgt atagtacctt
9541 acactgcatt gtactattat gctacattct attttactaa tgagcctgca tttattatgc
9601 atgtttcttg gtacattatg ttcgggccta tcgttcccat atggatgacc tgcgtctata
9661 cagttgcaat gtgctttaga cacttcttct gggttttagc ttattttagt aagaaacatg
9721 tagaagtttt tactgatggt aagcttaatt gtagtttcca ggacgctgcc tctaatatct
9781 ttgttattaa caaggacact tatgcagctc ttagaaactc tttaactaat gatgcctatt
9841 cacgattttt ggggttgttt aacaagtata agtacttctc tggtgctatg gaaacagccg
9901 cttatcgtga agctgcagca tgtcatcttg ctaaagcctt acaaacatac agcgagactg
9961 gtagtgatct tctttaccaa ccacccaact gtagcataac ctctggcgtg ttgcaaagcg
10021 gtttggtgaa aatgtcacat cccagtggag atgttgaggc ttgtatggtt caggttacct
10081 gcggtagcat gactcttaat ggtctttggc ttgacaacac agtctggtgc ccacgacacg
10141 taatgtgccc ggctgaccag ttgtctgatc ctaattatga tgccttgttg atttctatga
10201 ctaatcatag tttcagtgtg caaaaacaca ttggcgctcc agcaaacttg cgtgttgttg
10261 gtcatgccat gcaaggcact cttttgaagt tgactgtcga tgttgctaac cctagcactc
10321 cagcctacac ttttacaaca gtgaaacctg gcgcagcatt tagtgtgtta gcatgctata
10381 atggtcgtcc gactggtaca ttcactgttg taatgcgccc taactacaca attaagggtt
10441 cctttctgtg tggttcttgt ggtagtgttg gttacaccaa ggagggtagt gtgatcaatt
10501 tttgttacat gcatcaaatg gaacttgcta atggtacaca taccggttca gcatttgatg
10561 gtactatgta tggtgccttt atggataaac aagtgcacca agttcagtta acagacaaat
10621 actgcagtgt taatgtagta gcttggcttt acgcagcaat acttaatggt tgcgcttggt
10681 ttgtaaaacc taatcgcact agtgttgttt cttttaatga atgggctctt gccaaccaat
10741 tcactgaatt tgttggcact caatccgttg acatgttagc tgtcaaaaca ggcgttgcta
10801 ttgaacagct gctttatgcg atccaacaac tttatactgg gttccaggga aagcaaatcc
10861 ttggcagtac tatgttggaa gatgaattca cacctgagga tgttaatatg cagattatgg
10921 gtgtggttat gcagagtggt gtgagaaaag ttacatatgg tactgcgcat tggttgttcg
10981 cgacccttgt ctcaacctat gtgataatct tacaagccac taaatttact ttgtggaact
11041 acttgtttga gactattccc acacagttgt tcccactctt atttgtgact atggccttcg
11101 ttatgttgtt ggttaaacac aaacacacct ttttgacact tttcttgttg cctgtggcta
11161 tttgtttgac ttatgcaaac atagtctacg agcccactac tcccatttcg tcagcgctga
11221 ttgcagttgc aaattggctt gcccccacta atgcttatat gcgcactaca catactgata
11281 ttggtgtcta cattagtatg tcacttgtat tagtcattgt agtgaagaga ttgtacaacc
11341 catcactttc taactttgcg ttagcattgt gcagtggtgt aatgtggttg tacacttata
11401 gcattggaga agcctcaagc cccattgcct atctggtttt tgtcactaca ctcactagtg
11461 attatacgat tacagtcttt gttactgtca accttgcaaa agtttgcact tatgccatct
11521 ttgcttactc accacagctt acacttgtgt ttccggaagt gaagatgata cttttattat
11581 acacatgttt aggtttcatg tgtacttgct attttggtgt cttctctctt ttgaacctta
11641 agcttagagc acctatgggt gtctatgact ttaaggtctc aacacaagag ttcagattca
11701 tgactgctaa caatctaact gcacctagaa attcttggga ggctatggct ctgaacttta
11761 agttaatagg tattggcggt acaccttgta taaaggttgc tgctatgcag tctaaactta
11821 cagatcttaa atgcacatct gtggttctcc tctctgtgct ccaacagtta cacttagagg
11881 ctaatagtag ggcctgggct ttctgtgtta aatgccataa tgatatattg gcagcaacag
11941 accccagtga ggctttcgag aaattcgtaa gtctctttgc cactttaatg actttttctg
12001 gtaatgtaga tcttgatgcg ttagctagtg atatttttga cactcctagc gtacttcaag
12061 ctactctttc tgagttttca cacttagcta cctttgctga gttggaagct gcgcagaaag
12121 cctatcagga agctatggac tctggtgaca cctcaccaca agttcttaag gctttgcaga
12181 aggctgttaa tatagctaaa aacgcctatg agaaggataa ggcagtggcc cgtaagttag
12241 aacgtatggc tgatcaggct atgacttcta tgtataagca agcacgtgct gaagacaaga
12301 aagcaaaaat tgtcagtgct atgcaaacta tgttgtttgg tatgattaag aagctcgaca
12361 acgatgttct taatggtatc atttctaacg ctaggaatgg ttgtatacct cttagtgtca
12421 ttccactgtg tgcttcaaat aaacttcgcg ttgtaattcc tgacttcacc gtctggaatc
12481 aggtagtcac atatccctcg cttaactacg ctggggcttt gtgggacatt acagttataa
12541 acaatgtgga caatgaaatt gttaagtctt cagatgttgt agacagcaat gaaaatttaa
12601 catggccact tgttttagaa tgcactaggg catccacttc tgccgttaag ttgcaaaata
12661 atgagatcaa accttcaggt ttaaaaacca tggttgtgtc tgcaggtcaa gagcaaacta
12721 actgtaatac tagttcctta gcttattacg aacctgtgca gggtcgtaaa atgctgatgg
12781 ctcttctttc tgataatgcc tatctcaaat gggcgcgtgt tgaaggtaag gacggatttg
12841 ttagtgtaga gctacaacct ccttgcaaat tcttgattgc gggaccaaaa ggacctgaaa
12901 tccgatatct ctattttgtt aaaaatctta acaaccttca tcgcgggcaa gtgttagggc
12961 acattgctgc gactgttaga ttgcaagctg gttctaacac cgagtttgcc tctaattctt
13021 cggtgttgtc acttgttaac ttcaccgttg atcctcaaaa agcttatctc gatttcgtca
13081 atgcgggagg tgccccattg acaaattgtg ttaagatgct tactcctaaa actggtacag
13141 gtatagctat atctgttaaa ccagagagta cagctgatca agagacttat ggtggagctt
13201 cagtgtgtct ctattgccgt gcgcatatag aacatcctga tgtctctggt gtttgtaaat
13261 ataagggtaa gtttgtccaa atccctgctc agtgtgtccg tgaccctgtg ggattttgtt
13321 tgtcaaatac cccctgtaat gtctgtcaat attggattgg atatgggtgc aattgtgact
13381 cgcttaggca agtagcactg ccccaatcta aagattccaa ttttttaaac gagtccgggg
13441 ttctattgta aatgcccgaa tagaaccctg ttcaagtggt ttgtccactg atgtcgtctt
13501 tagggcattt gacatctgca actataaggc taaggttgct ggtattggaa aatactacaa
13561 gactaatact tgtaggtttg tagaattaga tgaccaaggg catcatttag actcctattt
13621 tgtcgttaag aggcatacta tggagaatta tgaactagag aagcactgtt acgatttgtt
13681 acgtgactgt gatgctgtag ctccccatga tttcttcatc tttgatgtag acaaagttaa
13741 aacacctcat attgtacgtc agcgtttaac tgagtacact atgatggatc ttgtatatgc
13801 cctgaggcac tttgatcaaa atagcgaagt gcttaaggct atcttagtga agtatggttg
13861 ctgtgatgtt acctactttg aaaataaact ctggtttgat tttgttgaaa atcccagtgt
13921 tattggtgtt tatcataaac ttggagaacg tgtacgccaa gctatcttaa acactgttaa
13981 attttgtgac cacatggtca aggctggttt agtcggtgtg ctcacactag acaaccagga
14041 ccttaatggc aagtggtatg attttggtga cttcgtaatc actcaacctg gttcaggagt
14101 agctatagtt gatagctact attcttattt gatgcctgtg ctctcaatga ccgattgtct
14161 ggccgctgag acacataggg attgtgattt taataaacca ctcattgagt ggccacttac
14221 tgagtatgat tttactgatt ataaggtaca actctttgag aagtacttta aatattggga
14281 tcagacgtat cacgcaaatt gcgttaattg tactgatgac cgttgtgtgt tacattgtgc
14341 taatttcaat gtattgtttg ctatgaccat gcctaagact tgtttcggac ccatagtccg
14401 aaagatcttt gttgatggcg tgccatttgt agtatcttgt ggttatcact acaaagaatt
14461 aggtttagtc atgaatatgg atgttagtct ccatagacat aggctctctc ttaaggagtt
14521 gatgatgtat gccgctgatc cagccatgca cattgcctcc tctaacgctt ttcttgattt
14581 gaggacatca tgttttagtg tcgctgcact tacaactggt ttgacttttc aaactgtgcg
14641 gcctggcaat tttaaccaag acttctatga tttcgtggta tctaaaggtt tctttaagga
14701 gggctcttca gttacgctca aacatttttt ctttgctcaa gatggtaatg ctgctattac
14761 agattataat tactattctt ataatctgcc tactatgtgt gacatcaaac aaatgttgtt
14821 ctgcatggaa gttgtaaaca agtacttcga aatctatgac ggtggttgtc ttaatgcttc
14881 tgaagtggtt gttaataatt tagacaagag tgctggccat ccttttaata agtttggcaa
14941 agctcgtgtc tattatgaga gcatgtctta ccaggagcaa gatgaactct ttgccatgac
15001 aaagcgtaac gtcattccta ccatgactca aatgaatcta aaatatgcta ttagtgctaa
15061 gaatagagct cgcactgttg caggcgtgtc catacttagc acaatgacta atcgccagta
15121 ccatcagaaa atgcttaagt ccatggctgc aactcgtgga gcgacttgcg tcattggtac
15181 tacaaagttc tatggtggct gggatttcat gcttaaaaca ttgtacaaag atgttgataa
15241 tccgcatctt atgggttggg attaccctaa gtgtgataga gctatgccta atatgtgtag
15301 aatcttcgct tcactcatat tagctcgtaa acatggcact tgttgtacta caagggacag
15361 attttatcgc ttggcaaatg agtgtgctca ggtgctaagc gaatatgttc tatgtggtgg
15421 tggttactac gtcaaacctg gaggtaccag tagcggagat gccaccactg catatgccaa
15481 tagtgtcttt aacattttgc aggcgacaac tgctaatgtc agtgcactta tgggtgctaa
15541 tggcaacaag attgttgaca aagaagttaa agacatgcag tttgatttgt atgtcaatgt
15601 ttacaggagc actagcccag accccaaatt tgttgataaa tactatgctt ttcttaataa
15661 gcacttttct atgatgatac tgtctgatga cggtgtcgtt tgctataata gtgattatgc
15721 agctaagggt tacattgctg gaatacagaa ttttaaggaa acgctgtatt atcagaacaa
15781 tgtctttatg tctgaagcta aatgctgggt ggaaaccgat ctgaagaaag ggccacatga
15841 attctgttca cagcatacgc tttatattaa ggatggcgac gatggttact tccttcctta
15901 tccagaccct tcaagaattt tgtctgccgg ttgctttgta gatgatatcg ttaagactga
15961 cggtacactc atggtagagc ggtttgtgtc tttggctata gatgcttacc ctctcacaaa
16021 gcatgaagat atagaatacc agaatgtatt ctgggtctac ttacagtata tagaaaaact
16081 gtataaagac cttacaggac acatgcttga cagttattct gtcatgctat gtggtgataa
16141 ttctgctaag ttttgggaag aggcattcta cagagatctc tatagttcgc ctaccacttt
16201 gcaggctgtc ggttcatgcg ttgtatgcca ttcacagact tccctacgct gtgggacatg
16261 catccgtaga ccatttctct gctgtaaatg ctgctatgat catgttatag caactccaca
16321 taagatggtt ttgtctgttt ctccttacgt ttgtaatgcc cctggttgtg gcgtttcaga
16381 cgttactaag ctatatttag gtggtatgag ctacttttgt gtagatcata gacctgtgtg
16441 tagttttcca ctttgcgcta atggtcttgt attcggctta tacaagaata tgtgcacagg
16501 tagtccttct atagttgaat ttaataggtt ggctacctgt gactggactg aaagtggtga
16561 ttacaccctt gccaatacta caacagaacc actcaaactt tttgctgctg agactttacg
16621 tgccactgaa gaggcgtcta agcagtctta tgctattgcc accatcaaag aaattgttgg
16681 tgagcgccaa ctattacttg tgtgggaggc tggcaagtcc aaaccaccac tcaatcgtaa
16741 ttatgttttt actggttatc atataaccaa aaatagtaaa gtgcagctcg gtgagtacat
16801 cttcgagcgc attgattata gtgatgctgt atcctacaag tctagtacaa cgtataaact
16861 gactgtaggt gacatcttcg tacttacctc tcactctgtg gctaccttga cggcgcccac
16921 aattgtgaat caagagaggt atgttaaaat tactgggttg tacccaacca ttacggtacc
16981 tgaagagttc gcaagtcatg ttgccaactt ccaaaaatca ggttatagta aatatgtcac
17041 tgttcaggga ccacctggca ctggcaaaag tcattttgct atagggttag cgatttacta
17101 ccctacagca cgtgttgttt atacagcatg ttcacacgca gctgttgatg ctttgtgtga
17161 aaaagctttt aaatatttga acattgctaa atgttcccgt atcattcctg caaaggcacg
17221 tgttgagtgc tatgacaggt ttaaagttaa tgagacaaat tctcaatatt tgtttagtac
17281 tattaatgct ctaccagaaa cttctgccga tattctggtg gttgatgagg ttagtatgtg
17341 cactaattat gatctttcaa ttattaatgc acgtattaaa gctaagcaca ttgtctatgt
17401 aggagatcca gcacagttgc cagctcctag gactttgttg actagaggca cattggaacc
17461 agaaaatttc aatagtgtca ctagattgat gtgtaactta ggtcctgaca tatttttaag
17521 tatgtgctac aggtgtccta aggaaatagt aagcactgtg agcgctcttg tctacaataa
17581 taaattgtta gccaagaagg agctttcagg ccagtgcttt aaaatactct ataagggcaa
17641 cgtgacgcat gatgctagct ctgccattaa tagaccacaa ctcacatttg tgaagaattt
17701 tattactgcc aatccggcat ggagtaaggc agtctttatt tcgccttata attcacagaa
17761 tgctgtggct cgttcaatgc tgggtcttac tactcagact gttgattcct cacagggttc
17821 agaataccag tacgttatct tctgtcaaac agcagatacg gcacatgcta acaacattaa
17881 cagatttaat gttgcaatca ctcgtgccca aaaaggtatt ctttgtgtta tgacatctca
17941 ggcactcttt gagtccttag agtttactga attgtctttt actaattaca agctccagtc
18001 tcagattgta actggccttt ttaaagattg ctctagagaa acttctggcc tctcacctgc
18061 ttatgcacca acatacgtta gtgttgatga caagtataag acgagtgatg agctttgcgt
18121 gaatcttaat ttacccgcaa atatcccata ctctcgtgtt atttccagga tgggctttaa
18181 actcgatgca acagttcctg gatatcctaa gcttttcatt actcgtgaag aggctgtaag
18241 gcaagttcga agctggatag gcttcgatgt tgagggtgct catgcttccc gtaatgcatg
18301 tggcaccaat gtgcctctac aattaggatt ttcaactggt gtgaactttg ttgttcagcc
18361 agttggtgtt gtagacactg agtggggtaa catgttaacg ggcattgctg cccgtcctcc
18421 accaggtgaa cagtttaagc acctcgtgcc tcttatgcat aagggggctg cgtggcctat
18481 tgttagacga cgtatagtgc aaatgttgtc agacacttta gacaaattgt ctgattactg
18541 tacgtttgtt tgttgggctc atggctttga attaacgtct gcatcatact tttgcaagat
18601 aggtaaggaa cagaagtgtt gcatgtgcaa tagacgcgct gcagcgtact cttcacctct
18661 gcaatcttat gcctgctgga cccattcctg cggttatgat tatgtctaca accctttctt
18721 tgtcgatgtt caacagtggg gttatgtagg caatcttgct actaatcacg atcgttattg
18781 ctctgtccat caaggagctc atgtggcttc taatgatgca ataatgactc gttgtttagc
18841 tattcattct tgttttatag aacgtgtgga ttgggatata gagtatcctt atatctcaca
18901 tgaaaagaaa ttgaattcct gttgtagaat cgttgagcgc aacgtcgtac gtgctgctct
18961 tcttgccggt tcatttgaca aagtctatga tattggcaat cctaaaggaa ttcctattgt
19021 tgatgaccct gtggttgatt ggcattattt tgatgcacag cccttgacca gaaaggtaca
19081 acagcttttc tatacagagg acatggcctc aagatttgct gatgggctct gcttattttg
19141 gaactgtaat gtaccaaaat atcctaataa tgcaattgta tgcaggtttg acacacgtgt
19201 gcattctgag ttcaatttgc caggttgtga tggcggtagt ttgtatgtta acaagcacgc
19261 ttttcataca ccagcatatg atgtgagtgc attccgtgat ctgaaacctt taccattctt
19321 ttattattct actacaccat gtgaagtgca tggtaatggt agtatgatag aggatattga
19381 ttatgtaccc ctaaaatctg cagtctgtat tacagcttgt aatttagggg gcgctgtttg
19441 taggaagcat gctacagagt acagagagta tatggaagca tataatcttg tctctgcatc
19501 aggtttccgc ctttggtgtt ataagacctt tgatatttat aatctctggt ctacttttac
19561 aaaagttcaa ggtttggaaa acattgcttt taatgttgtt aaacaaggcc attttattgg
19621 tgttgagggt gaactacctg tagctgtagt caatgataag atcttcacca agagtggcgt
19681 taatgacatt tgtatgtttg agaataaaac cactttgcct actaatatag cttttgaact
19741 ctatgctaag cgtgctgtac gctcgcatcc cgatttcaaa ttgctacaca atttacaagc
19801 agacatttgc tacaagttcg tcctttggga ttatgaacgt agcaatattt atggtactgc
19861 tactattggt gtatgtaagt acactgatat tgatgttaat tcagctttga atatatgttt
19921 tgacatacgc gataatggtt cattggagaa gttcatgtct actcccaatg ccatctttat
19981 ttctgataga aaaattaaga aatacccttg tattgtaggt cctgattatg cttacttcaa
20041 tggtgctatc atccgtgata gtgatgttgt taaacaacca gtgaagttct acttgtataa
20101 gaaagtcaat aatgagttta ttgatcctac tgagtgtatt tacactcaga gtcgctcttg
20161 tagtgacttc ctacccctgt ctgacatgga gaaagacttt ctatcttttg atagtgatgt
20221 tttcattaag aagtatggct tggaaaacta tgcttttgag cacgtagtct atggagactt
20281 ctctcatact acgttaggcg gtcttcactt gcttattggt ttatacaaga agcaacagga
20341 aggtcatatt attatggaag aaatgctaaa aggtagctca actattcata actattttat
20401 tactgagact aacacagcgg cttttaaggc ggtgtgttct gttatagatt taaagcttga
20461 cgactttgtt atgattttaa agagtcaaga ccttggcgta gtatccaagg ttgtcaaggt
20521 tcctattgac ttaacaatga ttgagtttat gttatggtgt aaggatggac aggttcaaac
20581 cttctaccct cgactccagg cttctgcaga ttggaaacct ggtcatgcaa tgccatccct
20641 ctttaaagtt caaaatgtaa accttgaacg ttgtgagctt gctaattaca agcaatctat
20701 tcctatgcct cgcggtgtgc acatgaacat cgctaaatat atgcaattgt gccagtattt
20761 aaatacttgc acattagccg tgcctgccaa tatgcgtgtt atacattttg gcgctggttc
20821 tgataaaggt atcgctcctg gtacatcagt tttacgacag tggcttccta cagatgccat
20881 tattatagat aatgatttaa atgagttcgt gtcagatgct gacataactt tatttggaga
20941 ttgtgtaact gtacgtgtcg gccaacaagt ggatcttgtt atttccgaca tgtatgatcc
21001 tactactaag aatgtaacag gtagtaatga gtcaaaggct ttattcttta cttacctgtg
21061 taacctcatt aataataatc ttgctcttgg tgggtctgtt gctattaaaa taacagaaca
21121 ctcttggagc gttgaacttt atgaacttat gggaaaattt gcttggtgga ctgttttctg
21181 caccaatgca aatgcatcct catctgaagg attcctctta ggtattaatt acttgggtac
21241 tattaaagaa aatatagatg gtggtgctat gcacgccaac tatatatttt ggagaaattc
21301 cactcctatg aatctgagta cttactcact ttttgattta tccaagtttc aattaaaatt
21361 aaaaggaaca ccagttcttc aattaaagga gagtcaaatt aacgaactcg taatatctct
21421 cctgtcgcag ggtaagttac ttatccgtga caatgataca ctcagtgttt ctactgatgt
21481 tcttgttaac acctacagaa agttacgttg atgtagggcc agattctgtt aagtctgctt
21541 gtattgaggt tgatatacaa cagactttct ttgataaaac ttggcctagg ccaattgatg
21601 tttctaaggc tgacggtatt atataccctc aaggccgtac atattctaac ataactatca
21661 cttatcaagg tctttttccc tatcagggag accatggtga tatgtatgtc tactctgcag
21721 gacatgctac aggcacaact ccacaaaagt tgtttgtagc taactattct caggacgtca
21781 aacagtttgc taatgggttt gtcgtccgta taggagcagc tgccaattcc actggcactg
21841 ttattattag cccatctacc agcgctacta tacgaaaaat ttaccctgct tttatgctgg
21901 gttcttcagt tggtaatttc tcagatggta aaatgggccg cttcttcaat catactctag
21961 ttcttttgcc cgatggatgt ggcactttac ttagagcttt ttattgtatt ctagagcctc
22021 gctctggaaa tcattgtcct gctggcaatt cctatacttc ttttgccact tatcatactc
22081 ctgcaacaga ttgttctgat ggcaattaca atcgtaatgc cagtctgaac tcttttaagg
22141 agtattttaa tttacgtaac tgcaccttta tgtacactta taacattacc gaagatgaga
22201 ttttagagtg gtttggcatt acacaaactg ctcaaggtgt tcacctcttc tcatctcggt
22261 atgttgattt gtacggcggc aatatgtttc aatttgccac cttgcctgtt tatgatacta
22321 ttaagtatta ttctatcatt cctcacagta ttcgttctat ccaaagtgat agaaaagctt
22381 gggctgcctt ctacgtatat aaacttcaac cgttaacttt cctgttggat ttttctgttg
22441 atggttatat acgcagagct atagactgtg gttttaatga tttgtcacaa ctccactgct
22501 catatgaatc cttcgatgtt gaatctggag tttattcagt ttcgtctttc gaagcaaaac
22561 cttctggctc agttgtggaa caggctgaag gtgttgaatg tgatttttca cctcttctgt
22621 ctggcacacc tcctcaggtt tataatttca agcgtttggt ttttaccaat tgcaattata
22681 atcttaccaa attgctttca cttttttctg tgaatgattt tacttgtagt caaatatctc
22741 cagcagcaat tgctagcaac tgttattctt cactgatttt ggattatttt tcatacccac
22801 ttagtatgaa atccgatctc agtgttagtt ctgctggtcc aatatcccag tttaattata
22861 aacagtcctt ttctaatccc acatgtttga ttttagcgac tgttcctcat aaccttacta
22921 ctattactaa gcctcttaag tacagctata ttaacaagtg ctctcgtctt ctttctgatg
22981 atcgtactga agtacctcag ttagtgaacg ctaatcaata ctcaccctgt gtatccattg
23041 tcccatccac tgtgtgggaa gacggtgatt attataggaa acaactatct ccacttgaag
23101 gtggtggctg gcttgttgct agtggctcaa ctgttgccat gactgagcaa ttacagatgg
23161 gctttggtat tacagttcaa tatggtacag acaccaatag tgtttgcccc aagcttgaat
23221 ttgctaatga cacaaaaatt gcctctcaat taggcaattg cgtggaatat tccctctatg
23281 gtgtttcggg ccgtggtgtt tttcagaatt gcacagctgt aggtgttcga cagcagcgct
23341 ttgtttatga tgcgtaccag aatttagttg gctattattc tgatgatggc aactactact
23401 gtttgcgtgc ttgtgttagt gttcctgttt ctgtcatcta tgataaagaa actaaaaccc
23461 acgctactct atttggtagt gttgcatgtg aacacatttc ctctaccatg tctcaatact
23521 cccgttctac gcgatcaatg cttaaacggc gagattctac atatggtccc cttcagacac
23581 ctgttggttg tgtcctagga cttgttaatt cctctttgtt cgtagaggac tgcaagttgc
23641 ctcttggtca atctctctgt gctcttcctg acacacctag tactctcaca cctcgcagtg
23701 tgcgctctgt tccaggtgaa atgcgcttgg catccattgc ttttaatcat cctattcagg
23761 ttgatcaact taatagtagt tattttaaat taagtatacc tactaatttt tcctttggtg
23821 tgactcagga gtacattcag acaaccattc agaaagttac tgttgattgt aaacagtacg
23881 tttgcaatgg tttccagaag tgtgagcaat tactgcgcga gtatggccag ttttgttcca
23941 aaataaacca ggctctccat ggtgccaatt tacgccagga tgattctgta cgtaatttgt
24001 ttgcgagcgt gaaaagctct caatcatctc ctatcatacc aggttttgga ggtgacttta
24061 atttgacact tctagaacct gtttctatat ctactggcag tcgtagtgca cgtagtgcta
24121 ttgaggattt gctatttgac aaagtcacta tagctgatcc tggttatatg caaggttacg
24181 atgattgtat gcagcaaggt ccagcatcag ctcgtgatct tatttgtgct caatatgtgg
24241 ctggttataa agtattacct cctcttatgg atgttaatat ggaagccgcg tacacttcat
24301 ctttgcttgg cagcatagca ggtgttggct ggactgctgg cttatcctcc tttgctgcta
24361 ttccatttgc acagagtatt ttttataggt taaacggtgt tggcattact caacaggttc
24421 tttcagagaa ccaaaagctt attgccaata agtttaatca ggctctggga gctatgcaaa
24481 caggcttcac tacaactaat gaagcttttc ggaaggttca ggatgctgtg aacaacaatg
24541 cacaggctct atccaaatta gctagcgagc tatctaatac ttttggtgct atttccgcct
24601 ctattggaga catcatacaa cgtcttgatg ttctcgaaca ggacgcccaa atagacagac
24661 ttattaatgg ccgtttgaca acactaaatg cttttgttgc acagcagctt gttcgttccg
24721 aatcagctgc tctttccgct caattggcta aagataaagt caatgagtgt gtcaaggcac
24781 aatccaagcg ttctggattt tgcggtcaag gcacacatat agtgtccttt gttgtaaatg
24841 cccctaatgg cctttacttt atgcatgttg gttattaccc tagcaaccac attgaggttg
24901 tttctgctta tggtctttgc gatgcagcta accctactaa ttgtatagcc cctgttaatg
24961 gctactttat taaaactaat aacactagga ttgttgatga gtggtcatat actggctcgt
25021 ccttctatgc acctgagccc atcacctctc ttaatactaa gtatgttgca ccacaggtga
25081 cataccaaaa catttctact aacctccctc ctcctcttct cggcaattcc accgggattg
25141 acttccaaga tgagttggat gagtttttca aaaatgttag caccagtata cctaattttg
25201 gttctctaac acagattaat actacattac tcgatcttac ctacgagatg ttgtctcttc
25261 aacaagttgt taaagccctc aatgagtctt acatagacct taaagagctt ggcaattata
25321 cttattacaa caaatggccg tggtacattt ggcttggttt cattgctggg cttgttgcct
25381 tagctctatg cgtcttcttc atactgtgct gcactggttg tggcacaaac tgtatgggaa
25441 aacttaagtg taatcgttgt tgtgatagat acgaggaata cgacctcgag ccgcataagg
25501 ttcatgttca ctaattaacg aactatcaat gagagttcaa agaccaccca ctctcttgtt
25561 agtgttctca ctctcttttt tggtcactgc attttcaaaa cctctctatg tacctgagca
25621 ttgtcagaat tattctggtt gcatgcttag ggcttgtatt aaaactgccc aagctgatac
25681 agctggtctt tatacaaatt ttcgaattga cgtcccatct gcagaatcaa ctggtactca
25741 atcagtttct gtcgatcgtg agtctacttc aactcatgat ggtcttaccg aacatgttac
25801 tagtgtgaat ctttttgacg ttggttactc agttaattaa cgaactctat ggattacgtg
25861 tctctgctta atcaaatttg gcagaagtac cttaattcac cgtatactac ttgtttgtat
25921 atccctaaac ccacagctaa gtatacacct ttagttggca cttcattgca ccctgtgctg
25981 tggaactgtc agctatcctt tgctggttat actgaatctg ctgttaattc tacaaaagct
26041 ttggccaaac aggacgcagc tcagcgaatc gcttggttgc tacataagga tggaggaatc
26101 cctgacggat gttccctcta cctccggcac tcaagtttat tcgcgcaaag cgaggaagag
26161 gagtcattct ccaactaaga aactgcgcta cgttaagcgt agattttctc ttctgcgccc
26221 tgaagacctt agtgttattg tccaaccaac acactatgtc agggttacat tttcagaccc
26281 caacatgtgg tatctacgtt cgggtcatca tttacactca gttcacaatt ggcttaaacc
26341 ttatggcggc caacctgttt ctgagtacca tattactcta gctttgctaa atctcactga
26401 tgaagattta gctagagatt tttcacccat tgcgctcttt ttgcgcaatg tcagatttga
26461 gctacatgag ttcgccttgc tgcgcaaaac tcttgttctt aatgcatcag agatctactg
26521 tgctaacata catagattta agcctgtgta tagagttaac acggcaatcc ctactattaa
26581 ggattggctt ctcgttcagg gattttccct ttaccatagt ggcctccctt tacatatgtc
26641 aatctctaaa ttgcatgcac tggatgatgt tactcgcaat tacatcatta caatgccatg
26701 ctttagaact tatcctcaac aaatgtttgt tactcctttg gccgtagatg ttgtctccat
26761 acggtcttcc aatcagggta ataaacaaat tgttcattct taccccattt tacatcatcc
26821 aggattttaa cgaactatgg ctttctcggc gtctttattt aaacccgtcc agctagtccc
26881 agtttctcct gcatttcatc gcattgagtc tactgactct attgttttca catacattcc
26941 tgctagcggc tatgtagctg ctttagctgt caatgtgtgt ctcattcccc tattattact
27001 gctacgtcaa gatacttgtc gtcgcagcat tatcagaact atggttctct atttccttgt
27061 tctttataac tttttattag ccattgtact agtcaatggt gtacattatc caactggaag
27121 ttgcctgata gccttcttag ttatcctcat aatactttgg tttgtagata gaattcgttt
27181 ctgtctcatg ctgaattcct acattccact gtttgacatg cgttctcact ttattcgtgt
27241 tagtacagtt tcttctcatg gtatggtccc tgtcatacac accaaaccat tatttattag
27301 aaacttcgat cagcgttgca gctgttctcg ttgtttttat ttgcactctt ctacttatat
27361 agagtgcact tatattagcc gttttagtaa gattagccta gtttctgtaa ctgacttctc
27421 cttaaacggc aatgtttcca ctgttttcgt gcctgcaacg cgcgattcag ttcctcttca
27481 cataatcgcc ccgagctcgc ttatcgttta agcagctctg cgctactatg ggtcccgtgt
27541 agaggctaat ccattagtct ctctttggac atatggaaaa cgaactatgt taccctttgt
27601 ccaagaacga atagggttgt tcatagtaaa ctttttcatt tttaccgtag tatgtgctat
27661 aacactcttg gtgtgtatgg ctttccttac ggctactaga ttatgtgtgc aatgtatgac
27721 aggcttcaat accctgttag ttcagcccgc attatacttg tataatactg gacgttcagt
27781 ctatgtaaaa ttccaggata gtaaaccccc tctaccacct gacgagtggg tttaacgaac
27841 tccttcataa tgtctaatat gacgcaactc actgaggcgc agattattgc cattattaaa
27901 gactggaact ttgcatggtc cctgatcttt ctcttaatta ctatcgtact acagtatgga
27961 tacccatccc gtagtatgac tgtctatgtc tttaaaatgt ttgttttatg gctcctatgg
28021 ccatcttcca tggcgctatc aatatttagc gccatttatc caattgatct agcttcccag
28081 ataatctctg gcattgtagc agctgtttca gctatgatgt ggatttccta ctttgtgcag
28141 agtatccggc tgtttatgag aactggatca tggtggtcat tcaatcctga gactaattgc
28201 cttttgaacg ttccaattgg tggtacaact gtcgtacgtc cactcgtaga ggactctacc
28261 agtgtaactg ctgttgtaac caatggtcac ctcaaaatgg ctggcatgca tttcggtgct
28321 tgtgactacg acagacttcc taatgaagtc accgtggcca aacccaatgt gctgattgct
28381 ttaaaaatgg tgaagcggca aagctacgga actaattccg gcgttgccat ttaccataga
28441 tataaggcag gtaattacag gagtccgcct attacggcgg atattgaact tgcattgctt
28501 cgagcttagg ctctttagta agagtatctt aattgatttt aacgaatctc aatttcattg
28561 ttatggcatc ccctgctgca ccttgtgctg tttcctttgc cgataacaat gatataacaa
28621 atacaaacct gtctcgaggt agaggacgta atccaaaacc acgagctgca ccaaataaca
28681 ctgtctcttg gtacactggg cttacccaac acgggaaagt ccctcttacc tttccacctg
28741 ggcagggtgt acctcttaat gccaattcca cccctgcgca aaatgctggg tattggcgga
28801 gacaggacag aaaaattaat accgggaatg gaattaagca actggctccc aggtggtact
28861 tctactacac tggaactgga cccgaagcag cactcccatt ccgggctgtt aaggatggca
28921 tcgtttgggt ccatgaagat ggcgccactg atgctccttc aacttttggg acgcggaacc
28981 ctaacaatga ttcagctatt gttacacaat tcgcgcccgg tactaagctt cctaaaaact
29041 tccacattga ggggactgga ggcaatagtc aatcatcttc aagagcctct agcgtaagca
29101 gaaactcttc cagatctagt tcacaaggtt caagatcagg aaactctacc cgcggcactt
29161 ctccaggtcc atctggaatc ggagcagtag gaggtgatct actttacctt gatcttctga
29221 acagactaca agcccttgag tctggcaaag taaagcaatc gcagccaaaa gtaatcacta
29281 agaaagatgc tgctgctgct aaaaataaga tgcgccacaa gcgcacttcc accaaaagtt
29341 tcaacatggt gcaagctttt ggtcttcgcg gaccaggaga cctccaggga aactttggtg
29401 atcttcaatt gaataaactc ggcactgagg acccacgttg gccccaaatt gctgagcttg
29461 ctcctacagc cagtgctttt atgggtatgt cgcaatttaa acttacccat cagaacaatg
29521 atgatcatgg caaccctgtg tacttccttc ggtacagtgg agccattaaa cttgacccaa
29581 agaatcccaa ctacaataag tggttggagc ttcttgagca aaatattgat gcctacaaaa
29641 ccttccctaa gaaggaaaag aaacaaaagg caccaaaaga agaatcaaca gaccaaatgt
29701 ctgaacctcc aaaggagcag cgtgtgcaag gtagcatcac tcagcgcact cgcacccgtc
29761 caagtgttca gcctggtcca atgattgatg ttaacactga ttagtgtcac tcaaagtaac
29821 aagatcgcgg caatcgtttg tgtttggtaa ccccatctca ccatcgcttg tccactcttg
29881 cacagaatgg aatcatgttg taattacagt gcaataaggt aattataacc catttaattg
29941 atagctatgc tttattaaag tgtgtagctg tagagagaat gttaaagact gtcacctctg
30001 cgtgattgca agtgaacagt gccccccggg aagagctcta cagtgtgaaa tgtaaataaa
30061 aatagctatt attcaattag attaggctaa ttagatgatt tgcaaaaaaa aaaaaaaaaa

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Tue Jun 09, 2015 10:06 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
Middle East respiratory syndrome coronavirus strain ChinaGD01, complete genome 54134 54134 99% 0.0 99% KT006149.1
Select seq gb|KF600628.1| Middle East respiratory syndrome coronavirus isolate Hafr-Al-Batin_1_2013, complete genome 54035 54035 99% 0.0 99% KF600628.1
Select seq gb|KJ650098.1| Middle East respiratory syndrome coronavirus isolate Camel/Qatar_2_2014, complete genome 53995 53995 99% 0.0 99% KJ650098.1
Select seq gb|KJ829365.1| Middle East respiratory syndrome coronavirus strain Florida/USA-2_Saudi Arabia_2014, complete genome 53992 53992 100% 0.0 99% KJ829365.1
Select seq gb|KP223131.1| Middle East respiratory syndrome coronavirus isolate Florida/USA-2_Saudi Arabia_2014, complete genome 53983 53983 100% 0.0 99% KP223131.1
Select seq gb|KF961222.1| Middle East respiratory syndrome coronavirus isolate Qatar4, complete genome 53967 53967 99% 0.0 99% KF961222.1
Select seq gb|KJ713295.1| Middle East respiratory syndrome coronavirus isolate KSA-CAMEL-505, complete genome 53956 53956 99% 0.0 99% KJ713295.1
Select seq gb|KJ713296.1| Middle East respiratory syndrome coronavirus isolate KSA-CAMEL-378, complete genome 53952 53952 99% 0.0 99% KJ713296.1
Select seq gb|KF961221.1| Middle East respiratory syndrome coronavirus isolate Qatar3, complete genome 53952 53952 99% 0.0 99% KF961221.1
Select seq gb|KC667074.1| Human betacoronavirus 2c England-Qatar/2012, complete genome 53952 53952 99% 0.0 99% KC667074.1

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Tue Jun 09, 2015 10:09 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
3 bp deletion

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Tue Jun 09, 2015 10:11 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
LOCUS KT026455 30114 bp RNA linear VRL 09-JUN-2015
DEFINITION Middle East respiratory syndrome coronavirus isolate
Hu/Riyadh_KSA_2959_2015, complete genome.
ACCESSION KT026455
VERSION KT026455.1 GI:828436876
KEYWORDS .
SOURCE Middle East respiratory syndrome coronavirus (MERS-CoV)
ORGANISM Middle East respiratory syndrome coronavirus
Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA
stage; Nidovirales; Coronaviridae; Coronavirinae; Betacoronavirus;
unclassified Betacoronavirus.
REFERENCE 1 (bases 1 to 30114)
AUTHORS Queen,K., Tamin,A., Bin Saeed,A., Paden,C., Zhang,J., Li,Y.,
Tao,Y., Erdman,D. and Tong,S.
TITLE Direct Submission
JOURNAL Submitted (06-JUN-2015) Division of Viral Diseases, Centers for
Disease Control and Prevention, 1600 Clifton Rd NE, Atlanta, GA
30033, USA
COMMENT ##Assembly-Data-START##
Assembly Method :: CLC Genomics Workbench v. 7.0.3
Sequencing Technology :: Illumina; Sanger dideoxy sequencing
##Assembly-Data-END##
FEATURES Location/Qualifiers
source 1..30114
/organism="Middle East respiratory syndrome coronavirus"
/mol_type="genomic RNA"
/isolate="Hu/Riyadh_KSA_2959_2015"
/isolation_source="tracheal aspirate"
/host="Homo sapiens"
/db_xref="taxon:1335626"
/country="Saudi Arabia"
/collection_date="10-Feb-2015"
/note="passaged in Vero cells"
gene 270..21505
/gene="orf1ab"
CDS join(270..13424,13424..21505)
/gene="orf1ab"
/ribosomal_slippage
/codon_start=1
/product="ORF1ab protein"
/protein_id="AKK52610.1"
/db_xref="GI:828436886"
/translation="MSFVAGVIAQGARGTYRAALNSEKHQDHVSLTVPLCGSGNLVEK
LSPWFMDGENAYEVVKAMLLKKEPLLYVPIRLAGHTRHLPGPRVYLVERLIACENPFM
VNQLAYSSSANGSLVGTTLQGKPIGMFFPYDIELVTGKQNILLRKYGRGGYHYTPVHY
ERDNTSCPEWMDDFEADPKGKYAQNLLKKLIGGDVTPVDQYMCGVDGKPISAYAFLMA
KDGITKLADVEADVAARADDEGFITLKNNLYRLVWHVERKDVPYPKQSIFTINSVVQK
DGVENTPPHYFTLGCKILTLTPRNKWSGVSDLSLKQKLLYTFYGKESLENPTYIYHSA
FIECGSCGNDSWLTGNAIQGFACGCGASYTANDVEVQSSGMIKPNALLCATCPFAKGD
SCSSNCKHSVAQLVSYLSERCNVIADSKSFTLIFGGVAYAYFGCEEGTMYFVPRAKSV
VSRIGDSIFTGCTGSWNKVTQIANMFLEQTQHSLNFVGEFVVNDVVLAILSGTTTNVD
KIRQLLKGVTIDKLRDYLADYDVAVTAGPFMDNAINVGGTGLQYAAITAPYVVLTGLG
ESFKKVATIPYKVCNSVKDTLTYYAHSVLYRVFPYDMDSGVSSFSELLFDCVDLSVAS
TYFLVRLLQDKTGDFMSTIITSCQTAVSKLLDTCFEATEATFNFLLDLAGLFRIFLRN
AYVYTSQGFVVVNGKVSTLVKQVLDLLNKGMQLLHTKVSWAGSNISAVIYSGRESLIF
PSGTYYCVTTKAKSVQQDLDVMLPGEFSKKQLGLLQPTDNSTTVSVTVSSNMVETVVG
QLEQTNMHSPDVIVGDYVIISEKLFVRSKEEDGFAFYPACTNGHAVPTLFRLKGGAPV
KKVAFGGDQVHEVAAVRSVTVEYNIHAVLDTLLASSSLRTFVVDKSLSIEEFADVVKE
QVSDLLVKLLRGMPIPDFDLDDFIDAPCYCFNAEGDASWSSTMIFSLHPVECDEECSE
VEASDLEEGESECISETSTEQVDVSHEVSDDEWAAAVDEAFPLDEAEDVTESVQEEAQ
PVEVPVEDIAQVVIADTLQETPVVSDTVEVPPQVVKLPSEPQTIQPEVKEVAPVYEAD
TEQTQSVTVKPKRLRKKRNVDPLSNFEHKVITECVTIVLGDAIQVAKCYGESVLVNAA
NTHLKHGGGIAGAINAASKGAVQKESDEYILAKGPLQVGDSVLLQGHSLAKNILHVVG
PDARAKQDVSLLSKCYKAMNAYPLVVTPLVSTGIFGVKPAVSFDYLIREAKTRVLVVV
NSQDVYKSLTIVDIPQSLTFSYDGLRGAIRKAKDYGFTVFVCTDNSANTKVLRNKGVD
YTKKFLTVDGVQYYCYTSKDTLDDILQQANKSVGIISMPLGYVSHGLDLIQAGSVVRR
VNVPYVCLLANKEQEAILMSEDVKLNPSEDFIKHVRTNGGYNSWHLVEGELLVQDLRL
NKLLHWSDQTICYKDSVFYVVKNSTAFPFETLSACRAYLDSRTTQQLTIEVLVTVDGV
NFRTVVLNNKNTYRSQLGCVFFNGADISDTIPDEKQNGHSLYLADNLTADETKALKEL
YGPVDPTFLHRFYSLKAAVHKWKMVVCDKVRSLKLSDNNCYLNAVIMTLDLLKDIKFV
IPALQHAFMKHKGGDSIDFIALIMAYGNCTFGAPDDASRLLHTVLAKAELCCSARMVW
REWCNVCGIKDVVLQGLKACCYVGVQTVEDLRARMTYVCQCGGERHRQIVEHTTPWLL
LSGTPNEKLVTTSTAPDFVAFNVFQGIETAVGHYVHARLKGGLILKFDSGTVSKTSDW
KCKVTDVLFPGQKYSSDCNVVRYSLDGNFRTEVDPDLSAFYVKDGKYFTSEPPVTYSP
ATILAGSVYTNSCLVSSDGQPGGDAISLSFNNLLGFDSSKPVTKKYTYSFLPKEDGDV
LLAEFDTYDPIYKNGAMYKGKPILWVNKASYDTNLNKFNRASLRQIFDVAPIELENKF
TPLSVASTPVEPPTVDVVALQQEMTIVKCKGLNKPFVKDNVSFVVDDSGTPVVEYLSK
EDLHTLYVDPKYQVIVLKDNVLSSMLRLHTVESGDINVVAASGSLTRKVKLLFRASFY
FKEFATRTFTATTAVGSCIKSVVRHLGVTKGILTGCFSFVKMLFILPLAYFSDSKLGT
TEVKVSALKTAGVVTGNVVKQCCTAAVDLSMDKLRRVDWKSTLRLLLMLCTTMVLLSS
VYHLYVFNQVLSSDVMFEDAQGLKKFYKEVRAYLGISSACDGLASAYRANSFDVPTFC
ANRSAMCNWCLISQDSITHYPALKMVQTHLSHYVLNIDWLWFAFETGLAYMLYTSAFN
WLLLAGTLHYFFAQTSIFVDWRSYNYAVSSAFWLFTHIPMAGLVRMYNLLACLWLLRK
FYQHVINGCKDTACLLCYKRNRLTRVEASTVVCGGKRTFYITANGGISFCRRHNWNCV
DCDIAGVGNTFICEEVANDLTTALRRPINATDRSHYYVDSVTVKETVVQFNYRRDGQP
FYERFPLCAFTNLDKLKFKEVCKTTTGIPEYNFIIYDSSDRGQESLARSACVYYSQVL
CKSILLVDSSLVTSVGDSSEIATKMFDSFVNSFVSLYNVTRDKLEKLISTARDGVRRG
DNFHSVLTTFIDAARGPAGVESDVETNEIVDSVQYAHKHDIQITNESYNNYVPSYVKP
DSVSTSDLGSLIDCNAASVNQIVLRNSNGACIWNAAAYMKLSDALKRQIRIACRKCNL
AFRLTTSKLRANDNILSVRFTANKIVGGAPTWFNVLRDFTLKGYVLATIIVFLCAVLM
YLCLPTFSMVPVEFYEDRILDFKVLDNGIIRDVNPDDKCFANKHRSFTQWYHEHVGGV
YDNSITCPLTVAVIAGVAGARIPDVPTTLAWVNNQIIFFVSRVFANTGSVCYTPIDEI
PYKSFSDSGCILPSECTMFRDAEGRMTPYCHDPTVLPGAFAYSQMRPHVRYDLYDGNM
FIKFPEVVFESTLRITRTLSTQYCRFGSCEYAQEGVCITTNGSWAIFNDHHLNRPGVY
CGSDFIDIVRRLAVSLFQPITYFQLTTSLVLGIGLCAFLTLLFYYINKVKRAFADYTQ
CAVIAVVAAVLNSLCICFVASIPLCIVPYTALYYYATFYFTNEPAFIMHVSWYIMFGP
IVPIWMTCVYTVAMCFRHFFWVLAYFSKKHVEVFTDGKLNCSFQDAASNIFVINKDTY
AALRNSLTNDAYSRFLGLFNKYKYFSGAMETAAYREAAACHLAKALQTYSETGSDLLY
QPPNCSITSGVLQSGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCP
ADQLSDPNYDALLISMTNHSFSVQKHIGAPANLRVVGHAMQGTLLKLTVDVANPSTPA
YTFTTVKPGAAFSVLACYNGRPTGTFTVVMRPNYTIKGSFLCGSCGSVGYTKEGSVIN
FCYMHQMELANGTHTGSAFDGTMYGAFMDKQVHQVQLTDKYCSVNVVAWLYAAILNGC
AWFVKPNRTSVVSFNEWALANQFTEFVGTQSVDMLAVKTGVAIEQLLYAIQQLYTGFQ
GKQILGSTMLEDEFTPEDVNMQIMGVVMQSGVRKVTYGTAHWLFATLVSTYVIILQAT
KFTLWNYLFETIPTQLFPLLFVTMAFVMLLVKHKHTFLTLFLLPVAICLTYANIVYEP
TTPISSALIAVANWLAPTNAYMRTTHTDIGVYISMSLVLVIVVKRLYNPSLSNFALAL
CSGVMWLYTYSIGEASSPIAYLVFVTTLTSDYTITVFVTVNLAKVCTYAIFAYSPQLT
LVFPEVKMILLLYTCLGFMCTCYFGVFSLLNLKLRAPMGVYDFKVSTQEFRFMTANNL
TAPRNSWEAMALNFKLIGIGGTPCIKVAAMQSKLTDLKCTSVVLLSVLQQLHLEANSR
AWAFCVKCHNDILAATDPSEAFEKFVSLFATLMTFSGNVDLDALASDIFDTPSVLQAT
LSEFSHLATFAELEAAQKAYQEAMDSGDTSPQVLKALQKAVNIAKNAYEKDKAVARKL
ERMADQAMTSMYKQARAEDKKAKIVSAMQTMLFGMIKKLDNDVLNGIISNARNGCIPL
SVIPLCASNKLRVVIPDFTVWNQVVTYPSLNYAGALWDITVINNVDNEIVKSSDVVDS
NENLTWPLVLECTRASTSAVKLQNNEIKPSGLKTMVVSAGQEQTNCNTSSLAYYEPVQ
GRKMLMALLSDNAYLKWARVEGKDGFVSVELQPPCKFLIAGPKGPEIRYLYFVKNLNN
LHRGQVLGHIAATVRLQAGSNTEFASNSSVLSLVNFTVDPQKAYLDFVNAGGAPLTNC
VKMLTPKTGTGIAISVKPESTADQETYGGASVCLYCRAHIEHPDVSGVCKYKGKFVQI
PAQCVRDPVGFCLSNTPCNVCQYWIGYGCNCDSLRQVALPQSKDSNFLNRVRGSIVNA
RIEPCSSGLSTDVVFRAFDICNYKAKVAGIGKYYKTNTCRFVELDDQGHHLDSYFVVK
RHTMENYELEKHCYDLLRDCDAVAPHDFFIFDVDKVKTPHIVRQRLTEYTMMDLVYAL
RHFDQNSEVLKAILVKYGCCDVTYFENKLWFDFVENPSVIGVYHKLGERVRQAILNTV
KFCDHMVKAGLVGVLTLDNQDLNGKWYDFGDFVITQPGSGVAIVDSYYSYLMPVLSMT
DCLAAETHRDCDFNKPLIEWPLTEYDFTDYKVQLFEKYFKYWDQTYHANCVNCTDDRC
VLHCANFNVLFAMTMPKTCFGPIVRKIFVDGVPFVVSCGYHYKELGLVMNMDVSLHRH
RLSLKELMMYAADPAMHIASSNAFLDLRTSCFSVAALTTGLTFQTVRPGNFNQDFYDF
VVSKGFFKEGSSVTLKHFFFAQDGNAAITDYNYYSYNLPTMCDIKQMLFCMEVVNKYF
EIYDGGCLNASEVVVNNLDKSAGHPFNKFGKARVYYESMSYQEQDELFAMTKRNVIPT
MTQMNLKYAISAKNRARTVAGVSILSTMTNRQYHQKMLKSMAATRGATCVIGTTKFYG
GWDFMLKTLYKDVDNPHLMGWDYPKCDRAMPNMCRIFASLILARKHGTCCTTRDRFYR
LANECAQVLSEYVLCGGGYYVKPGGTSSGDATTAYANSVFNILQATTANVSALMGANG
NKIVDKEVKDMQFDLYVNVYRSTSPDPKFVDKYYAFLNKHFSMMILSDDGVVCYNSDY
AAKGYIAGIQNFKETLYYQNNVFMSEAKCWVETDLKKGPHEFCSQHTLYIKDGDDGYF
LPYPDPSRILSAGCFVDDIVKTDGTLMVERFVSLAIDAYPLTKHEDIEYQNVFWVYLQ
YIEKLYKDLTGHMLDSYSVMLCGDNSAKFWEEAFYRDLYSSPTTLQAVGSCVVCHSQT
SLRCGTCIRRPFLCCKCCYDHVIATPHKMVLSVSPYVCNAPGCGVSDVTKLYLGGMSY
FCVDHRPVCSFPLCANGLVFGLYKNMCTGSPSIVEFNRLATCDWTESGDYTLANTTTE
PLKLFAAETLRATEEASKQSYAIATIKEIVGERQLLLVWEAGKSKPPLNRNYVFTGYH
ITKNSKVQLGEYIFERIDYSDAVSYKSSTTYKLTVGDIFVLTSHSVATLTAPTIVNQE
RYVKITGLYPTITVPEEFASHVANFQKSGYSKYVTVQGPPGTGKSHFAIGLAIYYPTA
RVVYTACSHAAVDALCEKAFKYLNIAKCSRIIPAKARVECYDRFKVNETNSQYLFSTI
NALPETSADILVVDEVSMCTNYDLSIINARIKAKHIVYVGDPAQLPAPRTLLTRGTLE
PENFNSVTRLMCNLGPDIFLSMCYRCPKEIVSTVSALVYNNKLLAKKELSGQCFKILY
KGNVTHDASSAINRPQLTFVKNFITANPAWSKAVFISPYNSQNAVARSMLGLTTQTVD
SSQGSEYQYVIFCQTADTAHANNINRFNVAITRAQKGILCVMTSQALFESLEFTELSF
TNYKLQSQIVTGLFKDCSRETSGLSPAYAPTYVSVDDKYKTSDELCVNLNLPANIPYS
RVISRMGFKLDATVPGYPKLFITREEAVRQVRSWIGFDVEGAHASRNACGTNVPLQLG
FSTGVNFVVQPVGVVDTEWGNMLTGIAARPPPGEQFKHLVPLMHKGAAWPIVRRRIVQ
MLSDTLDKLSDYCTFVCWAHGFELTSASYFCKIGKEQKCCMCNRRAAAYSSPLQSYAC
WTHSCGYDYVYNPFFVDVQQWGYVGNLATNHDRYCSVHQGAHVASNDAIMTRCLAIHS
CFIERVDWDIEYPYISHEKKLNSCCRIVERNVVRAALLAGSFDKVYDIGNPKGIPIVD
DPVVDWHYFDAQPLTRKVQQLFYTEDMASRFADGLCLFWNCNVPKYPNNAIVCRFDTR
VHSEFNLPGCDGGSLYVNKHAFHTPAYDVSAFRDLKPLPFFYYSTTPCEVHGNGSMIE
DIDYVPLKSAVCITACNLGGAVCRKHATEYREYMEAYNLVSASGFRLWCYKTFDIYNL
WSTFTKVQGLENIAFNVVKQGHFIGVEGELPVAVVNDKIFTKSGVNDICMFENKTTLP
TNIAFELYAKRAVRSHPDFKLLHNLQADICYKFVLWDYERSNIYGTATIGVCKYTDID
VNSALNICFDIRDNGSLEKFMSTPNAIFISDRKIKKYPCIVGPDYAYFNGAIIRDSDV
VKQPVKFYLYKKVNNEFIDPTECIYTQSRSCSDFLPLSDMEKDFLSFDSDVFIKKYGL
ENYAFEHVVYGDFSHTTLGGLHLLIGLYKKQQEGHIIMEEMLKGSSTIHNYFITETNT
AAFKAVCSVIDLKLDDFVMILKSQDLGVVSKVVKVPIDLTMIEFMLWCKDGQVQTFYP
RLQASADWKPGHAMPSLFKVQNVNLERCELANYKQSIPMPRGVHMNIAKYMQLCQYLN
TCTLAVPANMRVIHFGAGSDKGIAPGTSVLRQWLPTDAIIIDNDLNEFVSDADITLFG
DCVTVRVGQQVDLVISDMYDPTTKNVTGSNESKALFFTYLCNLINNNLALGGSVAIKI
TEHSWSVELYELMGKFAWWTVFCTNANASSSEGFLLGINYLGTIKENIDGGAMHANYI
FWRNSTPMNLSTYSLFDLSKFQLKLKGTPVLQLKESQINELVISLLSQGKLLIRDNDT
LSVSTDVLVNTYRKLR"
CDS 270..13445
/gene="orf1ab"
/codon_start=1
/product="ORF1a protein"
/protein_id="AKK52601.1"
/db_xref="GI:828436877"
/translation="MSFVAGVIAQGARGTYRAALNSEKHQDHVSLTVPLCGSGNLVEK
LSPWFMDGENAYEVVKAMLLKKEPLLYVPIRLAGHTRHLPGPRVYLVERLIACENPFM
VNQLAYSSSANGSLVGTTLQGKPIGMFFPYDIELVTGKQNILLRKYGRGGYHYTPVHY
ERDNTSCPEWMDDFEADPKGKYAQNLLKKLIGGDVTPVDQYMCGVDGKPISAYAFLMA
KDGITKLADVEADVAARADDEGFITLKNNLYRLVWHVERKDVPYPKQSIFTINSVVQK
DGVENTPPHYFTLGCKILTLTPRNKWSGVSDLSLKQKLLYTFYGKESLENPTYIYHSA
FIECGSCGNDSWLTGNAIQGFACGCGASYTANDVEVQSSGMIKPNALLCATCPFAKGD
SCSSNCKHSVAQLVSYLSERCNVIADSKSFTLIFGGVAYAYFGCEEGTMYFVPRAKSV
VSRIGDSIFTGCTGSWNKVTQIANMFLEQTQHSLNFVGEFVVNDVVLAILSGTTTNVD
KIRQLLKGVTIDKLRDYLADYDVAVTAGPFMDNAINVGGTGLQYAAITAPYVVLTGLG
ESFKKVATIPYKVCNSVKDTLTYYAHSVLYRVFPYDMDSGVSSFSELLFDCVDLSVAS
TYFLVRLLQDKTGDFMSTIITSCQTAVSKLLDTCFEATEATFNFLLDLAGLFRIFLRN
AYVYTSQGFVVVNGKVSTLVKQVLDLLNKGMQLLHTKVSWAGSNISAVIYSGRESLIF
PSGTYYCVTTKAKSVQQDLDVMLPGEFSKKQLGLLQPTDNSTTVSVTVSSNMVETVVG
QLEQTNMHSPDVIVGDYVIISEKLFVRSKEEDGFAFYPACTNGHAVPTLFRLKGGAPV
KKVAFGGDQVHEVAAVRSVTVEYNIHAVLDTLLASSSLRTFVVDKSLSIEEFADVVKE
QVSDLLVKLLRGMPIPDFDLDDFIDAPCYCFNAEGDASWSSTMIFSLHPVECDEECSE
VEASDLEEGESECISETSTEQVDVSHEVSDDEWAAAVDEAFPLDEAEDVTESVQEEAQ
PVEVPVEDIAQVVIADTLQETPVVSDTVEVPPQVVKLPSEPQTIQPEVKEVAPVYEAD
TEQTQSVTVKPKRLRKKRNVDPLSNFEHKVITECVTIVLGDAIQVAKCYGESVLVNAA
NTHLKHGGGIAGAINAASKGAVQKESDEYILAKGPLQVGDSVLLQGHSLAKNILHVVG
PDARAKQDVSLLSKCYKAMNAYPLVVTPLVSTGIFGVKPAVSFDYLIREAKTRVLVVV
NSQDVYKSLTIVDIPQSLTFSYDGLRGAIRKAKDYGFTVFVCTDNSANTKVLRNKGVD
YTKKFLTVDGVQYYCYTSKDTLDDILQQANKSVGIISMPLGYVSHGLDLIQAGSVVRR
VNVPYVCLLANKEQEAILMSEDVKLNPSEDFIKHVRTNGGYNSWHLVEGELLVQDLRL
NKLLHWSDQTICYKDSVFYVVKNSTAFPFETLSACRAYLDSRTTQQLTIEVLVTVDGV
NFRTVVLNNKNTYRSQLGCVFFNGADISDTIPDEKQNGHSLYLADNLTADETKALKEL
YGPVDPTFLHRFYSLKAAVHKWKMVVCDKVRSLKLSDNNCYLNAVIMTLDLLKDIKFV
IPALQHAFMKHKGGDSIDFIALIMAYGNCTFGAPDDASRLLHTVLAKAELCCSARMVW
REWCNVCGIKDVVLQGLKACCYVGVQTVEDLRARMTYVCQCGGERHRQIVEHTTPWLL
LSGTPNEKLVTTSTAPDFVAFNVFQGIETAVGHYVHARLKGGLILKFDSGTVSKTSDW
KCKVTDVLFPGQKYSSDCNVVRYSLDGNFRTEVDPDLSAFYVKDGKYFTSEPPVTYSP
ATILAGSVYTNSCLVSSDGQPGGDAISLSFNNLLGFDSSKPVTKKYTYSFLPKEDGDV
LLAEFDTYDPIYKNGAMYKGKPILWVNKASYDTNLNKFNRASLRQIFDVAPIELENKF
TPLSVASTPVEPPTVDVVALQQEMTIVKCKGLNKPFVKDNVSFVVDDSGTPVVEYLSK
EDLHTLYVDPKYQVIVLKDNVLSSMLRLHTVESGDINVVAASGSLTRKVKLLFRASFY
FKEFATRTFTATTAVGSCIKSVVRHLGVTKGILTGCFSFVKMLFILPLAYFSDSKLGT
TEVKVSALKTAGVVTGNVVKQCCTAAVDLSMDKLRRVDWKSTLRLLLMLCTTMVLLSS
VYHLYVFNQVLSSDVMFEDAQGLKKFYKEVRAYLGISSACDGLASAYRANSFDVPTFC
ANRSAMCNWCLISQDSITHYPALKMVQTHLSHYVLNIDWLWFAFETGLAYMLYTSAFN
WLLLAGTLHYFFAQTSIFVDWRSYNYAVSSAFWLFTHIPMAGLVRMYNLLACLWLLRK
FYQHVINGCKDTACLLCYKRNRLTRVEASTVVCGGKRTFYITANGGISFCRRHNWNCV
DCDIAGVGNTFICEEVANDLTTALRRPINATDRSHYYVDSVTVKETVVQFNYRRDGQP
FYERFPLCAFTNLDKLKFKEVCKTTTGIPEYNFIIYDSSDRGQESLARSACVYYSQVL
CKSILLVDSSLVTSVGDSSEIATKMFDSFVNSFVSLYNVTRDKLEKLISTARDGVRRG
DNFHSVLTTFIDAARGPAGVESDVETNEIVDSVQYAHKHDIQITNESYNNYVPSYVKP
DSVSTSDLGSLIDCNAASVNQIVLRNSNGACIWNAAAYMKLSDALKRQIRIACRKCNL
AFRLTTSKLRANDNILSVRFTANKIVGGAPTWFNVLRDFTLKGYVLATIIVFLCAVLM
YLCLPTFSMVPVEFYEDRILDFKVLDNGIIRDVNPDDKCFANKHRSFTQWYHEHVGGV
YDNSITCPLTVAVIAGVAGARIPDVPTTLAWVNNQIIFFVSRVFANTGSVCYTPIDEI
PYKSFSDSGCILPSECTMFRDAEGRMTPYCHDPTVLPGAFAYSQMRPHVRYDLYDGNM
FIKFPEVVFESTLRITRTLSTQYCRFGSCEYAQEGVCITTNGSWAIFNDHHLNRPGVY
CGSDFIDIVRRLAVSLFQPITYFQLTTSLVLGIGLCAFLTLLFYYINKVKRAFADYTQ
CAVIAVVAAVLNSLCICFVASIPLCIVPYTALYYYATFYFTNEPAFIMHVSWYIMFGP
IVPIWMTCVYTVAMCFRHFFWVLAYFSKKHVEVFTDGKLNCSFQDAASNIFVINKDTY
AALRNSLTNDAYSRFLGLFNKYKYFSGAMETAAYREAAACHLAKALQTYSETGSDLLY
QPPNCSITSGVLQSGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCP
ADQLSDPNYDALLISMTNHSFSVQKHIGAPANLRVVGHAMQGTLLKLTVDVANPSTPA
YTFTTVKPGAAFSVLACYNGRPTGTFTVVMRPNYTIKGSFLCGSCGSVGYTKEGSVIN
FCYMHQMELANGTHTGSAFDGTMYGAFMDKQVHQVQLTDKYCSVNVVAWLYAAILNGC
AWFVKPNRTSVVSFNEWALANQFTEFVGTQSVDMLAVKTGVAIEQLLYAIQQLYTGFQ
GKQILGSTMLEDEFTPEDVNMQIMGVVMQSGVRKVTYGTAHWLFATLVSTYVIILQAT
KFTLWNYLFETIPTQLFPLLFVTMAFVMLLVKHKHTFLTLFLLPVAICLTYANIVYEP
TTPISSALIAVANWLAPTNAYMRTTHTDIGVYISMSLVLVIVVKRLYNPSLSNFALAL
CSGVMWLYTYSIGEASSPIAYLVFVTTLTSDYTITVFVTVNLAKVCTYAIFAYSPQLT
LVFPEVKMILLLYTCLGFMCTCYFGVFSLLNLKLRAPMGVYDFKVSTQEFRFMTANNL
TAPRNSWEAMALNFKLIGIGGTPCIKVAAMQSKLTDLKCTSVVLLSVLQQLHLEANSR
AWAFCVKCHNDILAATDPSEAFEKFVSLFATLMTFSGNVDLDALASDIFDTPSVLQAT
LSEFSHLATFAELEAAQKAYQEAMDSGDTSPQVLKALQKAVNIAKNAYEKDKAVARKL
ERMADQAMTSMYKQARAEDKKAKIVSAMQTMLFGMIKKLDNDVLNGIISNARNGCIPL
SVIPLCASNKLRVVIPDFTVWNQVVTYPSLNYAGALWDITVINNVDNEIVKSSDVVDS
NENLTWPLVLECTRASTSAVKLQNNEIKPSGLKTMVVSAGQEQTNCNTSSLAYYEPVQ
GRKMLMALLSDNAYLKWARVEGKDGFVSVELQPPCKFLIAGPKGPEIRYLYFVKNLNN
LHRGQVLGHIAATVRLQAGSNTEFASNSSVLSLVNFTVDPQKAYLDFVNAGGAPLTNC
VKMLTPKTGTGIAISVKPESTADQETYGGASVCLYCRAHIEHPDVSGVCKYKGKFVQI
PAQCVRDPVGFCLSNTPCNVCQYWIGYGCNCDSLRQVALPQSKDSNFLNESGVLL"
gene 21447..25508
/gene="S"
CDS 21447..25508
/gene="S"
/codon_start=1
/product="S protein"
/protein_id="AKK52602.1"
/db_xref="GI:828436878"
/translation="MIHSVFLLMFLLTPTESYVDVGPDSVKSACIEVDIQQTFFDKTW
PRPIDVSKADGIIYPQGRTYSNITITYQGLFPYQGDHGDMYVYSAGHATGTTPQKLFV
ANYSQDVKQFANGFVVRIGAAANSTGTVIISPSTSATIRKIYPAFMLGSSVGNFSDGK
MGRFFNHTLVLLPDGCGTLLRAFYCILEPRSGNHCPAGNSYTSFATYHTPATDCSDGN
YNRNASLNSFKEYFNLRNCTFMYTYNITEDEILEWFGITQTAQGVHLFSSRYVDLYGG
NMFQFATLPVYDTIKYYSIIPHSIRSIQSDRKAWAAFYVYKLQPLTFLLDFSVDGYIR
RAIDCGFNDLSQLHCSYESFDVESGVYSVSSFEAKPSGSVVEQAEGVECDFSPLLSGT
PPQVYNFKRLVFTNCNYNLTKLLSLFSVNDFTCSQISPAAIASNCYSSLILDYFSYPL
SMKSDLSVSSAGPISQFNYKQSFSNPTCLILATVPHNLTTITKPLKYSYINKCSRLLS
DDRTEVPQLVNANQYSPCVSIVPSTVWEDGDYYRKQLSPLEGGGWLVASGSTVAMTEQ
LQMGFGITVQYGTDTNSVCPKLEFANDTKIASQLGNCVEYSLYGVSGRGVFQNCTAVG
VRQQRFVYDAYQNLVGYYSDDGNYYCLRACVSVPVSVIYDKETKTHATLFGSVACEHI
SSTMSQYSRSTRSMLKRRDSTYGPLQTPVGCVLGLVNSSLFVEDCKLPLGQSLCALPD
TPSTLTPRSVRSVPGEMRLASIAFNHPIQVDQLNSSYFKLSIPTNFSFGVTQEYIQTT
IQKVTVDCKQYVCNGFQKCEQLLREYGQFCSKINQALHGANLRQDDSVRNLFASVKSS
QSSPIIPGFGGDFNLTLLEPVSISTGSRSARSAIEDLLFDKVTIADPGYMQGYDDCMQ
QGPASARDLICAQYVAGYKVLPPLMDVNMEAAYTSSLLGSIAGVGWTAGLSSFAAIPF
AQSIFYRLNGVGITQQVLSENQKLIANKFNQALGAMQTGFTTTNEAFRKVQDAVNNNA
QALSKLASELSNTFGAISASIGDIIQRLDVLEQDAQIDRLINGRLTTLNAFVAQQLVR
SESAALSAQLAKDKVNECVKAQSKRSGFCGQGTHIVSFVVNAPNGLYFMHVGYYPSNH
IEVVSAYGLCDAANPTNCIAPVNGYFIKTNNTRIVDEWSYTGSSFYAPEPITSLNTKY
VAPQVTYQNISTNLPPPLLGNSTGIDFQDELDEFFKNVSTSIPNFGSLTQINTTLLDL
TYEMLSLQQVVKALNESYIDLKELGNYTYYNKWPWYIWLGFIAGLVALALCVFFILCC
TGCGTNCMGKLKCNRCCDRYEEYDLEPHKVHVH"
gene 25523..25834
/gene="ns3a"
CDS 25523..25834
/gene="ns3a"
/codon_start=1
/product="NS3a protein"
/protein_id="AKK52603.1"
/db_xref="GI:828436879"
/translation="MRVQRPPTLLLVFSLSFLVTAFSKPLYVPEHCQNYSGCMLRACI
KTAQADTAGLYTNFRIDVPSAESTGTQSVSVDRESTSTHDGLTEHVTSVNLFDVGYSV
N"
gene 25843..26172
/gene="ns3b"
CDS 25843..26172
/gene="ns3b"
/codon_start=1
/product="NS3b protein"
/protein_id="AKK52604.1"
/db_xref="GI:828436880"
/translation="MDYVSLLNQIWQKYLNSPYTTCLYIPKPTAKYTPLVGTSLHPVL
WNCQLSFAGYTESAVNSTKALAKQDAAQRIAWLLHKDGGIPDGCSLYLRHSSLFAQSE
EDESFSN"
gene 26084..26818
/gene="ns3c"
CDS 26084..26818
/gene="ns3c"
/codon_start=1
/product="NS3c protein"
/protein_id="AKK52605.1"
/db_xref="GI:828436881"
/translation="MEESLTDVPSTSGTQVYSRKARKMSHSPTKKLRYVKRRFSLLRP
EDLSVIVQPTHYVRVTFSDPNMWYLRSGHHLHSVHNWLKPYGGQPVSEYHITLALLNL
TDEDLARDFSPIALFLRNVRFELHEFALLRKTLVLNASEIYCANIHRFKPVYRVNTAI
PTIKDWLLVQGFSLYHSGLPLHMSISKLHALDDVTRNYIITMPCFRTYPQQMFVTPLA
VDVVSIRSSNQGNKQIVHSYPILHHP"
gene 26831..27505
/gene="ns3d"
CDS 26831..27505
/gene="ns3d"
/codon_start=1
/product="NS3d protein"
/protein_id="AKK52606.1"
/db_xref="GI:828436882"
/translation="MAFSASLFKPVQLVPVSPAFHRIESTDSIVFTYIPASGYVAALA
VNVCLIPLLLLLRQDTCRRSIIRTMVLYFLVLYNFLLAIVLVNGVHYPTGSCLIAFLV
ILIILWFVDRIRFCLMLNSYIPLFDMRSHFIRVSTVSSHGMVPVIHTKPLFIRNFDQR
CSCSRCFYLHSSTYIECTYISRFSKISLVSVTDFSLNGNVSTVFVPATRDSVPLHIIA
PSSLIV"
gene 27581..27829
/gene="E"
CDS 27581..27829
/gene="E"
/codon_start=1
/product="E protein"
/protein_id="AKK52607.1"
/db_xref="GI:828436883"
/translation="MLPFVQERIGLFIVNFFIFTVVCAITLLVCMAFLTATRLCVQCM
TGFNTLLVQPALYLYNTGRSVYVKFQDSKPPLPPDEWV"
gene 27844..28503
/gene="M"
CDS 27844..28503
/gene="M"
/codon_start=1
/product="M protein"
/protein_id="AKK52608.1"
/db_xref="GI:828436884"
/translation="MSNMTQLTEAQIIAIIKDWNFAWSLIFLLITIVLQYGYPSRSMT
VYVFKMFVLWLLWPSSMALSIFSAIYPIDLASQIISGIVAAVSAMMWISYFVQSIRLF
MRTGSWWSFNPETNCLLNVPIGGTTVVRPLVEDSTSVTAVVTNGHLKMAGMHFGACDY
DRLPNEVTVAKPNVLIALKMVKRQSYGTNSGVAIYHRYKAGNYRSPPITADIELALLR
A"
gene 28557..29798
/gene="N"
CDS 28557..29798
/gene="N"
/codon_start=1
/product="N protein"
/protein_id="AKK52609.1"
/db_xref="GI:828436885"
/translation="MASPAAPRAVSFADNNDITNTNLSRGRGRNPKPRAAPNNTVSWY
TGLTQHGKVPLTFPPGQGVPLNANSTPAQNAGYWRRQDRKINTGNGIKQLAPRWYFYY
TGTGPEAALPFRAVKDGIVWVHEDGATDAPSTFGTRNPNNDSAIVTQFAPGTKLPKNF
HIEGTGGNSQSSSRASSVSRNSSRSSSQGSRSGNSTRGTSPGPSGIGAVGGDLLYLDL
LNRLQALESGKVKQSQPKVITKKDAAAAKNKMRHKRTSTKSFNMVQAFGLRGPGDLQG
NFGDLQLNKLGTEDPRWPQIAELAPTASAFMGMSQFKLTHQNNDDHGNPVYFLRYSGA
IKLDPKNPNYNKWLELLEQNIDAYKTFPKKEKKQKAPKEESTDQMSEPPKEQRVQGSI
TQRTRTRPSVQPGPMIDVNTD"

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Tue Jun 09, 2015 10:12 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
1 gatttaagtg aatagcttgg ctatctcact tcccctcgtt ctcttgcaga actttgattt
61 taacgaactt aaataaaagc cctgttgttt agcgtattgt tgcacttgtc tggtgggatt
121 atttgcctgc tcatctaggc agtggacata tgctcaacac tgggtataat tctaattgaa
181 tactattttt cagttagagc gtcgtgtctc ttgtacgtct cggtcacaat atacggtttc
241 gtccggtgcg tggcaattcg gggcacatca tgtctttcgt ggctggtgtg atcgcgcaag
301 gtgcgcgcgg tacgtatcga gcagcgctca actctgaaaa acatcaagac catgtgtctc
361 taactgtgcc actctgtggt tcaggaaacc tggttgaaaa actttcacca tggttcatgg
421 atggcgaaaa tgcctatgaa gtggtgaagg ccatgttact taaaaaagag ccacttctct
481 atgtgcccat ccggctggct ggacacacta gacacctccc aggtcctcgt gtgtacctgg
541 ttgagaggct cattgcttgt gaaaatccat tcatggttaa ccaattggct tatagctcta
601 gtgcaaatgg cagccttgtt ggcacaactt tgcagggcaa gcctattggt atgttcttcc
661 cttatgacat cgaacttgtc acaggaaagc aaaatattct cctgcgcaag tatggccgtg
721 gtggttatca ctacacccca gtccactatg agcgagacaa cacctcttgc cctgagtgga
781 tggacgattt tgaggcggat cctaaaggca aatatgccca gaatctgctt aagaagttga
841 ttggcggtga tgtcactcca gttgaccaat acatgtgtgg cgttgatgga aaacccatta
901 gtgcctacgc atttttaatg gccaaggatg gaataaccaa actggctgat gttgaagcgg
961 acgtcgcagc acgtgctgat gacgaaggct tcatcacatt aaagaacaat ctatatagat
1021 tggtttggca tgttgagcgt aaagacgttc catatcctaa gcaatctatt tttactatta
1081 atagtgtggt ccaaaaggat ggtgttgaaa acactcctcc tcactatttt actcttggat
1141 gcaaaatttt aacgctcacc ccacgcaaca agtggagtgg cgtttctgac ttgtccctca
1201 aacaaaaact cctttacacc ttctatggta aggagtcact tgagaaccca acctacattt
1261 accactccgc attcattgag tgtggaagtt gtggtaatga ttcctggctt acagggaatg
1321 ctatccaagg gtttgcctgt ggatgtgggg catcatatac agctaatgat gtcgaagtcc
1381 aatcatctgg catgattaag ccaaatgctc ttctttgtgc tacttgcccc tttgctaagg
1441 gtgacagctg ttcttctaat tgcaaacatt cagttgctca gttggttagt tacctttctg
1501 aacgctgtaa tgttattgct gattctaagt ccttcacact tatctttggt ggcgtagctt
1561 acgcctactt tggatgtgag gaaggtacta tgtactttgt gcctagagct aagtctgttg
1621 tctcaaggat tggagactcc atctttacag gctgtactgg ctcttggaac aaggtcactc
1681 aaattgctaa catgttcttg gaacagactc agcattccct taactttgtg ggagagttcg
1741 ttgtcaacga tgttgtcctc gcaattctct ctggaaccac aactaatgtt gacaaaatac
1801 gccagcttct caaaggtgtc accattgaca agttgcgtga ttatttagct gactatgacg
1861 tagcagtcac tgccggccca ttcatggata atgctattaa tgttggtggt acaggattac
1921 agtatgccgc cattactgca ccttatgtag ttctcactgg cttaggtgag tcctttaaga
1981 aagttgcaac cataccgtac aaggtttgca actctgttaa ggatactctg acctattatg
2041 ctcacagcgt gttgtacaga gtttttcctt atgacatgga ttctggtgtg tcatccttta
2101 gtgaactact ttttgattgc gttgatcttt cagtagcttc tacctatttt ttagtccgcc
2161 tcttgcaaga taagactggc gactttatgt ctacaattat tacttcctgc caaactgctg
2221 ttagtaagct tctagataca tgttttgaag ctacagaagc aacatttaat ttcttgttag
2281 atttggcagg attgttcaga atctttcttc gcaatgccta tgtgtacact tcacaagggt
2341 ttgtggtggt caatggcaaa gtttctacac ttgtcaaaca agtgttagac ttgcttaata
2401 agggtatgca acttttgcat acaaaggtct cctgggctgg ttctaatatc agtgctgtta
2461 tctacagcgg cagggagtct ctaatattcc catcgggaac ctattactgt gtcaccacta
2521 aggctaagtc cgttcaacaa gatcttgacg ttatgttgcc tggtgagttt tccaagaagc
2581 agttaggact gctccaacct actgacaatt ctacaactgt tagtgttact gtatccagta
2641 acatggttga aactgttgtg ggtcaacttg agcaaactaa tatgcatagt cctgatgtta
2701 tagtaggtga ctatgtcatt attagtgaaa aattgtttgt gcgtagtaag gaagaagacg
2761 gattcgcctt ctaccctgct tgcactaatg gtcatgctgt accgactctc tttagactta
2821 agggaggtgc acctgtaaaa aaagtagcct ttggcggtga tcaagtacat gaggttgctg
2881 ctgtaagaag tgttactgtc gagtacaaca ttcatgctgt attagacaca ctacttgctt
2941 cttctagtct tagaaccttt gttgtagata agtctttgtc aattgaggag tttgctgacg
3001 tagtaaagga acaagtctca gacttgcttg ttaaattact gcgtggaatg ccgattccag
3061 attttgattt agacgatttt attgacgcac catgctattg ctttaacgct gagggtgatg
3121 catcttggtc ttctactatg atcttctctc ttcaccccgt cgagtgtgac gaggagtgtt
3181 ctgaagtaga ggcttcagat ttagaagaag gtgaatcaga gtgcatttct gagacttcaa
3241 ctgaacaagt tgacgtttct catgaggttt ctgacgacga gtgggctgct gcagttgatg
3301 aagcgttccc cctcgatgaa gcagaagatg ttactgaatc tgtgcaagaa gaagcacaac
3361 cagtagaagt acctgttgaa gatattgcgc aggttgtcat agctgacacc ttacaggaaa
3421 ctcctgttgt gtctgatact gttgaagtcc caccgcaagt ggtgaaactt ccgtctgaac
3481 ctcagactat ccagcccgag gtaaaagaag ttgcacctgt ctatgaggct gataccgaac
3541 agacacagag tgttactgtt aaacctaaga ggttacgcaa aaagcgtaat gttgaccctt
3601 tgtccaattt tgaacataag gttattacag agtgcgttac catagtttta ggtgacgcaa
3661 ttcaagtagc caagtgctat ggggagtctg tgttagttaa tgctgctaac acacatctta
3721 agcatggcgg tggtatcgct ggtgctatta atgcggcttc aaaaggggct gtccaaaaag
3781 agtcagatga gtatattctg gctaaagggc cgttacaagt aggagattca gttctcttgc
3841 aaggccattc tctagctaag aatatcctgc atgtcgtagg cccagatgcc cgcgctaaac
3901 aggatgtttc tctccttagt aagtgctata aggctatgaa tgcatatcct cttgtagtca
3961 ctcctcttgt ttcaacaggc atatttggtg taaaaccagc tgtgtctttt gattatctta
4021 ttagagaggc taagactaga gttttagtcg tcgttaattc ccaagatgtc tataagagtc
4081 ttaccatagt tgacattcca cagagtttga ctttttcata tgatgggtta cgtggcgcaa
4141 tacgtaaagc taaagattat ggttttactg tttttgtgtg cacagacaac tctgctaaca
4201 ctaaagttct taggaacaag ggtgttgatt atactaagaa gtttcttaca gttgacggtg
4261 tgcaatatta ttgctacacg tctaaggaca ctttagatga tatcttacaa caggctaata
4321 agtctgttgg tattatatct atgcctttgg gatatgtgtc tcatggttta gacttaattc
4381 aagcagggag tgtcgtgcgt agagttaacg tgccctacgt gtgtctccta gctaataaag
4441 agcaagaagc tattttgatg tctgaagacg ttaagttaaa cccttcagaa gattttataa
4501 agcacgtccg cactaatggt ggttacaatt cttggcattt agtcgagggt gaactattgg
4561 tgcaagactt acgcttaaat aagctcctgc attggtctga tcaaaccata tgctacaagg
4621 atagtgtgtt ttatgttgta aagaatagta cagcttttcc atttgaaaca ctttcagcat
4681 gtcgtgcgta tttggattca cgcacgacac agcagttaac aatcgaagtc ttagtgactg
4741 tcgatggtgt aaattttaga acagtcgttc taaataataa gaacacttat agatcacagc
4801 ttggatgcgt tttctttaat ggtgctgata tttctgatac cattcctgat gagaaacaga
4861 atggtcacag tttatatcta gcagacaatt tgactgctga tgaaacaaag gcgcttaaag
4921 agttatatgg ccccgttgat cctactttct tacacagatt ctattcactt aaggctgcag
4981 tccataagtg gaagatggtt gtgtgtgata aggtacgttc tctcaaattg agtgataata
5041 attgttatct taatgcagtt attatgacac ttgatttatt gaaggacatt aaatttgtta
5101 tacctgctct acagcatgca tttatgaaac ataagggcgg tgattcaatt gacttcatag
5161 ccctcattat ggcttatggc aattgcacat ttggtgctcc agatgatgcc tctcggttac
5221 ttcataccgt gcttgcaaag gctgagttat gctgttctgc acgcatggtt tggagagagt
5281 ggtgcaatgt ctgtggcata aaagatgttg ttctacaagg cttaaaagct tgttgttacg
5341 tgggtgtgca aactgttgaa gatctgcgtg ctcgcatgac atatgtatgc cagtgtggtg
5401 gtgaacgtca tcggcaaata gtcgaacaca ccaccccctg gttgctgctc tcaggcacac
5461 caaatgaaaa attggtgaca acctccacgg cgcctgattt tgtagcgttt aatgtctttc
5521 agggcattga aacggctgtt ggccattatg ttcatgctcg cctgaagggt ggtcttattt
5581 taaagtttga ctctggcacc gttagcaaga cttcagactg gaagtgcaag gtgacagatg
5641 tacttttccc cggccaaaaa tacagtagcg attgtaatgt cgtacggtat tctttggacg
5701 gtaatttcag aacagaggtt gatcccgacc tatctgcttt ctatgttaag gatggtaaat
5761 actttacaag tgaaccaccc gtaacatatt caccagctac aattttagct ggtagtgtct
5821 acactaatag ctgccttgta tcgtctgatg gacaacctgg cggtgatgct attagtttga
5881 gttttaataa ccttttaggg tttgattcta gtaaaccagt cactaagaaa tacacttact
5941 ccttcttgcc taaagaagac ggcgatgtgt tgttggctga gtttgacact tatgacccta
6001 tttataagaa tggtgccatg tataaaggca aaccaattct ttgggtcaac aaagcatctt
6061 atgatactaa tcttaataag ttcaatagag ctagtttgcg tcaaattttt gacgtagccc
6121 ccattgaact cgaaaataaa ttcacacctt tgagtgtggc gtccacacca gttgaacctc
6181 caactgtaga tgtggtagca cttcaacagg aaatgacaat tgtcaaatgt aagggtttaa
6241 ataaaccttt cgtgaaggac aatgtcagtt tcgttgttga tgactcaggt actcccgttg
6301 ttgagtatct gtctaaagaa gatctacata cattgtatgt agaccctaag tatcaagtca
6361 ttgtcttaaa agacaatgta ctttcttcta tgcttagatt gcacaccgtt gagtcaggtg
6421 atattaacgt tgttgcagct tccggatctt tgacacgtaa agtgaagtta ctatttaggg
6481 cttcatttta tttcaaagaa tttgctaccc gcactttcac tgctaccact gctgtaggta
6541 gttgtataaa gagtgtagtg cggcatctag gtgttactaa aggcatattg acaggctgtt
6601 ttagttttgt caagatgtta tttattcttc cactagctta ctttagtgat tcaaaactcg
6661 gcaccacaga ggttaaagtg agtgctttga aaacagctgg cgttgtgaca ggtaatgttg
6721 taaaacagtg ttgcactgct gctgttgatt taagtatgga taagttgcgc cgtgtggatt
6781 ggaaatcaac cctacggttg ttacttatgt tatgcacaac tatggtattg ttgtcttctg
6841 tgtatcactt gtatgtcttc aatcaggtct tatcaagtga tgttatgttt gaagatgccc
6901 aaggtttgaa aaagttctac aaagaagtta gagcttacct aggaatctct tctgcttgtg
6961 acggtcttgc ttcagcttat agggcgaatt catttgatgt acctacattc tgcgcaaacc
7021 gttctgcaat gtgtaattgg tgcttgatta gccaagattc cataactcac tacccagctc
7081 ttaagatggt tcaaacacat cttagccact atgttcttaa catagattgg ttgtggtttg
7141 catttgagac tggtttggca tacatgctct atacctcggc cttcaactgg ttgttgttgg
7201 caggtacatt gcattatttc tttgcacaga cttccatatt tgtagactgg cggtcataca
7261 attatgctgt gtctagtgcc ttctggttat tcacccacat tccaatggcg ggtttggtac
7321 gaatgtataa tttgttagca tgcctttggc ttttacgcaa gttttatcag catgtaatca
7381 atggttgcaa agatacggca tgcttgctct gctataagag gaaccgactt actagagttg
7441 aagcttctac cgttgtctgt ggtggaaaac gtacgtttta tatcacagca aatggcggta
7501 tttcattctg tcgtaggcat aattggaatt gtgtggattg tgacattgca ggtgtgggga
7561 ataccttcat ctgtgaagaa gtcgcaaatg acctcactac cgccctacgc aggcctatta
7621 acgctacgga tagatcacat tattatgtgg attccgttac agttaaagag actgttgttc
7681 agtttaatta tcgtagagac ggtcaaccat tctacgagcg gtttcccctc tgcgctttta
7741 caaatctaga taagttgaag ttcaaagagg tctgtaaaac tactactggt atacctgaat
7801 acaactttat catctacgac tcatcagatc gtggccagga aagtttagct aggtctgcat
7861 gtgtttatta ttctcaagtc ttgtgtaaat caattctttt ggttgactca agtttggtta
7921 cttctgttgg tgattctagt gaaatcgcca ctaaaatgtt tgattccttt gttaatagtt
7981 tcgtctcgct gtataatgtc acacgcgata agttggaaaa acttatctct actgctcgtg
8041 atggcgtaag gcgaggcgat aacttccata gtgtcttaac aacattcatt gacgcagcac
8101 gaggccccgc aggtgtggag tctgatgttg agaccaatga aattgttgac tctgtgcagt
8161 atgctcataa acatgacata caaattacta atgagagtta caataattat gtaccctcat
8221 atgttaaacc tgatagtgtg tctaccagtg atttaggtag tctcattgat tgtaatgcgg
8281 cttcagttaa ccaaattgtc ttgcgtaatt ctaatggtgc ttgtatttgg aacgctgctg
8341 catatatgaa actctcggat gcacttaaac gacagattcg cattgcatgc cgtaagtgta
8401 atttagcttt ccggttaacc acctcaaagc tacgcgctaa tgataatatc ttatcagtta
8461 gattcactgc taacaaaatt gttggtggtg ctcctacatg gtttaatgtg ttgcgtgact
8521 ttacgttaaa gggttacgtt cttgctacca ttattgtgtt tctgtgtgct gtactgatgt
8581 atttgtgttt acctacattt tctatggtac ctgttgaatt ttatgaagac cgcatcttgg
8641 actttaaagt tcttgataat ggtatcatta gggatgtaaa tcctgatgat aagtgctttg
8701 ctaataagca ccggtccttc acacaatggt atcatgagca tgttggtggt gtctatgaca
8761 actctatcac atgcccattg acagttgcag taattgctgg agttgctggt gctcgcattc
8821 cagacgtacc tactacattg gcttgggtga acaatcagat aattttcttt gtttctcgag
8881 tctttgctaa tacaggcagt gtttgctaca ctcctataga tgagataccc tataagagtt
8941 tctctgatag tggttgcatt cttccatctg agtgcactat gtttagggat gcagagggcc
9001 gtatgacacc atactgccat gatcctactg ttttgcctgg ggcttttgcg tacagtcaga
9061 tgaggcctca tgttcgttac gacttgtatg atggtaacat gtttattaaa tttcctgaag
9121 tagtatttga aagtacactt aggattacta gaactctgtc aactcagtac tgccggttcg
9181 gtagttgtga gtatgcacaa gagggtgttt gtattaccac aaatggctcg tgggccattt
9241 ttaatgacca ccatcttaat agacctggtg tctattgtgg ctctgatttt attgacattg
9301 tcaggcggtt agcagtatca ctgttccagc ctattactta tttccaattg actacctcat
9361 tggtcttggg tataggtttg tgtgcattcc tgactttgct cttctattat attaataaag
9421 taaaacgtgc ttttgcagat tacacccagt gtgctgtaat tgctgttgtt gctgctgttc
9481 ttaatagctt gtgcatctgc tttgttgcat ctataccatt gtgtatagta ccttacactg
9541 cattgtacta ttatgctaca ttctatttta ctaatgagcc tgcatttatt atgcatgttt
9601 cttggtacat tatgttcggg cctatcgttc ccatatggat gacctgcgtc tatacagttg
9661 caatgtgctt tagacacttc ttctgggttt tagcttattt tagtaagaaa catgtagaag
9721 tttttactga tggtaagctt aattgtagtt tccaggacgc tgcctctaat atctttgtta
9781 ttaacaagga cacttatgca gctcttagaa actctttaac taatgatgcc tattcacgat
9841 ttttggggtt gtttaacaag tataagtact tctctggtgc tatggaaaca gccgcttatc
9901 gtgaagctgc agcatgtcat cttgctaaag ccttacaaac atacagcgag actggtagtg
9961 atcttcttta ccaaccaccc aactgtagca taacctctgg cgtgttgcaa agcggtttgg
10021 tgaaaatgtc acatcccagt ggagatgttg aggcttgtat ggttcaggtt acctgcggta
10081 gcatgactct taatggtctt tggcttgaca acacagtctg gtgcccacga cacgtaatgt
10141 gcccggctga ccagttgtct gatcctaatt atgatgcctt gttgatttct atgactaatc
10201 atagtttcag tgtgcaaaaa cacattggcg ctccagcaaa cttgcgtgtt gttggtcatg
10261 ccatgcaagg cactcttttg aagttgactg tcgatgttgc taaccctagc actccagcct
10321 acacttttac aacagtgaaa cctggcgcag catttagtgt gttagcatgc tataatggtc
10381 gtccgactgg tacattcact gttgtaatgc gccctaacta cacaattaag ggttcctttc
10441 tgtgtggttc ttgtggtagt gttggttaca ccaaggaggg tagtgtgatc aatttttgtt
10501 acatgcatca aatggaactt gctaatggta cacataccgg ttcagcattt gatggtacta
10561 tgtatggtgc ctttatggat aaacaagtgc accaagttca gttaacagac aaatactgca
10621 gtgttaatgt agtagcttgg ctttacgcag caatacttaa tggttgcgct tggtttgtaa
10681 aacctaatcg cactagtgtt gtttctttta atgaatgggc tcttgccaac caattcactg
10741 aatttgttgg cactcaatcc gttgacatgt tagctgtcaa aacaggcgtt gctattgaac
10801 agctgcttta tgcgatccaa caactttata ctgggttcca gggaaagcaa atccttggca
10861 gtactatgtt ggaagatgaa ttcacacctg aggatgttaa tatgcagatt atgggtgtgg
10921 ttatgcagag tggtgtgaga aaagttacat atggtactgc gcattggttg ttcgcgaccc
10981 ttgtctcaac ctatgtgata atcttacaag ccactaaatt tactttgtgg aactacttgt
11041 ttgagactat tcccacacag ttgttcccac tcttatttgt gactatggcc ttcgttatgt
11101 tgttggttaa acacaaacac acctttttga cacttttctt gttgcctgtg gctatttgtt
11161 tgacttatgc aaacatagtc tacgagccca ctactcccat ttcgtcagcg ctgattgcag
11221 ttgcaaattg gcttgccccc actaatgctt atatgcgcac tacacatact gatattggtg
11281 tctacattag tatgtcactt gtattagtca ttgtagtgaa gagattgtac aacccatcac
11341 tttctaactt tgcgttagca ttgtgcagtg gtgtaatgtg gttgtacact tatagcattg
11401 gagaagcctc aagccccatt gcctatctgg tttttgtcac tacactcact agtgattata
11461 cgattacagt ctttgttact gtcaaccttg caaaagtttg cacttatgcc atctttgctt
11521 actcaccaca gcttacactt gtgtttccgg aagtgaagat gatactttta ttatacacat
11581 gtttaggttt catgtgtact tgctattttg gtgtcttctc tcttttgaac cttaagctta
11641 gagcacctat gggtgtctat gactttaagg tctcaacaca agagttcaga ttcatgactg
11701 ctaacaatct aactgcacct agaaattctt gggaggctat ggctctgaac tttaagttaa
11761 taggtattgg cggtacacct tgtataaagg ttgctgctat gcagtctaaa cttacagatc
11821 ttaaatgcac atctgtggtt ctcctctctg tgctccaaca gttacactta gaggctaata
11881 gtagggcctg ggctttctgt gttaaatgcc ataatgatat attggcagca acagacccca
11941 gtgaggcttt cgagaaattc gtaagtctct ttgccacttt aatgactttt tctggtaatg
12001 tagatcttga tgcgttagct agtgatattt ttgacactcc tagcgtactt caagctactc
12061 tttctgagtt ttcacactta gctacctttg ctgagttgga agctgcgcag aaagcctatc
12121 aggaagctat ggactctggt gacacctcac cacaagttct taaggctttg cagaaggctg
12181 ttaatatagc taaaaacgcc tatgagaagg ataaggcagt ggcccgtaag ttagaacgta
12241 tggctgatca ggctatgact tctatgtata agcaagcacg tgctgaagac aagaaagcaa
12301 aaattgtcag tgctatgcaa actatgttgt ttggtatgat taagaagctc gacaacgatg
12361 ttcttaatgg tatcatttct aacgctagga atggttgtat acctcttagt gtcattccac
12421 tgtgtgcttc aaataaactt cgcgttgtaa ttcctgactt caccgtctgg aatcaggtag
12481 tcacatatcc ctcgcttaac tacgctgggg ctttgtggga cattacagtt ataaacaatg
12541 tggacaatga aattgttaag tcttcagatg ttgtagacag caatgaaaat ttaacatggc
12601 cacttgtttt agaatgcact agggcatcca cttctgccgt taagttgcaa aataatgaga
12661 tcaaaccttc aggtttaaaa accatggttg tgtctgcagg tcaagagcaa actaactgta
12721 atactagttc cttagcttat tacgaacctg tgcagggtcg taaaatgctg atggctcttc
12781 tttctgataa tgcctatctc aaatgggcgc gtgttgaagg taaggacgga tttgttagtg
12841 tagagctaca acctccttgc aaattcttga ttgcgggacc aaaaggacct gaaatccgat
12901 atctctattt tgttaaaaat cttaacaacc ttcatcgcgg gcaagtgtta gggcacattg
12961 ctgcgactgt tagattgcaa gctggttcta acaccgagtt tgcctctaat tcttcggtgt
13021 tgtcacttgt taacttcacc gttgatcctc aaaaagctta tctcgatttc gtcaatgcgg
13081 gaggtgcccc attgacaaat tgtgttaaga tgcttactcc taaaactggt acaggtatag
13141 ctatatctgt taaaccagag agtacagctg atcaagagac ttatggtgga gcttcagtgt
13201 gtctctattg ccgtgcgcat atagaacatc ctgatgtctc tggtgtttgt aaatataagg
13261 gtaagtttgt ccaaatccct gctcagtgtg tccgtgaccc tgtgggattt tgtttgtcaa
13321 ataccccctg taatgtctgt caatattgga ttggatatgg gtgcaattgt gactcgctta
13381 ggcaagtagc actgccccaa tctaaagatt ccaatttttt aaacgagtcc ggggttctat
13441 tgtaaatgcc cgaatagaac cctgttcaag tggtttgtcc actgatgtcg tctttagggc
13501 atttgacatc tgcaactata aggctaaggt tgctggtatt ggaaaatact acaagactaa
13561 tacttgtagg tttgtagaat tagatgacca agggcatcat ttagactcct attttgtcgt
13621 taagaggcat actatggaga attatgaact agagaagcac tgttacgatt tgttacgtga
13681 ctgtgatgct gtagctcccc atgatttctt catctttgat gtagacaaag ttaaaacacc
13741 tcatattgta cgtcagcgtt taactgagta cactatgatg gatcttgtat atgccctgag
13801 gcactttgat caaaatagcg aagtgcttaa ggctatctta gtgaagtatg gttgctgtga
13861 tgttacctac tttgaaaata aactctggtt tgattttgtt gaaaatccca gtgttattgg
13921 tgtttatcat aaacttggag aacgtgtacg ccaagctatc ttaaacactg ttaaattttg
13981 tgaccacatg gtcaaggctg gtttagtcgg tgtgctcaca ctagacaacc aggaccttaa
14041 tggcaagtgg tatgattttg gtgacttcgt aatcactcaa cctggttcag gagtagctat
14101 agttgatagc tactattctt atttgatgcc tgtgctctca atgaccgatt gtctggccgc
14161 tgagacacat agggattgtg attttaataa accactcatt gagtggccac ttactgagta
14221 tgattttact gattataagg tacaactctt tgagaagtac tttaaatatt gggatcagac
14281 gtatcacgca aattgcgtta attgtactga tgaccgttgt gtgttacatt gtgctaattt
14341 caatgtattg tttgctatga ccatgcctaa gacttgtttc ggacccatag tccgaaagat
14401 ctttgttgat ggcgtgccat ttgtagtatc ttgtggttat cactacaaag aattaggttt
14461 agtcatgaat atggatgtta gtctccatag acataggctc tctcttaagg agttgatgat
14521 gtatgccgct gatccagcca tgcacattgc ctcctctaac gcttttcttg atttgaggac
14581 atcatgtttt agtgtcgctg cacttacaac tggtttgact tttcaaactg tgcggcctgg
14641 caattttaac caagacttct atgatttcgt ggtatctaaa ggtttcttta aggagggctc
14701 ttcagttacg ctcaaacatt ttttctttgc tcaagatggt aatgctgcta ttacagatta
14761 taattactat tcttataatc tgcctactat gtgtgacatc aaacaaatgt tgttctgcat
14821 ggaagttgta aacaagtact tcgaaatcta tgacggtggt tgtcttaatg cttctgaagt
14881 ggttgttaat aatttagaca agagtgctgg ccatcctttt aataagtttg gcaaagctcg
14941 tgtctattat gagagcatgt cttaccagga gcaagatgaa ctctttgcca tgacaaagcg
15001 taacgtcatt cctaccatga ctcaaatgaa tctaaaatat gctattagtg ctaagaatag
15061 agctcgcact gttgcaggcg tgtccatact tagcacaatg actaatcgcc agtaccatca
15121 gaaaatgctt aagtccatgg ctgcaactcg tggagcgact tgcgtcattg gtactacaaa
15181 gttctatggt ggctgggatt tcatgcttaa aacattgtac aaagatgttg ataatccgca
15241 tcttatgggt tgggattacc ctaagtgtga tagagctatg cctaatatgt gtagaatctt
15301 cgcttcactc atattagctc gtaaacatgg cacttgttgt actacaaggg acagatttta
15361 tcgcttggca aatgagtgtg ctcaggtgct aagcgaatat gttctatgtg gtggtggtta
15421 ctacgtcaaa cctggaggta ccagtagcgg agatgccacc actgcatatg ccaatagtgt
15481 ctttaacatt ttgcaggcga caactgctaa tgtcagtgca cttatgggtg ctaatggcaa
15541 caagattgtt gacaaagaag ttaaagacat gcagtttgat ttgtatgtca atgtttacag
15601 gagcactagc ccagacccca aatttgttga taaatactat gcttttctta ataagcactt
15661 ttctatgatg atactgtctg atgacggtgt cgtttgctat aatagtgatt atgcagctaa
15721 gggttacatt gctggaatac agaattttaa ggaaacgctg tattatcaga acaatgtctt
15781 tatgtctgaa gctaaatgct gggtggaaac cgatctgaag aaagggccac atgaattctg
15841 ttcacagcat acgctttata ttaaggatgg cgacgatggt tacttccttc cttatccaga
15901 cccttcaaga attttgtctg ccggttgctt tgtagatgat atcgttaaga ctgacggtac
15961 actcatggta gagcggtttg tgtctttggc tatagatgct taccctctca caaagcatga
16021 agatatagaa taccagaatg tattctgggt ctacttacag tatatagaaa aactgtataa
16081 agaccttaca ggacacatgc ttgacagtta ttctgtcatg ctatgtggtg ataattctgc
16141 taagttttgg gaagaggcat tctacagaga tctctatagt tcgcctacca ctttgcaggc
16201 tgtcggttca tgcgttgtat gccattcaca gacttcccta cgctgtggga catgcatccg
16261 tagaccattt ctctgctgta aatgctgcta tgatcatgtt atagcaactc cacataagat
16321 ggttttgtct gtttctcctt acgtttgtaa tgcccctggt tgtggcgttt cagacgttac
16381 taagctatat ttaggtggta tgagctactt ttgtgtagat catagacctg tgtgtagttt
16441 tccactttgc gctaatggtc ttgtattcgg cttatacaag aatatgtgca caggtagtcc
16501 ttctatagtt gaatttaata ggttggctac ctgtgactgg actgaaagtg gtgattacac
16561 ccttgccaat actacaacag aaccactcaa actttttgct gctgagactt tacgtgccac
16621 tgaagaggcg tctaagcagt cttatgctat tgccaccatc aaagaaattg ttggtgagcg
16681 ccaactatta cttgtgtggg aggctggcaa gtccaaacca ccactcaatc gtaattatgt
16741 ttttactggt tatcatataa ccaaaaatag taaagtgcag ctcggtgagt acatcttcga
16801 gcgcattgat tatagtgatg ctgtatccta caagtctagt acaacgtata aactgactgt
16861 aggtgacatc ttcgtactta cctctcactc tgtggctacc ttgacggcgc ccacaattgt
16921 gaatcaagag aggtatgtta aaattactgg gttgtaccca accattacgg tacctgaaga
16981 gttcgcaagt catgttgcca acttccaaaa atcaggttat agtaaatatg tcactgttca
17041 gggaccacct ggcactggca aaagtcattt tgctataggg ttagcgattt actaccctac
17101 agcacgtgtt gtttatacag catgttcaca cgcagctgtt gatgctttgt gtgaaaaagc
17161 ttttaaatat ttgaacattg ctaaatgttc ccgtatcatt cctgcaaagg cacgtgttga
17221 gtgctatgac aggtttaaag ttaatgagac aaattctcaa tatttgttta gtactattaa
17281 tgctctacca gaaacttctg ccgatattct ggtggttgat gaggttagta tgtgcactaa
17341 ttatgatctt tcaattatta atgcacgtat taaagctaag cacattgtct atgtaggaga
17401 tccagcacag ttgccagctc ctaggacttt gttgactaga ggcacattgg aaccagaaaa
17461 tttcaatagt gtcactagat tgatgtgtaa cttaggtcct gacatatttt taagtatgtg
17521 ctacaggtgt cctaaggaaa tagtaagcac tgtgagcgct cttgtctaca ataataaatt
17581 gttagccaag aaggagcttt caggccaatg ctttaaaata ctctataagg gcaatgtgac
17641 gcatgatgct agctctgcca ttaatagacc acaactcaca tttgtgaaga attttattac
17701 tgccaatccg gcatggagta aggcagtctt tatttcgcct tataattcac agaatgctgt
17761 ggctcgttca atgctgggtc ttactactca gactgttgat tcctcacagg gttcagaata
17821 ccagtacgtt atcttctgtc aaacagcaga tacggcacat gctaacaaca ttaacagatt
17881 taatgttgca atcactcgtg cccaaaaagg tattctttgt gttatgacat ctcaggcact
17941 ctttgagtcc ttagagttta ctgaattgtc ttttactaat tacaagctcc agtctcagat
18001 tgtaactggc ctttttaaag attgctctag agaaacttct ggcctctcac ctgcttatgc
18061 accaacatac gttagtgttg atgacaagta taagacgagt gatgagcttt gcgtgaatct
18121 taatttaccc gcaaatatcc catactctcg tgttatttcc aggatgggct ttaaactcga
18181 tgcaacagtt cctggatatc ctaagctttt cattactcgt gaagaggctg taaggcaagt
18241 tcgaagctgg ataggcttcg atgttgaggg tgctcatgct tcccgtaatg catgtggcac
18301 caatgtgcct ctacaattag gattttcaac tggtgtgaac tttgttgttc agccagttgg
18361 tgttgtagac actgagtggg gtaacatgtt aacgggcatt gctgcccgtc ctccaccagg
18421 tgaacagttt aagcacctcg tgcctcttat gcataagggg gctgcgtggc ctattgttag
18481 acgacgtata gtgcaaatgt tgtcagacac tttagacaaa ttgtctgatt actgtacgtt
18541 tgtttgttgg gctcatggct ttgaattaac gtctgcatca tacttttgca agataggtaa
18601 ggaacagaag tgttgcatgt gcaatagacg cgctgcagcg tactcttcac ctctgcaatc
18661 ttatgcctgc tggactcatt cctgcggtta tgattatgtc tacaaccctt tctttgtcga
18721 tgttcaacag tggggttatg taggcaatct tgctactaat cacgatcgtt attgctctgt
18781 ccatcaagga gctcatgtgg cttctaatga tgcaataatg actcgttgtt tagctattca
18841 ttcttgtttt atagaacgtg tggattggga tatagagtat ccttatatct cacatgaaaa
18901 gaaattgaat tcctgttgta gaatcgttga gcgcaacgtc gtacgtgctg ctcttcttgc
18961 cggttcattt gacaaagtct atgatattgg caatcctaaa ggaattccta ttgttgatga
19021 ccctgtggtt gattggcatt attttgatgc acagcccttg accagaaagg tacaacagct
19081 tttctataca gaggacatgg cctcaagatt tgctgatggg ctctgcttat tttggaactg
19141 taatgtacca aaatatccta ataatgcaat tgtatgcagg tttgacacac gtgtgcattc
19201 tgagttcaat ttgccaggtt gtgatggcgg tagtttgtat gttaacaagc acgcttttca
19261 tacaccagca tatgatgtga gtgcattccg tgatctgaaa cctttaccat tcttttatta
19321 ttctactaca ccatgtgaag tgcatggtaa tggtagtatg atagaggata ttgattatgt
19381 acccctaaaa tctgcagtct gtattacagc ttgtaattta gggggcgctg tttgtaggaa
19441 gcatgctaca gagtacagag agtatatgga agcatataat cttgtctctg catcaggttt
19501 ccgcctttgg tgttataaga cctttgatat ttataatctc tggtctactt ttacaaaagt
19561 tcaaggtttg gaaaacattg cttttaatgt tgttaaacaa ggccatttta ttggtgttga
19621 gggtgaacta cctgtagctg tagtcaatga taagatcttc accaagagtg gcgttaatga
19681 catttgtatg tttgagaata aaaccacttt gcctactaat atagcttttg aactctatgc
19741 taagcgtgct gtacgctcgc atcccgattt caaattgcta cacaatttac aagcagacat
19801 ttgctacaag ttcgtccttt gggattatga acgtagcaat atttatggta ctgctactat
19861 tggtgtatgt aagtacactg atattgatgt taattcagct ttgaatatat gttttgacat
19921 acgcgataat ggttcattgg agaagttcat gtctactccc aatgccatct ttatttctga
19981 tagaaaaatt aagaaatacc cttgtattgt aggtcctgat tatgcttact tcaatggtgc
20041 tatcatccgt gatagtgatg ttgttaaaca accagtgaag ttctacttgt ataagaaagt
20101 caataatgag tttattgatc ctactgagtg tatttacact cagagtcgct cttgtagtga
20161 cttcctaccc ctgtctgaca tggagaaaga ctttctatct tttgatagtg atgttttcat
20221 taagaagtat ggcttggaaa actatgcttt tgagcacgta gtctatggag acttctctca
20281 tactacgtta ggcggtcttc acttgcttat tggtttatac aagaagcaac aggaaggtca
20341 tattattatg gaagaaatgc taaaaggtag ctcaactatt cataactatt ttattactga
20401 gactaacaca gcggctttta aggcggtgtg ttctgttata gatttaaagc ttgacgactt
20461 tgttatgatt ttaaagagtc aagaccttgg cgtagtatcc aaggttgtca aggttcctat
20521 tgacttaaca atgattgagt ttatgttatg gtgtaaggat ggacaggttc aaaccttcta
20581 ccctcgactc caggcttctg cagattggaa acctggtcat gcaatgccat ccctctttaa
20641 agttcaaaat gtaaaccttg aacgttgtga gcttgctaat tacaagcaat ctattcctat
20701 gcctcgcggt gtgcacatga acatcgctaa atatatgcaa ttgtgccagt atttaaatac
20761 ttgcacatta gccgtgcctg ccaatatgcg tgttatacat tttggcgctg gttctgataa
20821 aggtatcgct cctggtacat cagttttacg acagtggctt cctacagatg ccattattat
20881 agataatgat ttaaatgagt tcgtgtcaga tgctgacata actttatttg gagattgtgt
20941 aactgtacgt gtcggccaac aagtggatct tgttatttcc gacatgtatg atcctactac
21001 taagaatgta acaggtagta atgagtcaaa ggctttattc tttacttacc tgtgtaacct
21061 cattaataat aatcttgctc ttggtgggtc tgttgctatt aaaataacag aacactcttg
21121 gagcgttgaa ctttatgaac ttatgggaaa atttgcttgg tggactgttt tctgcaccaa
21181 tgcaaatgca tcctcatctg aaggattcct cttaggtatt aattacttgg gtactattaa
21241 agaaaatata gatggtggtg ctatgcacgc caactatata ttttggagaa attccactcc
21301 tatgaatctg agtacttact cactttttga tttatccaag tttcaattaa aattaaaagg
21361 aacaccagtt cttcaattaa aggagagtca aattaacgaa ctcgtaatat ctctcctgtc
21421 gcagggtaag ttacttatcc gtgacaatga tacactcagt gtttctactg atgttcttgt
21481 taacacctac agaaagttac gttgatgtag ggccagattc tgttaagtct gcttgtattg
21541 aggttgatat acaacagact ttctttgata aaacttggcc taggccaatt gatgtttcta
21601 aggctgacgg tattatatac cctcaaggcc gtacatattc taacataact atcacttatc
21661 aaggtctttt tccctatcag ggagaccatg gtgatatgta tgtctactct gcaggacatg
21721 ctacaggcac aactccacaa aagttgtttg tagctaacta ttctcaggac gtcaaacagt
21781 ttgctaatgg gtttgtcgtc cgtataggag cagctgccaa ttccactggc actgttatta
21841 ttagcccatc taccagcgct actatacgaa aaatttaccc tgcttttatg ctgggttctt
21901 cagttggtaa tttctcagat ggtaaaatgg gccgcttctt caatcatact ctagttcttt
21961 tgcccgatgg atgtggcact ttacttagag ctttttattg tattctagag cctcgctctg
22021 gaaatcattg tcctgctggc aattcctata cttcttttgc cacttatcac actcctgcaa
22081 cagattgttc tgatggcaat tacaatcgta atgccagtct gaactctttt aaggagtatt
22141 ttaatttacg taactgcacc tttatgtaca cttataacat taccgaagat gagattttag
22201 agtggtttgg cattacacaa actgctcaag gtgttcacct cttctcatct cggtatgttg
22261 atttgtacgg cggcaatatg tttcaatttg ccaccttgcc tgtttatgat actattaagt
22321 attattctat cattcctcac agtattcgtt ctatccaaag tgatagaaaa gcttgggctg
22381 ccttctacgt atataaactt caaccgttaa ctttcctgtt ggatttttct gttgatggtt
22441 atatacgcag agctatagac tgtggtttta atgatttgtc acaactccac tgctcatatg
22501 aatccttcga tgttgaatct ggagtttatt cagtttcgtc tttcgaagca aaaccttctg
22561 gctcagttgt ggaacaggct gaaggtgttg aatgtgattt ttcacctctt ctgtctggca
22621 cacctcctca ggtttataat ttcaagcgtt tggtttttac caattgcaat tataatctta
22681 ccaaattgct ttcacttttt tctgtgaatg attttacttg tagtcaaata tctccagcag
22741 caattgctag caactgttat tcttcactga ttttggatta tttttcatac ccacttagta
22801 tgaaatccga tctcagtgtt agttctgctg gtccaatatc ccagtttaat tataaacagt
22861 ccttttctaa tcccacatgt ttgattttag cgactgttcc tcataacctt actactatta
22921 ctaagcctct taagtacagc tatattaaca agtgctctcg tcttctttct gatgatcgta
22981 ctgaagtacc tcagttagtg aacgctaatc aatactcacc ctgtgtatcc attgtcccat
23041 ccactgtgtg ggaagacggt gattattata ggaaacaact atctccactt gaaggtggtg
23101 gctggcttgt tgctagtggc tcaactgttg ccatgactga gcaattacag atgggctttg
23161 gtattacagt tcaatatggt acagacacca atagtgtttg ccccaagctt gaatttgcta
23221 atgacacaaa aattgcctct caattaggca attgcgtgga atattccctc tatggtgttt
23281 cgggccgtgg tgtttttcag aattgcacag ctgtaggtgt tcgacagcag cgctttgttt
23341 atgatgcgta ccagaattta gttggctatt attctgatga tggcaactac tactgtttgc
23401 gtgcttgtgt tagtgttcct gtttctgtca tctatgataa agaaactaaa acccacgcta
23461 ctctatttgg tagtgttgca tgtgaacaca tttcctctac catgtctcaa tactcccgtt
23521 ctacgcgatc aatgcttaaa cggcgagatt ctacatatgg tccccttcag acacctgttg
23581 gttgtgtcct aggacttgtt aattcctctt tgttcgtaga ggactgcaag ttgcctcttg
23641 gtcaatctct ctgtgctctt cctgacacac ctagtactct cacacctcgc agtgtgcgct
23701 ctgttccagg tgaaatgcgc ttggcatcca ttgcttttaa tcatcctatt caggttgatc
23761 aacttaatag tagttatttt aaattaagta tacctactaa tttttccttt ggtgtgactc
23821 aggagtacat tcagacaacc attcagaaag ttactgttga ttgtaaacag tacgtttgca
23881 atggtttcca gaagtgtgag caattactgc gcgagtatgg ccagttttgt tccaaaataa
23941 accaggctct ccatggtgcc aatttacgcc aggatgattc tgtacgtaat ttgtttgcga
24001 gcgtgaaaag ctctcaatca tctcctatca taccaggttt tggaggtgac tttaatttga
24061 cacttctaga acctgtttct atatctactg gcagtcgtag tgcacgtagt gctattgagg
24121 atttgctatt tgacaaagtc actatagctg atcctggtta tatgcaaggt tacgatgatt
24181 gtatgcagca aggtccagca tcagctcgtg atcttatttg tgctcaatat gtggctggtt
24241 ataaagtatt acctcctctt atggatgtta atatggaagc cgcgtacact tcatctttgc
24301 ttggcagcat agcaggtgtt ggctggactg ctggcttatc ctcctttgct gctattccat
24361 ttgcacagag tattttttat aggttaaacg gtgttggcat tactcaacag gttctttcag
24421 agaaccaaaa gcttattgcc aataagttta atcaggctct gggagctatg caaacaggct
24481 tcactacaac taatgaagct tttcggaagg ttcaggatgc tgtgaacaac aatgcacagg
24541 ctctatccaa attagctagc gagctatcta atacttttgg tgctatttcc gcctctattg
24601 gagacatcat acaacgtctt gatgttctcg aacaggacgc ccaaatagac agacttatta
24661 atggccgttt gacaacacta aatgcttttg ttgcacagca gcttgttcgt tccgaatcag
24721 ctgctctttc cgctcaattg gctaaagata aagtcaatga gtgtgtcaag gcacaatcca
24781 agcgttctgg attttgcggt caaggcacac atatagtgtc ctttgttgta aatgccccta
24841 atggccttta ctttatgcat gttggttatt accctagcaa ccacattgag gttgtttctg
24901 cttatggtct ttgcgatgca gctaacccta ctaattgtat agcccctgtt aatggctact
24961 ttattaaaac taataacact aggattgttg atgagtggtc atatactggc tcgtccttct
25021 atgcacctga gcccatcacc tctcttaata ctaagtatgt tgcaccacag gtgacatacc
25081 aaaacatttc tactaacctc cctcctcctc ttctcggcaa ttccaccggg attgacttcc
25141 aagatgagtt ggatgagttt ttcaaaaatg ttagcaccag tatacctaat tttggttctc
25201 taacacagat taatactaca ttactcgatc ttacctacga gatgttgtct cttcaacaag
25261 ttgttaaagc ccttaatgag tcttacatag accttaaaga gcttggcaat tatacttatt
25321 acaacaaatg gccgtggtac atttggcttg gtttcattgc tgggcttgtt gccttagctc
25381 tatgcgtctt cttcatactg tgctgcactg gttgtggcac aaactgtatg ggaaaactta
25441 agtgtaatcg ttgttgtgat agatacgagg aatacgacct cgagccgcat aaggttcatg
25501 ttcactaatt aacgaactat caatgagagt tcaaagacca cccactctct tgttagtgtt
25561 ctcactctct tttttggtca ctgcattttc aaaacctctc tatgtacctg agcattgtca
25621 gaattattct ggttgcatgc ttagggcttg tattaaaact gcccaagctg atacagctgg
25681 tctttataca aattttcgaa ttgacgtccc atctgcagaa tcaactggta ctcaatcagt
25741 ttctgtcgat cgtgagtcta cttcaactca tgatggtctt accgaacatg ttactagtgt
25801 gaatcttttt gacgttggtt actcagttaa ttaacgaact ctatggatta cgtgtctctg
25861 cttaatcaaa tttggcagaa gtaccttaat tcaccgtata ctacttgttt gtatatccct
25921 aaacccacag ctaagtatac acctttagtt ggcacttcat tgcaccctgt gctgtggaac
25981 tgtcagctat cctttgctgg ttatactgaa tctgctgtta attctacaaa agctttggcc
26041 aaacaggacg cagctcagcg aatcgcttgg ttgctacata aggatggagg aatccctgac
26101 ggatgttccc tctacctccg gcactcaagt ttattcgcgc aaagcgagga agatgagtca
26161 ttctccaact aagaaactgc gctacgttaa gcgtagattt tctcttctgc gccctgaaga
26221 ccttagtgtt attgtccaac caacacacta tgtcagggtt acattttcag accccaacat
26281 gtggtatcta cgttcgggtc atcatttaca ctcagttcac aattggctta aaccttatgg
26341 cggccaacct gtttctgagt accatattac tctagctttg ctaaatctca ctgatgaaga
26401 tttagctaga gatttttcac ccattgcgct ctttttgcgc aatgtcagat ttgagctaca
26461 tgagttcgcc ttgctgcgca aaactcttgt tcttaatgca tcagagatct actgtgctaa
26521 catacataga tttaagcctg tgtatagagt taacacggca atccctacta ttaaggattg
26581 gcttctcgtt cagggatttt ccctttacca tagtggcctc cctttacata tgtcaatctc
26641 taaattgcat gcactggatg atgttactcg caattacatc attacaatgc catgctttag
26701 aacttatcct caacaaatgt ttgttactcc tttggccgta gatgttgtct ccatacggtc
26761 ttccaatcag ggtaataaac aaattgttca ttcttacccc attttacatc atccatgatt
26821 ttaacgaact atggctttct cggcgtcttt atttaaaccc gtccagctag tcccagtttc
26881 tcctgcattt catcgcattg agtctactga ctctattgtt ttcacataca ttcctgctag
26941 cggctatgta gctgctttag ctgtcaatgt gtgtctcatt cccctattat tactgctacg
27001 tcaagatact tgtcgtcgca gcattatcag aactatggtt ctctatttcc ttgttcttta
27061 taacttttta ttagccattg tactagtcaa tggtgtacat tatccaactg gaagttgcct
27121 gatagccttc ttagttatcc tcataatact ttggtttgta gatagaattc gtttctgtct
27181 catgctgaat tcctacattc cactgtttga catgcgttct cactttattc gtgttagtac
27241 agtttcttct catggtatgg tccctgtcat acacaccaaa ccattattta ttagaaactt
27301 cgatcagcgt tgcagctgtt ctcgttgttt ttatttgcac tcttctactt atatagagtg
27361 cacttatatt agccgtttta gtaagattag cctagtttct gtaactgact tctccttaaa
27421 cggcaatgtt tccactgttt tcgtgcctgc aacgcgcgat tcagttcctc ttcacataat
27481 cgccccgagc tcgcttatcg tttaagcagc tctgcgctac tatgggtccc gtgtagaggc
27541 taatccatta gtctctcttt ggacatatgg aaaacgaact atgttaccct ttgtccaaga
27601 acgaataggg ttgttcatag taaacttttt catttttacc gtagtatgtg ctataacact
27661 cttggtgtgt atggctttcc ttacggctac tagattatgt gtgcaatgta tgacaggctt
27721 caataccctg ttagttcagc ccgcattata cttgtataat actggacgtt cagtctatgt
27781 aaaattccag gatagtaaac cccctctacc acctgacgag tgggtttaac gaactccttc
27841 ataatgtcta atatgacgca actcactgag gcgcagatta ttgccattat taaagactgg
27901 aactttgcat ggtccctgat ctttctctta attactatcg tactacagta tggataccca
27961 tcccgtagta tgactgtcta tgtctttaaa atgtttgttt tatggctcct atggccatct
28021 tccatggcgc tatcaatatt tagcgccatt tatccaattg atctagcttc ccagataatc
28081 tctggcattg tagcagctgt ttcagctatg atgtggattt cctactttgt gcagagtatc
28141 cggctgttta tgagaactgg atcatggtgg tcattcaatc ctgagactaa ttgccttttg
28201 aatgttccaa ttggtggtac aactgtcgta cgtccactcg tagaggactc taccagtgta
28261 actgctgttg taaccaatgg tcacctcaaa atggctggca tgcatttcgg tgcttgtgac
28321 tacgacagac ttcctaatga agtcaccgtg gccaaaccca atgtgctgat tgctttaaaa
28381 atggtgaagc ggcaaagcta cggaactaat tccggcgttg ccatttacca tagatataag
28441 gcaggtaatt acaggagtcc gcctattacg gcggatattg aacttgcatt gcttcgagct
28501 taggctcttt agtaagagta tcttaattga ttttaacgaa tctcaatttc attgttatgg
28561 catcccctgc tgcacctcgt gctgtttcct ttgccgataa caatgatata acaaatacaa
28621 acctgtctcg aggtagagga cgtaatccaa aaccacgagc tgcaccaaat aacactgtct
28681 cttggtacac tgggcttacc caacacggga aagtccctct tacctttcca cctgggcagg
28741 gtgtacctct taatgccaat tccacccctg cgcaaaatgc tgggtattgg cggagacagg
28801 acagaaaaat taataccggg aatggaatta agcaactggc tcccaggtgg tacttctact
28861 acactggaac tggacccgaa gcagcactcc cattccgggc tgttaaggat ggcatcgttt
28921 gggtccatga agatggcgcc actgatgctc cttcaacttt tgggacgcgg aaccctaaca
28981 atgattcagc tattgttaca caattcgcgc ccggtactaa gcttcctaaa aacttccaca
29041 ttgaggggac tggaggcaat agtcaatcat cttcaagagc ctctagcgta agcagaaact
29101 cttccagatc tagttcacaa ggttcaagat caggaaactc tacccgcggc acttctccag
29161 gtccatctgg aatcggagca gtaggaggtg atctacttta ccttgatctt ctgaacagac
29221 tacaagccct tgagtctggc aaagtaaagc aatcgcagcc aaaagtaatc actaagaaag
29281 atgctgctgc tgctaaaaat aagatgcgcc acaagcgcac ttccaccaaa agtttcaaca
29341 tggtgcaagc ttttggtctt cgcggaccag gagacctcca gggaaacttt ggtgatcttc
29401 aattgaataa actcggcact gaggacccac gttggcccca aattgctgag cttgctccta
29461 cagccagtgc ttttatgggt atgtcgcaat ttaaacttac ccatcagaac aatgatgatc
29521 atggcaaccc tgtgtacttc cttcggtaca gtggagccat taaacttgac ccaaagaatc
29581 ccaactacaa taagtggttg gagcttcttg agcaaaatat tgatgcctac aaaaccttcc
29641 ctaagaagga aaagaaacaa aaggcaccaa aagaagaatc aacagaccaa atgtctgaac
29701 ctccaaagga gcagcgtgtg caaggtagca tcactcagcg cactcgcacc cgtccaagtg
29761 ttcagcctgg tccaatgatt gatgttaaca ctgattagtg tcactcaaag taacaagatc
29821 gcggcaatcg tttgtgtttg gtaaccccat ctcaccatcg cttgtccact cttgcacaga
29881 atggaatcat gttgtaatta cagtgcaata aggtaattat aacccattta attgatagct
29941 atgctttatt aaagtgtgta gctgtagaga gaatgttaaa gactgtcacc tctgcgtgat
30001 tgcaagtgaa cagtgccccc cgggaagagc tctacagtgt gaaatgtaaa taaaaatagc
30061 tattattcaa ttagattagg ctaattagat gatttgcaaa aaaaaaaaaa aaaa

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Tue Jun 09, 2015 10:14 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
Select seq gb|KT006149.1| Middle East respiratory syndrome coronavirus strain ChinaGD01, complete genome 54131 54131 99% 0.0 99% KT006149.1
Select seq gb|KF600628.1| Middle East respiratory syndrome coronavirus isolate Hafr-Al-Batin_1_2013, complete genome 54026 54026 99% 0.0 99% KF600628.1
Select seq gb|KJ650098.1| Middle East respiratory syndrome coronavirus isolate Camel/Qatar_2_2014, complete genome 53992 53992 99% 0.0 99% KJ650098.1
Select seq gb|KJ829365.1| Middle East respiratory syndrome coronavirus strain Florida/USA-2_Saudi Arabia_2014, complete genome 53988 53988 100% 0.0 99% KJ829365.1
Select seq gb|KP223131.1| Middle East respiratory syndrome coronavirus isolate Florida/USA-2_Saudi Arabia_2014, complete genome 53979 53979 100% 0.0 99% KP223131.1
Select seq gb|KF961222.1| Middle East respiratory syndrome coronavirus isolate Qatar4, complete genome 53963 53963 99% 0.0 99% KF961222.1
Select seq gb|KJ713295.1| Middle East respiratory syndrome coronavirus isolate KSA-CAMEL-505, complete genome 53952 53952 99% 0.0 99% KJ713295.1
Select seq gb|KJ713296.1| Middle East respiratory syndrome coronavirus isolate KSA-CAMEL-378, complete genome 53949 53949 99% 0.0 99% KJ713296.1
Select seq gb|KF961221.1| Middle East respiratory syndrome coronavirus isolate Qatar3, complete genome 53949 53949 99% 0.0 99% KF961221.1
Select seq gb|KC667074.1| Human betacoronavirus 2c England-Qatar/2012, complete genome 53949 53949 99% 0.0 99% KC667074.1

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Tue Jun 09, 2015 10:20 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
9 BP del

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Tue Jun 09, 2015 10:23 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
LOCUS KT026454 30123 bp RNA linear VRL 08-JUN-2015
DEFINITION Middle East respiratory syndrome coronavirus strain
Hu/Riyadh_KSA_4050_2015, complete genome.
ACCESSION KT026454
VERSION KT026454.1 GI:828436865
KEYWORDS .
SOURCE Middle East respiratory syndrome coronavirus (MERS-CoV)
ORGANISM Middle East respiratory syndrome coronavirus
Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA
stage; Nidovirales; Coronaviridae; Coronavirinae; Betacoronavirus;
unclassified Betacoronavirus.
REFERENCE 1 (bases 1 to 30123)
AUTHORS Queen,K., Bin Saeed,A., Paden,C., Zhang,J., Li,Y., Tao,Y.,
Erdman,D. and Tong,S.
TITLE Direct Submission
JOURNAL Submitted (06-JUN-2015) Division of Viral Diseases, Centers for
Disease Control and Prevention, 1600 Clifton Rd NE, Atlanta, GA
30033, USA
COMMENT ##Assembly-Data-START##
Assembly Method :: CLC Genomics Workbench v. 7.0.3
Sequencing Technology :: Illumina; Sanger dideoxy sequencing
##Assembly-Data-END##
FEATURES Location/Qualifiers
source 1..30123
/organism="Middle East respiratory syndrome coronavirus"
/mol_type="genomic RNA"
/strain="Hu/Riyadh_KSA_4050_2015"
/isolation_source="respiratory swab"
/host="Homo sapiens"
/db_xref="taxon:1335626"
/country="Saudi Arabia"
/collection_date="01-Mar-2015"
gene 279..21514
/gene="orf1ab"
CDS join(279..13433,13433..21514)
/gene="orf1ab"
/ribosomal_slippage
/codon_start=1
/product="ORF1ab protein"
/protein_id="AKK52600.1"
/db_xref="GI:828436875"
/translation="MSFVAGVIAQGARGTYRAALNSEKHQDHVSLTVPLCGSGNLVEK
LSPWFMDGENAYEVVKAMLLKKEPLLYVPIRLAGHTRHLPGPRVYLVERLIACENPFM
VNQLAYSSSANGSLVGTTLQGKPIGMFFPYDIELVTGKQNILLRKYGRGGYHYTPVHY
ERDNTSCPEWMDDFEADPKGKYAQNLLKKLIGGDVTPVDQYMCGVDGKPISAYAFLMA
KDGITKLADVEADVAARADDEGFITLKNNLYRLVWHVERKDVPYPKQSIFTINSVVQK
DGVENTPPHYFTLGCKILTLTPRNKWSGVSDLSLKQKLLYTFYGKESLENPTYIYHSA
FIECGSCGNDSWLTGNAIQGFACGCGASYTANDVEVQSSGMIKPNALLCATCPFAKGD
SCSSNCKHSVAQLVSYLSERCNVIADSKSFTLIFGGVAYAYFGCEEGTMYFVPRAKSV
VSRIGDSIFTGCTGSWNKVTQIANMFLEQTQHSLNFVGEFVVNDVVLAILSGTTTNVD
KIRQLLKGVTIDKLRDYLADYDVAVTAGPFMDNAINVGGTGLQYAAITAPYVVLTGLG
ESFKKVATIPYKVCNSVKDTLTYYAHSVLYRVFPYDMDSGVSSFSELLFDCVDLSVAS
TYFLVRLLQDKTGDFMSTIITSCQTAVSKLLDTCFEATEATFNFLLDLAGLFRIFLRN
AYVYTSQGFVVVNGKVSTLVKQVLDLLNKGMQLLHTKVSWAGSNISAVIYSGRESLIF
PSGTYYCVTTKAKSVQQDLDVILPGEFSKKQLGLLQPTDNSTTVSVTVSSNMVETVVG
QLEQTNMHSPDVIVGDYVIISEKLFVRSKEEDGFAFYPACTNGHAVPTLFRLKGGAPV
KKVAFGGDQVHEVAAVRSVTVEYNIHAVLDTLLASSSLRTFVVDKSLSIEEFADVVKE
QVSDLLVKLLRGMPIPDFDLDDFIDAPCYCFNAEGDASWSSTMIFSLHPVECDEECSE
VEASDLEEGESECISETSTEQVDVSHEVSDDEWAAAVDEAFPLDEAEDVTESVQEEAQ
PVEVPVEDIAQVVIADTLQETPVVSDTVEVPPQVVKLPSEPQTIQPEVKEVAPVYEAD
TEQTQSVTVKPKRLRKKRNVDPLSNFEHKVITECVTIVLGDAIQVAKCYGESVLVNAA
NTHLKHGGGIAGAINAASKGAVQKESDEYILAKGPLQVGDSVLLQGHSLAKNILHVVG
PDARAKQDVSLLSKCYKAMNAYPLVVTPLVSTGIFGVKPAVSFDYLIREAKTRVLVVV
NSQDVYKSLTIVDIPQSLTFSYDGLRGAIRKAKDYGFTVFVCTDNSANTKVLRNKGVD
YTKKFLTVDGVQYYCYTSKDTLDDILQQANKSVGIISMPLGYVSHGLDLIQAGSVVRR
VNVPYVCLLANKEQEAILMSEDVKLNPSEDFIKHVRTNGGYNSWHLVEGELLVQDLRF
NKLLHWSDQTICYKDSVFYVVKNSTAFPFETLSACRAYLDSRTTQQLTIEVLVTVDGV
NFRTVVLNNKNTYRSQLGCVFFNGADISDTIPDEKQNGHSLYLADNLTADETKALKEL
YGPVDPTFLHRFYSLKAAVHKWKMVVCDKVRSLKLSDNNCYLNAVIMTLDLLKDIKFV
IPALQHAFMKHKGGDSTDFIALIMAYGNCTFGAPDDASRLLHTVLAKAELCCSARMVW
REWCNVCGIKDVVLQGLKACCYVGVQTVEDLRARMTYVCQCGGERHRQIVEHTTPWLL
LSGTPNEKLVTTSTAPDFVAFNVFQGIETAVGHYVHARLKGGLILKFDSGTVSKTSDW
KCKVTDVLFPGQKYSSDCNVVRYSLDGNFRTEVDPDLSAFYVKDGKYFTSEPPVTYSP
ATILAGSVYTNSCLVSSDGQPGGDAISLSFNNLLGFDSSKPVTKKYTYSFLPKEDGDV
LLAEFDTYDPIYKNGAMYKGKPILWVNKASYDTNLNKFNRASLRQIFDVAPIELENKF
TPLSVASTPVEPPTVDVVALQQEMTIVKCKGLNKPFVKDNVSFVVDDSGTPVVEYLSK
EDLHTLYVDPKYQVIVLKDNVLSSMLRLHTVESGDINVVAASGSLTRKVKLLFRASFY
FKEFATRTFTATTAVGSCIKSVVRHLGVTKGILTGCFSFVKMLFILPLAYFSDSKLGT
TEVKVSALKTAGVVTGNVVKQCCTAAVDLSMDKLRRVDWKSTLRLLLMLCTTMVLLSS
VYHLYVFNQVLSSDVMFEDAQGLKKFYKEVRAYLGISSACDGLASAYRANSFDVPTFC
ANRSAMCNWCLISQDSITHYPALKMVQTHLSHYVLNIDWLWFAFETGLAYMLYTSAFN
WLLLAGTLHYFFAQTSIFVDWRSYNYAVSSAFWLFTHIPMAGLVRMYNLLACLWLLRK
FYQHVINGCKDTACLLCYKRNRLTRVEASTVVCGGKRTFYITANGGISFCRRHNWNCV
DCDIAGVGNTFICEEVANDLTTALRRPINATDRSHYYVDSVTVKETVVQFNYRRDGQP
FYERFPLCAFTNLDKLKFKEVCKTTTGIPEYNFIIYDSSDRGQESLARSACVYYSQVL
CKSILLVDSSLVTSVGDSSEIATKMFDSFVNSFVSLYNVTRDKLEKLISTARDGVRRG
DNFHSVLTTFIDAARGPAGVESDVETNEIVDSVQYAHKHDIQITNESYNNYVPSYVKP
DSVSTSDLGSLIDCNAASVNQIVLRNSNGACIWNAAAYMKLSDALKRQIRIACRKCNL
AFRLTTSKLRANDNILSVRFTANKIVGGAPTWFNVLRDFTLKGYVLATIIVFLCAVLM
YLCLPTFSMVPVEFYEDRILDFKVLDNGIIRDVNPDDKCFANKHRSFTQWYHEHVGGV
YDNSITCPLTVAVIAGVAGARIPDVPTTLAWVNNQIIFFVSRVFANTGSVCYTPIDEI
PYKSFSDSGCILPSECTMFRDAEGRMTPYCHDPTVLPGAFAYSQMRPHVRYDLYDGNM
FIKFPEVVFESTLRITRTLSTQYCRFGSCEYAQEGVCITTNGSWAIFNDHHLNRPGVY
CGSDFIDIVRRLAVSLFQPITYFQLTTSLVLGIGLCAFLTLLFYYINKVKRAFADYTQ
CAVIAVVAAVLNSLCICFVASIPLCIVPYTALYYYATFYFTNEPAFIMHVSWYIMFGP
IVPIWMTCVYTVAMCFRHFFWVLAYFSKKHVEVFTDGKLNCSFQDAASNIFVINKDTY
AALRNSLTNDAYSRFLGLFNKYKYFSGAMETAAYREAAACHLAKALQTYSETGSDLLY
QPPNCSITSGVLQSGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCP
ADQLSDPNYDALLISMTNHSFSVQKHIGAPANLRVVGHAMQGTLLKLTVDVANPSTPA
YTFTTVKPGAAFSVLACYNGRPTGTFTVVMRPNYTIKGSFLCGSCGSVGYTKEGSVIN
FCYMHQMELANGTHTGSAFDGTMYGAFMDKQVHQVQLTDKYCSVNVVAWLYAAILNGC
AWFVKPNRTSVVSFNEWALANQFTEFVGTQSVDMLAVKTGVAIEQLLYAIQQLYTGFQ
GKQILGSTMLEDEFTPEDVNMQIMGVVMQSGVRKVTYGTAHWLFATLVSTYVIILQAT
KFTLWNYLFETIPTQLFPLLFVTMAFVMLLVKHKHTFLTLFLLPVAICLTYANIVYEP
TTPISSALIAVANWLAPTNAYMRTTHTDIGVYISMSLVLVIVVKRLYNPSLSNFALAL
CSGVMWLYTYSIGEASSPIAYLVFVTTLTSDYTITVFVTVNLAKVCTYAIFAYSPQLT
LVFPEVKMILLLYTCLGFMCTCYFGVFSLLNLKLRAPMGVYDFKVSTQEFRFMTANNL
TAPRNSWEAMALNFKLIGIGGTPCIKVAAMQSKLTDLKCTSVVLLSVLQQLHLEANSR
AWAFCVKCHNDILAATDPSEAFEKFVSLFATLMTFSGNVDLDALASDIFDTPSVLQAT
LSEFSHLATFAELEAAQKAYQEAMDSGDTSPQVLKALQKAVNIAKNAYEKDKAVARKL
ERMADQAMTSMYKQARAEDKKAKIVSAMQTMLFGMIKKLDNDVLNGIISNARNGCIPL
SVIPLCASNKLRVVIPDFTVWNQVVTYPSLNYAGALWDITVINNVDNEIVKSSDVVDS
NENLTWPLVLECTRASTSAVKLQNNEIKPSGLKTMVVSAGQEQTNCNTSSLAYYEPVQ
GRKMLMALLSDNAYLKWARVEGKDGFVSVELQPPCKFLIAGPKGPEIRYLYFVKNLNN
LHRGQVLGHIAATVRLQAGSNTEFASNSSVLSLVNFTVDPQKAYLDFVNAGGAPLTNC
VKMLTPKTGTGIAISVKPESTADQETYGGASVCLYCRAHIEHPDVSGVCKYKGKFVQI
PAQCVRDPVGFCLSNTPCNVCQYWIGYGCNCDSLRQVALPQSKDSNFLNRVRGSIVNA
RIEPCSSGLSTDVVFRAFDICNYKAKVAGIGKYYKTNTCRFVELDDQGHHLDSYFVVK
RHTMENYELEKHCYDLLRDCDAVAPHDFFIFDVDKVKTPHIVRQRLTEYTMMDLVYAL
RHFDQNSEVLKAILVKYGCCDVTYFENKLWFDFVENPSVIGVYHKLGERVRQAILNTV
KFCDHMVKAGLVGVLTLDNQDLNGKWYDFGDFVITQPGSGVAIVDSYYSYLMPVLSMT
DCLAAETHRDCDFNKPLIEWPLTEYDFTDYKVQLFEKYFKYWDQTYHANCVNCTDDRC
VLHCANFNVLFAMTMPKTCFGPIVRKIFVDGVPFVVSCGYHYKELGLVMNMDVSLHRH
RLSLKELMMYAADPAMHIASSNAFLDLRTSCFSVAALTTGLTFQTVRPGNFNQDFYDF
VVSKGFFKEGSSVTLKHFFFAQDGNAAITDYNYYSYNLPTMCDIKQMLFCMEVVNKYF
EIYDGGCLNASEVVVNNLDKSAGHPFNKFGKARVYYESMSYQEQDELFAMTKRNVIPT
MTQMNLKYAISAKNRARTVAGVSILSTMTNRQYHQKMLKSMAATRGATCVIGTTKFYG
GWDFMLKTLYKDVDNPHLMGWDYPKCDRAMPNMCRIFASLILARKHGTCCTTRDRFYR
LANECAQVLSEYVLCGGGYYVKPGGTSSGDATTAYANSVFNILQATTANVSALMGANG
NKIVDKEVKDMQFDLYVNVYRSTSPDPKFVDKYYAFLNKHFSMMILSDDGVVCYNSDY
AAKGYIAGIQNFKETLYYQNNVFMSEAKCWVETDLKKGPHEFCSQHTLYIKDGDDGYF
LPYPDPSRILSAGCFVDDIVKTDGTLMVERFVSLAIDAYPLTKHEDIEYQNVFWVYLQ
YIEKLYKDLTGHMLDSYSVMLCGDNSAKFWEEAFYRDLYSSPTTLQAVGSCVVCHSQT
SLRCGTCIRRPFLCCKCCYDHVIATPHKMVLSVSPYVCNAPGCGVSDVTKLYLGGMSY
FCVDHRPVCSFPLCANGLVFGLYKNMCTGSPSIVEFNRLATCDWTESGDYTLANTTTE
PLKLFAAETLRATEEASKQSYAIATIKEIVGERQLLLVWEAGKSKPPLNRNYVFTGYH
ITKNSKVQLGEYIFERIDYSDAVSYKSSTTYKLTVGDIFVLTSHSVATLTAPTIVNQE
RYVKITGLYPTITVPEEFASHVANFQKSGYSKYVTVQGPPGTGKSHFAIGLAIYYPTA
RVVYTACSHAAVDALCEKAFKYLNIAKCSRIIPAKARVECYDRFKVNETNSQYLFSTI
NALPETSADILVVDEVSMCTNYDLSIINARIKAKHIVYVGDPAQLPAPRTLLTRGTLE
PENFNSVTRLMCNLGPDIFLSMCYRCPKEIVSTVSALVYNNKLLAKKELSGQCFKILY
KGNVTHDASSAINRPQLTFVKNFITANPAWSKAVFISPYNSQNAVARSMLGLTTQTVD
SSQGSEYQYVIFCQTADTAHANNINRFNVAITRAQKGILCVMTSQALFESLEFTELSF
TNYKLQSQIVTGLFKDCSRETSGLSPAYAPTYVSVDDKYKTSDELCVNLNLPANIPYS
RVISRMGFKLDATVPGYPKLFITREEAVRQVRSWIGFDVEGAHASRNACGTNVPLQLG
FSTGVNFVVQPVGVVDTEWGNMLTGIAARPPPGEQFKHLVPLMHKGAAWPIVRRRIVQ
MLSDTLDKLSDYCTFVCWAHGFELTSASYFCKIGKEQKCCMCNRRAAAYSSPLQSYAC
WTHSCGYDYVYNPFFVDVQQWGYVGNLATNHDRYCSVHQGAHVASNDAIMTRCLAIHS
CFIERVDWDIEYPYISHEKKLNSCCRIVERNVVRAALLAGSFDKVYDIGNPKGIPIVD
DPVVDWHYFDAQPLTRKVQQLFYTEDMASRFADGLCLFWNCNVPKYPNNAIVCRFDTR
VHSEFNLPGCDGGSLYVNKHAFHTPAYDVSAFRDLKPLPFFYYSTTPCEVHGNGSMIE
DIDYVPLKSAVCITACNLGGAVCRKHATEYREYMEAYNLVSASGFRLWCYKTFDIYNL
WSTFTKVQGLENIAFNVVKQGHFIGVEGELPVAVVNDKIFTKSGVNDICMFENKTTLP
TNIAFELYAKRAVRSHPDFKLLHNLQADICYKFVLWDYERSNIYGTATIGVCKYTDID
VNSALNICFDIRDNGSLEKFMSTPNAIFISDRKIKKYPCIVGPDYAYFNGAIIRDSDV
VKQPVKFYLYKKVNNEFIDPTECIYTQSRSCSDFLPLSDMEKDFLSFDSDVFIKKYGL
ENYAFEHVVYGDFSHTTLGGLHLLIGLYKKQQEGHIIMEEMLKGSSTIHNYFITETNT
AAFKAVCSVIDLKLDDFVMILKSQDLGVVSKVVKVPIDLTMIEFMLWCKDGQVQTFYP
RLQASADWKPGHAMPSLFKVQNVNLERCELANYKQSIPMPRGVHMNIAKYMQLCQYLN
TCTLAVPANMRVIHFGAGSDKGIAPGTSVLRQWLPTDAIIIDNDLNEFVSDADITLFG
DCVTVRVGQQVDLVISDMYDPTTKNVTGSNESKALFFTYLCNLINNNLALGGSVAIKI
TEHSWSVELYELMGKFAWWTVFCTNANASSSEGFLLGINYLGTIKENIDGGAMHANYI
FWRNSTPMNLSTYSLFDLSKFQLKLKGTPVLQLKESQINELVISLLSQGKLLIRDNDT
LSVSTDVLVNTYRKLR"
CDS 279..13454
/gene="orf1ab"
/codon_start=1
/product="ORF1a protein"
/protein_id="AKK52591.1"
/db_xref="GI:828436866"
/translation="MSFVAGVIAQGARGTYRAALNSEKHQDHVSLTVPLCGSGNLVEK
LSPWFMDGENAYEVVKAMLLKKEPLLYVPIRLAGHTRHLPGPRVYLVERLIACENPFM
VNQLAYSSSANGSLVGTTLQGKPIGMFFPYDIELVTGKQNILLRKYGRGGYHYTPVHY
ERDNTSCPEWMDDFEADPKGKYAQNLLKKLIGGDVTPVDQYMCGVDGKPISAYAFLMA
KDGITKLADVEADVAARADDEGFITLKNNLYRLVWHVERKDVPYPKQSIFTINSVVQK
DGVENTPPHYFTLGCKILTLTPRNKWSGVSDLSLKQKLLYTFYGKESLENPTYIYHSA
FIECGSCGNDSWLTGNAIQGFACGCGASYTANDVEVQSSGMIKPNALLCATCPFAKGD
SCSSNCKHSVAQLVSYLSERCNVIADSKSFTLIFGGVAYAYFGCEEGTMYFVPRAKSV
VSRIGDSIFTGCTGSWNKVTQIANMFLEQTQHSLNFVGEFVVNDVVLAILSGTTTNVD
KIRQLLKGVTIDKLRDYLADYDVAVTAGPFMDNAINVGGTGLQYAAITAPYVVLTGLG
ESFKKVATIPYKVCNSVKDTLTYYAHSVLYRVFPYDMDSGVSSFSELLFDCVDLSVAS
TYFLVRLLQDKTGDFMSTIITSCQTAVSKLLDTCFEATEATFNFLLDLAGLFRIFLRN
AYVYTSQGFVVVNGKVSTLVKQVLDLLNKGMQLLHTKVSWAGSNISAVIYSGRESLIF
PSGTYYCVTTKAKSVQQDLDVILPGEFSKKQLGLLQPTDNSTTVSVTVSSNMVETVVG
QLEQTNMHSPDVIVGDYVIISEKLFVRSKEEDGFAFYPACTNGHAVPTLFRLKGGAPV
KKVAFGGDQVHEVAAVRSVTVEYNIHAVLDTLLASSSLRTFVVDKSLSIEEFADVVKE
QVSDLLVKLLRGMPIPDFDLDDFIDAPCYCFNAEGDASWSSTMIFSLHPVECDEECSE
VEASDLEEGESECISETSTEQVDVSHEVSDDEWAAAVDEAFPLDEAEDVTESVQEEAQ
PVEVPVEDIAQVVIADTLQETPVVSDTVEVPPQVVKLPSEPQTIQPEVKEVAPVYEAD
TEQTQSVTVKPKRLRKKRNVDPLSNFEHKVITECVTIVLGDAIQVAKCYGESVLVNAA
NTHLKHGGGIAGAINAASKGAVQKESDEYILAKGPLQVGDSVLLQGHSLAKNILHVVG
PDARAKQDVSLLSKCYKAMNAYPLVVTPLVSTGIFGVKPAVSFDYLIREAKTRVLVVV
NSQDVYKSLTIVDIPQSLTFSYDGLRGAIRKAKDYGFTVFVCTDNSANTKVLRNKGVD
YTKKFLTVDGVQYYCYTSKDTLDDILQQANKSVGIISMPLGYVSHGLDLIQAGSVVRR
VNVPYVCLLANKEQEAILMSEDVKLNPSEDFIKHVRTNGGYNSWHLVEGELLVQDLRF
NKLLHWSDQTICYKDSVFYVVKNSTAFPFETLSACRAYLDSRTTQQLTIEVLVTVDGV
NFRTVVLNNKNTYRSQLGCVFFNGADISDTIPDEKQNGHSLYLADNLTADETKALKEL
YGPVDPTFLHRFYSLKAAVHKWKMVVCDKVRSLKLSDNNCYLNAVIMTLDLLKDIKFV
IPALQHAFMKHKGGDSTDFIALIMAYGNCTFGAPDDASRLLHTVLAKAELCCSARMVW
REWCNVCGIKDVVLQGLKACCYVGVQTVEDLRARMTYVCQCGGERHRQIVEHTTPWLL
LSGTPNEKLVTTSTAPDFVAFNVFQGIETAVGHYVHARLKGGLILKFDSGTVSKTSDW
KCKVTDVLFPGQKYSSDCNVVRYSLDGNFRTEVDPDLSAFYVKDGKYFTSEPPVTYSP
ATILAGSVYTNSCLVSSDGQPGGDAISLSFNNLLGFDSSKPVTKKYTYSFLPKEDGDV
LLAEFDTYDPIYKNGAMYKGKPILWVNKASYDTNLNKFNRASLRQIFDVAPIELENKF
TPLSVASTPVEPPTVDVVALQQEMTIVKCKGLNKPFVKDNVSFVVDDSGTPVVEYLSK
EDLHTLYVDPKYQVIVLKDNVLSSMLRLHTVESGDINVVAASGSLTRKVKLLFRASFY
FKEFATRTFTATTAVGSCIKSVVRHLGVTKGILTGCFSFVKMLFILPLAYFSDSKLGT
TEVKVSALKTAGVVTGNVVKQCCTAAVDLSMDKLRRVDWKSTLRLLLMLCTTMVLLSS
VYHLYVFNQVLSSDVMFEDAQGLKKFYKEVRAYLGISSACDGLASAYRANSFDVPTFC
ANRSAMCNWCLISQDSITHYPALKMVQTHLSHYVLNIDWLWFAFETGLAYMLYTSAFN
WLLLAGTLHYFFAQTSIFVDWRSYNYAVSSAFWLFTHIPMAGLVRMYNLLACLWLLRK
FYQHVINGCKDTACLLCYKRNRLTRVEASTVVCGGKRTFYITANGGISFCRRHNWNCV
DCDIAGVGNTFICEEVANDLTTALRRPINATDRSHYYVDSVTVKETVVQFNYRRDGQP
FYERFPLCAFTNLDKLKFKEVCKTTTGIPEYNFIIYDSSDRGQESLARSACVYYSQVL
CKSILLVDSSLVTSVGDSSEIATKMFDSFVNSFVSLYNVTRDKLEKLISTARDGVRRG
DNFHSVLTTFIDAARGPAGVESDVETNEIVDSVQYAHKHDIQITNESYNNYVPSYVKP
DSVSTSDLGSLIDCNAASVNQIVLRNSNGACIWNAAAYMKLSDALKRQIRIACRKCNL
AFRLTTSKLRANDNILSVRFTANKIVGGAPTWFNVLRDFTLKGYVLATIIVFLCAVLM
YLCLPTFSMVPVEFYEDRILDFKVLDNGIIRDVNPDDKCFANKHRSFTQWYHEHVGGV
YDNSITCPLTVAVIAGVAGARIPDVPTTLAWVNNQIIFFVSRVFANTGSVCYTPIDEI
PYKSFSDSGCILPSECTMFRDAEGRMTPYCHDPTVLPGAFAYSQMRPHVRYDLYDGNM
FIKFPEVVFESTLRITRTLSTQYCRFGSCEYAQEGVCITTNGSWAIFNDHHLNRPGVY
CGSDFIDIVRRLAVSLFQPITYFQLTTSLVLGIGLCAFLTLLFYYINKVKRAFADYTQ
CAVIAVVAAVLNSLCICFVASIPLCIVPYTALYYYATFYFTNEPAFIMHVSWYIMFGP
IVPIWMTCVYTVAMCFRHFFWVLAYFSKKHVEVFTDGKLNCSFQDAASNIFVINKDTY
AALRNSLTNDAYSRFLGLFNKYKYFSGAMETAAYREAAACHLAKALQTYSETGSDLLY
QPPNCSITSGVLQSGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCP
ADQLSDPNYDALLISMTNHSFSVQKHIGAPANLRVVGHAMQGTLLKLTVDVANPSTPA
YTFTTVKPGAAFSVLACYNGRPTGTFTVVMRPNYTIKGSFLCGSCGSVGYTKEGSVIN
FCYMHQMELANGTHTGSAFDGTMYGAFMDKQVHQVQLTDKYCSVNVVAWLYAAILNGC
AWFVKPNRTSVVSFNEWALANQFTEFVGTQSVDMLAVKTGVAIEQLLYAIQQLYTGFQ
GKQILGSTMLEDEFTPEDVNMQIMGVVMQSGVRKVTYGTAHWLFATLVSTYVIILQAT
KFTLWNYLFETIPTQLFPLLFVTMAFVMLLVKHKHTFLTLFLLPVAICLTYANIVYEP
TTPISSALIAVANWLAPTNAYMRTTHTDIGVYISMSLVLVIVVKRLYNPSLSNFALAL
CSGVMWLYTYSIGEASSPIAYLVFVTTLTSDYTITVFVTVNLAKVCTYAIFAYSPQLT
LVFPEVKMILLLYTCLGFMCTCYFGVFSLLNLKLRAPMGVYDFKVSTQEFRFMTANNL
TAPRNSWEAMALNFKLIGIGGTPCIKVAAMQSKLTDLKCTSVVLLSVLQQLHLEANSR
AWAFCVKCHNDILAATDPSEAFEKFVSLFATLMTFSGNVDLDALASDIFDTPSVLQAT
LSEFSHLATFAELEAAQKAYQEAMDSGDTSPQVLKALQKAVNIAKNAYEKDKAVARKL
ERMADQAMTSMYKQARAEDKKAKIVSAMQTMLFGMIKKLDNDVLNGIISNARNGCIPL
SVIPLCASNKLRVVIPDFTVWNQVVTYPSLNYAGALWDITVINNVDNEIVKSSDVVDS
NENLTWPLVLECTRASTSAVKLQNNEIKPSGLKTMVVSAGQEQTNCNTSSLAYYEPVQ
GRKMLMALLSDNAYLKWARVEGKDGFVSVELQPPCKFLIAGPKGPEIRYLYFVKNLNN
LHRGQVLGHIAATVRLQAGSNTEFASNSSVLSLVNFTVDPQKAYLDFVNAGGAPLTNC
VKMLTPKTGTGIAISVKPESTADQETYGGASVCLYCRAHIEHPDVSGVCKYKGKFVQI
PAQCVRDPVGFCLSNTPCNVCQYWIGYGCNCDSLRQVALPQSKDSNFLNESGVLL"
gene 21456..25517
/gene="S"
CDS 21456..25517
/gene="S"
/codon_start=1
/product="S protein"
/protein_id="AKK52592.1"
/db_xref="GI:828436867"
/translation="MIHSVFLLMFLLTPTESYVDVGPDSVKSACIEVDIQQTFFDKTW
PRPIDVSKADGIIYPQGRTYSNITITYQGLFPYQGDHGDMYVYSAGHATGTTPQKLFV
ANYSQDVKQFANGFVVRIGAAANSTGTVIISPSTSATIRKIYPAFMLGSSVGNFSDGK
MGRFFNHTLVLLPDGCGTLLRAFYCILEPRSGNHCPAGNSYTSFATYHTPATDCSDGN
YNRNASLNSFKEYFNLRNCTFMYTYNITEDEILEWFGITQTAQGVHLFSSRYVDLYGG
NMFQFATLPVYDTIKYYSIIPHSIRSIQSDRKAWAAFYVYKLQPLTFLLDFSVDGYIR
RAIDCGFNDLSQLHCSYESFDVESGVYSVSSFEAKPSGSVVEQAEGVECDFSPLLSGT
PPQVYNFKRLVFTNCNYNLTKLLSLFSVNDFTCSQISPAAIASNCYSSLILDYFSYPL
SMKSDLSVSSAGPISQFNYKQSFSNPTCLILATVPHNLTTITKPLKYSYINKCSRLLS
DDRTEVPQLVNANQYSPCVSIVPSTVWEDGDYYRKQLSPLEGGGWLVASGSTVAMTEQ
LQMGFGITVQYGTDTNSVCPKLEFANDTKIASQLGNCVEYSLYGVSGRGVFQNCTAVG
VRQQRFVYDAYQNLVGYYSDDGNYYCLRACVSVPVSVIYDKETKTHATLFGSVACEHI
SSTMSQYSRSTRSMLKRRDSTYGPLQTPVGCVLGLVNSSLFVEDCKLPLGQSLCALPD
TPSTLTPRSVRSVPGEMRLASIAFNHPIQVDQLNSSYFKLSIPTNFSFGVTQEYIQTT
IQKVTVDCKQYVCNGFQKCEQLLREYGQFCSKINQALHGANLRQDDSVRNLFASVKSS
QSSPIIPGFGGDFNLTLLEPVSISTGSRSARSAIEDLLFDKVTIADPGYMQGYDDCMQ
QGPASARDLICAQYVAGYKVLPPLMDVNMEAAYTSSLLGSIAGVGWTAGLSSFAAIPF
AQSIFYRLNGVGITQQVLSENQKLIANKFNQALGAMQTGFTTTNEAFRKVQDAVNNNA
QALSKLASELSNTFGAISASIGDIIQRLDVLEQDAQIDRLINGRLTTLNAFVAQQLVR
SESAALSAQLAKDKVNECVKAQSKRSGFCGQGTHIVSFVVNAPNGLYFMHVGYYPSNH
IEVVSAYGLCDAANPTNCIAPVNGYFIKTNNTRIVDEWSYTGSSFYAPEPITSLNTKY
VAPQVTYQNISTNLPPPLLGNSTGIDFQDELDEFFKNVSTSIPNFGSLTQINTTLLDL
TYEMLSLQQVVKALNESYIDLKELGNYTYYNKWPWYIWLGFIAGLVALALCVFFILCC
TGCGTNCMGKLKCNRCCDRYEEYDLEPHKVHVH"
gene 25532..25843
/gene="ns3a"
CDS 25532..25843
/gene="ns3a"
/codon_start=1
/product="NS3a protein"
/protein_id="AKK52593.1"
/db_xref="GI:828436868"
/translation="MRVQRPPTLLLVFSLSFLVTAFSKPLYVPEHCQNYSGCMLRACI
KTAQADTAGLYTNFRIDVPSAESTGTQSVSVDRESTSTHDGLTEHVTSVNLFDVGYSV
N"
gene 25852..26181
/gene="ns3b"
CDS 25852..26181
/gene="ns3b"
/codon_start=1
/product="NS3b protein"
/protein_id="AKK52594.1"
/db_xref="GI:828436869"
/translation="MDYVSLLNQIWQKYLNSPYTTCLYIPKPTAKYTPLVGTSLHPVL
WNCQLSFAGYTESAVNSTKALAKQDAAQRIAWLLHKDGGIPDGCSLYLRHSSLFAQSE
EEESFSN"
gene 26093..26833
/gene="ns3c"
CDS 26093..26833
/gene="ns3c"
/codon_start=1
/product="NS3c protein"
/protein_id="AKK52595.1"
/db_xref="GI:828436870"
/translation="MEESLTDVPSTSGTQVYSRKARKRSHSPTKKLRYVKRRFSLLRP
EDLSVIVQPTHYVRVTFSDPNMWYLRSGHHLHSVHNWLKPYGGQPVSEYHITLALLNL
TDEDLARDFSPIALFLRNVRFELHEFALLRKTLVLNASEIYCANIHRFKPVYRVNTAI
PTIKDWLLVQGFSLYHSGLPLHMSISKLHALDDVTRNYIITMPCFRTYPQQMFVTPLA
VDVVSIRSSNQGNKQIVHSYPILHHPGF"
gene 26840..27514
/gene="ns3d"
CDS 26840..27514
/gene="ns3d"
/codon_start=1
/product="NS3d protein"
/protein_id="AKK52596.1"
/db_xref="GI:828436871"
/translation="MAFSASLFKPVQLVPVSPAFHRIESTDSIVFTYIPASGYVAALA
VNVCLIPLLLLLRQDTCRRSIIRTMVLYFLVLYNFLLAIVLVNGVHYPTGSCLIAFLV
ILIILWFVDRIRFCLMLNSYIPLFDMRSHFIRVSTVSSHGMVPVIHTKPLFIRNFDQR
CSCSRCFYLHSSTYIECTYISRFSKISLVSVTDFSLNGNVSTVFVPATRDSVPLHIIA
PSSLIV"
gene 27590..27838
/gene="E"
CDS 27590..27838
/gene="E"
/codon_start=1
/product="E protein"
/protein_id="AKK52597.1"
/db_xref="GI:828436872"
/translation="MLPFVQERIGLFIVNFFIFTVVCAITLLVCMAFLTATRLCVQCM
TGFNTLLVQPALYLYNTGRSVYVKFQDSKPPLPPDEWV"
gene 27853..28512
/gene="M"
CDS 27853..28512
/gene="M"
/codon_start=1
/product="M protein"
/protein_id="AKK52598.1"
/db_xref="GI:828436873"
/translation="MSNMTQLTEAQIIAIIKDWNFAWSLIFLLITIVLQYGYPSRSMT
VYVFKMFVLWLLWPSSMALSIFSAIYPIDLASQIISGIVAAVSAMMWISYFVQSIRLF
MRTGSWWSFNPETNCLLNVPIGGTTVVRPLVEDSTSVTAVVTNGHLKMAGMHFGACDY
DRLPNEVTVAKPNVLIALKMVKRQSYGTNSGVAIYHRYKAGNYRSPPITADIELALLR
A"
gene 28566..29807
/gene="N"
CDS 28566..29807
/gene="N"
/codon_start=1
/product="N protein"
/protein_id="AKK52599.1"
/db_xref="GI:828436874"
/translation="MASPAAPCAVSFADNNDITNTNLSRGRGRNPKPRAAPNNTVSWY
TGLTQHGKVPLTFPPGQGVPLNANSTPAQNAGYWRRQDRKINTGNGIKQLAPRWYFYY
TGTGPEAALPFRAVKDGIVWVHEDGATDAPSTFGTRNPNNDSAIVTQFAPGTKLPKNF
HIEGTGGNSQSSSRASSVSRNSSRSSSQGSRSGNSTRGTSPGPSGIGAVGGDLLYLDL
LNRLQALESGKVKQSQPKVITKKDAAAAKNKMRHKRTSTKSFNMVQAFGLRGPGDLQG
NFGDLQLNKLGTEDPRWPQIAELAPTASAFMGMSQFKLTHQNNDDHGNPVYFLRYSGA
IKLDPKNPNYNKWLELLEQNIDAYKTFPKKEKKQKAPKEESTDQMSEPPKEQRVQGSI
TQRTRTRPSVQPGPMIDVNTD"

_________________
www.twitter.com/hniman


Top
 Profile  
 
Display posts from previous:  Sort by  
Post new topic Reply to topic  [ 17 posts ]  Go to page 1, 2  Next

All times are UTC - 5 hours [ DST ]


Who is online

Users browsing this forum: No registered users and 58 guests


You cannot post new topics in this forum
You cannot reply to topics in this forum
You cannot edit your posts in this forum
You cannot delete your posts in this forum
You cannot post attachments in this forum

Search for:
Jump to:  
cron
Powered by phpBB® Forum Software © phpBB Group