Rhiza Labs FluTracker Forum

The place to discuss the flu
It is currently Wed Oct 18, 2017 1:44 am

All times are UTC - 5 hours [ DST ]




Post new topic Reply to topic  [ 6 posts ] 
Author Message
PostPosted: Mon Jun 08, 2015 8:03 pm 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
Although the full sequence from isolate MERS-CoV/KOR/KNIH/002_05_2015 has not been made public, a preliminary analysis notes 22 differences between the above sequence and the initial Guangdong sequence, including two non-synonymous changes in the spike protein. However, the Chinese CDC has issued a revised sequence which does not contain these two changes. The revised sequence is 99.97% identical to the original nucleotide sequence.

The consensus sequence is closely related to Feb/Mar 2015 sequences from cases in Riyadh, but is unique enough to keep the country of origin unclear.

However, the Riyadh sequences as well as the Korea/China sequences have obvious recombination, leading to significant differences with prior sequences.

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Mon Jun 08, 2015 8:05 pm 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
Preliminary analysis of Middle East respiratory syndrome coronavirus (MERS-CoV) sequences from
Korea and China
8 June 2015
Prepared by members of the WHO-convened "Laboratory Experts for MERS-CoV" with additional data
from several research groups (see complete contributors listing in Appendix).
Recent Middle East respiratory syndrome (MERS) cases in Korea and China are thought to have
originated from a virus carried by a traveller returning from the Middle East after visits to the Kingdom
of Saudi Arabia (KSA), Bahrain, the United Arabic Emirates and Qatar. A MERS-CoV sequence from a
patient in Guangdong has been produced by the Chinese CDC (GenBank KT006149) and the MERSCoV
sequence from a patient in Korea (MERS-CoV/KOR/KNIH/002_05_2015, submitted to GenBank)
has been produced by the Korea National Institute of Health and Seoul National University.
A preliminary analysis of the two viral genomes supports the following conclusions:
1. A strict consensus of the Korean and Chinese MERS-CoV sequences clusters closest with viruses
obtained from a recent outbreak in Riyadh in February-March 2015 (1) (Figure 1). The Chinese and
Korean viruses are however divergent enough from the Riyadh 2015 cluster to potentially be derived
from a separate zoonotic event in the Arabian Peninsula. Given the travel history of the Korean index
patient (2) to other countries with recent MERS-CoV cases, the originating country cannot be
determined with certainty. From these data the new MERS-CoVs are unlikely to be phenotypically
different from the MERS-CoV currently circulating in the Arabian Peninsula and are unlikely to present
different virulence or transmission properties. However, further clinical, epidemiological and virus
genetic data will be required to be certain of these preliminary conclusions. In addition, there is an
urgency to increase sequencing efforts in all countries where MERS-CoV is circulating. This will
increase our knowledge of transmission patterns and inform public health measures required to
prevent transmission.
2. The two currently available sequences from Korea and China are from patients with a direct
epidemiological link and as such are not expected to show many nucleotide differences. However, it is
important to note that the Korean sequence was obtained from a cell culture passaged virus while the
Chinese sequence was obtained by direct sequencing of patient swab material. In addition, different
error rates and profiles for the sequencing platforms used (Sanger and Ion Torrent for the Chinese
sequence versus Illumina for the Korean sequence) and differences in the assembly methods could
be a factor. We therefore assume that most of the 22 nucleotide differences between the Korean and
Chinese sequences are the result of these technical issues. Further sequencing will clarify this. These
considerations led us to use a strict consensus sequence in the analyses above.
2
3. No shared amino changes in the encoded spike were observed between the Korean and Chinese
sequences. If there was a more transmissible virus emerging in Korea/China and this was due to a
new spike variant, then one would expect the changes to be shared by the two sequences. This was
not observed. Additional sequencing of patient samples in Korea will help to resolve the sequence
diversity within this cluster.
References
1. Somily A, Barry M, Al Subaie SS, BinSaeed AA, Alzamil FA, Zaher W, Al Qahtani T, Al
Jerian K, McNabb SJN, Cotten M, Watson SJ, Binter S, Rambaut A, Kellam P. 2015. New MERSCoV
sequences Feb-Mar 2015 and preliminary analysis MERS coronavirus.
http://wwwvirologicalorg/t/new-mers-cov ... alysis/140.
2. ProMED-mail. 2015. South Korea, new contact cases, media report.
http://wwwpromedmailorg/directphp?id=201505223378310.
Figure Legend
Figure 1. Phylogenetic reconstruction of 171 available MERS CoV sequences. A strict consensus was
created between the Korean and Chinese sequences (marked in red with asterisk), recent virus
sequences from Riyadh (Riyadh KKUH 2015) are from (1) and viruses sequences from camels are
shown in orange. Colored boxes indicate previously-defined clades or lineages. The Al-Hasa hospital
outbreak is collapsed for clarity. Clade support is shown where the bootstrap support values were
greater than 75%. The scale bar is in units of substitutions/site. A maximum-likelihood phylogeny was
constructed from the alignment of 171 MERS CoV sequences using RAxML version 7.8.6 under a
GTR+G substitution model. Clade support was assessed by bootstrapping with 1000 pseudoreplicates.

http://virological.org/uploads/default/ ... 2b3eb8.pdf

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Mon Jun 08, 2015 8:09 pm 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
LOCUS KT006149 30114 bp RNA linear VRL 05-JUN-2015
DEFINITION Middle East respiratory syndrome coronavirus strain ChinaGD01,
complete genome.
ACCESSION KT006149
VERSION KT006149.1 GI:827491170
KEYWORDS .
SOURCE Middle East respiratory syndrome coronavirus (MERS-CoV)
ORGANISM Middle East respiratory syndrome coronavirus
Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA
stage; Nidovirales; Coronaviridae; Coronavirinae; Betacoronavirus;
unclassified Betacoronavirus.
REFERENCE 1 (bases 1 to 30114)
AUTHORS Lu,R., Nie,K., Ke,C., Zhao,Y., Wang,Y., Li,Y., Deng,Y., Wang,W.,
Zhang,Y., Zhou,W., Wang,H., Zou,L., Niu,P., Zhang,S., Wu,J.,
Wang,W., Wu,G., Ma,X. and Tan,W.
TITLE Phylogenetic Analysis of an Imported Middle East Respirtory
Syndrome Coronavirus Case in China
JOURNAL Unpublished
REFERENCE 2 (bases 1 to 30114)
AUTHORS Lu,R., Nie,K., Ke,C., Zhao,Y., Wang,Y., Li,Y., Deng,Y., Wang,W.,
Zhang,Y., Zhou,W., Wang,H., Zou,L., Niu,P., Zhang,S., Wu,J.,
Wang,W., Wu,G., Ma,X. and Tan,W.
TITLE Direct Submission
JOURNAL Submitted (03-JUN-2015) China CDC, National Institute for Viral
Disease Control and Prevention, 155 Changbai Road, ChangPing
District, Beijing, Beijing 102206, China
COMMENT [WARNING] On Jun 8, 2015 this sequence was replaced by
gi:828177937.

##Assembly-Data-START##
Assembly Method :: Seqman v. version5.0
Sequencing Technology :: IonTorrent; Sanger dideoxy sequencing
##Assembly-Data-END##
FEATURES Location/Qualifiers
source 1..30114
/organism="Middle East respiratory syndrome coronavirus"
/mol_type="genomic RNA"
/strain="ChinaGD01"
/isolation_source="nasopharyngeal swab"
/host="Homo sapiens"
/db_xref="taxon:1335626"
/country="China"
/collection_date="27-May-2015"
CDS join(273..13427,13427..21508)
/ribosomal_slippage
/codon_start=1
/product="ORF1ab"
/protein_id="AKJ80135.1"
/db_xref="GI:827491171"
/translation="MSFVAGVIAQGARGTYRAALNSEKHQDHVSLTVPLCGSGNLVEK
LSPWFMDGENAYEVVKAMLLKKEPLLYVPIRLAGHTRHLPGPRVYLVERLIACENPFM
VNQLAYSSSANGSLVGTTLQGKPIGMFFPYDIELVTGKQNILLRKYGRGGYHYTPVHY
ERDNTSCPEWMDDFEADPKGKYAQNLLKKLIGGDVTPVDQYMCGVDGKPISAYAFLMA
KDGITKLADVEADVAARADDEGFITLKNNLYRLVWHVERKDVPYPKQSIFTINSVVQK
DGVENTPPHYFTLGCKILTLTPRNKWSGVSDLSLKQKLLYTFYGKESLENPTYIYHSA
FIECGSCGNDSWLTGNAIQGFACGCGASYTANDVEVQSSGMIKPNALLCATCPFAKGD
SCSSNCKHSVAQLVSYLSERCNVIADSKSFTLIFGGVAYAYFGCEEGTMYFVPRAKSV
VSRIGDSIFTGCTGSWNKVTQIANMFLEQTQHSLNFVGEFVVNDVVLAILSGTTTNVD
KIRQLLKGVTIDKLRDYLADYDVAVTAGPFMDNAINVGGTGLQYAAITAPYVVLTGLG
ESFKKVATIPYKVCNSVKDTLTYYAHSVLYRVFPYDMDSGVSSFSELLFDCVDLSVAS
TYFLVRLLQDKTGDFMSTIITSCQTAVSKLLDTCFEATEATFNFLLDLAGLFRIFLRN
AYVYTSQGFVVVNGKVSTLVKQVLDLLNKGMQLLHTKVSWAGSNISAVIYSGRESLIF
PSGTYYCVTTKAKSVQQDLDVILPGEFSKKQLGLLQPTDNSTTVSVTVSSNMVETVVG
QLEQTNMHSPDVIVGDYVIISEKLFVRSKEEDGFAFYPACTNGHAVPTLFRLKGGAPV
KKVAFGGDQVHEVAAVRSVTVEYNIHAVLDTLLASSSLRTFVVDKSLSIEEFADVVKE
QVSDLLVKLLRGMPIPDFDLDDFIDAPCYCFNAEGDASWSSTMIFSLHPVECDEECSE
VEASGLEEGESECISETSTEQVDVSHEVSDDEWAAAVDEAFPLDEAEDVTESVQEEAQ
PVEVPVEDIAQVVIADTLQETPVVSDTVEVPPQVVKLPSEPQTIQPEVKEVAPVYEAD
TEQTQSVTVKPKRLRKKRNVDPLSNFEHKVITECVTIVLGDAIQVAKCYGESVLVNAA
NTHLKHGGGIAGAINAASKGAVQKESDEYILAKGPLQVGDSVLLQGHSLAKNILHVVG
PDARAKQDVSLLSKCYKAMNAYPLVVTPLVSAGIFGVKPAVSFDYLIREAKTRVLVVV
NSQDVYKSLTIVDIPQSLTFSYDGLRGAIRKAKDYGFTVFVCTDNSANTKVLRNKGVD
YTKKFLTVDGVQYYCYTSKDTLDDILQQANKSVGIISMPLGYVSHGLDLIQAGSVVRR
VNVPYVCLLANKEQEAILMSEDVKLNPSEDFIKHVRTNGGYNSWHLVEGELLVQDLRL
NKLLHWSDQTICYKDSVFYVVKNSTAFPFETLSACGAYLDSRTTQQLTIEVLVTVDGV
NFRTVVLNNKNTYRSQLGCVFFNGADISDTIPDEKQNGHSLYLADNLTADETKALKEL
YGPVDPTFLHRFYSLKAAVHKWKMVVCDKVRSLKLSDNNCYLNAVIMTLDLLKDIKFV
IPALQHAFMKHKGGDSTDFIALIMAYGNCTFGAPDDASRLLHTVLAKAELCCSARMVW
REWCNVCGIKDVVLQGLKACCYVGVQTVEDLRARMTYVCQCGGERHRQIVEHTTPWLL
LSGTPNEKLVTTSTAPDFVAFNVFQGIETAVGHYVHARLKGGLILKFDSGTVSKTSDW
KCKVTDVLFPGQKYSSDCNVVRYSLDGNFRTEVDPDLSAFYVKDGKYFTSEPPVTYSP
ATILAGSVYTNSCLVSSDGQPGGDAISLSFNNLLGFDSSKPVTKKYTYSFLPKEDGDV
LLAEFDTYDPIYKNGAMYKGKPILWVNKASYDTNLNKFNRASLRQIFDVPPIELENKF
TPLSVASTPVEPPTVDVVALQQEMTIVKCKGLNKPFGKDNVSFVVDDSGTPVVEYLSK
EDLHTLYVDPKYQVIVLKDNVLSSMLRLHTVESGDINVVAASGSLTRKVKLLFRASFY
FKEFATRTFTATTAVGSCIKSVVRHLGVTKGILTGCFSFVKMLFILPLAYFSDSKLGT
TEVKVSALKTAGVVTGNVVKQCCTAAVDLSMDKLRRVDWKSTLRLLLMLCTTMVLLSS
VYHLYVFNQVLSSDVMFEDAQGLKKFYKEVRAYLGISSACDGLASAYRANSFDVPTFC
ANRSAMCNWCLISQDSITHYPALKMVQTHLSHYVLNIDWLWFAFETGLAYMLYTSAFN
WLLLAGTLHYFFAQTSIFVDWRSYNYAVSSAFWLFTHIPMAGLVRMYNLLACLWLLRK
FYQHVINGCKDTACLLCYKRNRLTRVEASTVVCGGKRTFYITANGGISFCRRHNWNCV
DCDIAGVGNTFICEEVANDLTTALRRPINATDRSHYYVDSVTVKETVVQFNYRRDGQP
FYERFPLCAFTNLDKLKFKEVCKTTTGIPEYNFIIYDSSDRGQESLARSACVYYSQVL
CKSILLVDSSLVTSVGDSSEIATKMFDSFVNSFVSLYNVTRDKLEKLISTARDGVRRG
DNFHSVLTTFIDAARGPAGVESDVETNEIVDSVQYAHKHDIQITNESYNNYVPSYVKP
DSVSTSDLGSLIDCNAASVNQIVLRNSNGACIWNAAAYMKLSDALKRQIRIACRKCNL
AFRLTTSKLRANDNILSVRFTANKIVGGAPTWFNVLRDFTLKGYVLATIIVFLCAVLM
YLCLPTFSMVPVEFYEDRILDFKVLDNGIIRDVNPDDKCFANKHRSFTQWYHEHVGGV
YDNSITCPLTVAVIAGVAGARIPDVPTTLAWVNNQIIFFVSRVFANTGSVCYTPIDEI
PYKSFSDSGCILPSECTMFMDAEGRMTPYCHDPTVLPGAFAYSQMRPHVRYDLYDGNM
FIKFPEVVFESTLRITRTLSTQYCRFGSCEYAQEGVCITTNGSWAIFNDHHLNRPGVY
CGSDFIDIVRRLAVSLFQPITYFQLTTSLVLGIGLCAFLTLLFYYINKVKRAFADYTQ
CAVIAVVAAVLNSLCICFVASIPLCIVPYTALYYYATFYFTNEPAFIMHVSWYIMFGP
IVPIWMTCVYTVAMCFRHFFWVLAYFSKKHVEVFTDGKLNCSFQDAASNIFVINKDTY
AALRNSLTNDAYSRFLGLFNKYKYFSGAMETAAYREAAACHLAKALQTYSETGSDLLY
QPPNCSITSGVLQSGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCP
ADQLSDPNYDALLISMTNHSFSVQKHIGAPANLRVVGHAMQGTLLKLTVDVANPSTPA
YTFTTVKPGAAFSVLACYNGRPTGTFTVVMRPNYTIKGSFLCGSCGSVGYTKEGSVIN
FCYMHQMELANGTHTGSAFDGTMYGAFMDKQVHQVQLTDKYCSVNVVAWLYAAILNGC
AWFVKPNRTSVVSFNEWALANQFTEFVGTQSVDMLAVKTGVAIEQLLYAIQQLYTGFQ
GKQILGSTMLEDEFTPEDVNMQIMGVVMQSGVRKVTYGTAHWLFATLVSTYVIILQAT
KFTLWNYLFETIPTQLFPLLFVTMAFVMLLVKHKHTFLTLFLLPVAICLTYANIVYEP
TTPISSALIAVANWLAPTNAYMRTTHTDIGVYISMSLVLVIVVKRLYNPSLSNFALAL
CSGVMWLYTYSIGEASSPIAYLVFVTTLTSDYTITVFVTVNLAKVCTYAIFAYSPQLT
LVFPEVKMILLLYTCLGFMCTCYFGVFSLLNLKLRAPMGVYDFKVSTQEFRFMTANNL
TAPRNSWEAMALNFKLIGIGGTPCIKVAAMQSKLTDLKCTSVVLLSVLQQLHLEANSR
AWAFCVKCHNDILAATDPSEAFEKFVSLFATLMTFSGNVDLDALASDIFDTPSVLQAT
LSEFSHLATFAELEAAQKAYQEAMDSGDTSPQVLKALQKAVNIAKNAYEKDKAVARKL
ERMADQAMTSMYKQARAEDKKAKIVSAMQTMLFGMIKKLDNDVLNGIISNARNGCIPL
SVIPLCASNKLRVVIPDFTVWNQVVTYPSLNYAGALWDITVINNVDNEIVKSSDVVDS
NENLTWPLVLECTRASTSAVKLQNNEIKPSGLKTMVVSAGQEQTNCNTSSLAYYEPVQ
GRKMLMALLSDNAYLKWARVEGKDGFVSVELQPPCKFLIAGPKGPEIRYLYFVKNLNN
LHRGQVLGHIAATVRLQAGSNTEFASNSSVLSLVNFTVDPQKAYLDFVNAGGAPLTNC
VKMLTPKTGTGIAISVKPESTADQETYGGASVCLYCRAHIEHPDVSGVCKYKGKFVQI
PAQCVRDPVGFCLSNTPCNVCQYWIGYGCNCDSLRQVALPQSKDSNFLNRVRGSIVNA
RIEPCSSGLSTDVVFRAFDICNYKAKVAGIGKYYKTNTCRFVELDDQGHHLDSYFVVK
RHTMENYELEKHCYDLLRDCDAVAPHDFFIFDVDKVKTPHIVRQRLTEYTMMDLVYAL
RHFDQNSEVLKAILVKYGCCDVTYFENKLWFDFVENPSVIGVYHKLGERVRQAILNTV
KFCDHMVKAGLVGVLTLDNQDLNGKWYDFGDFVITQPGSGVAIVDSYYSYLMPVLSMT
DCLAAETHRDCDFNKPLIEWPLTEYDFTDYKVQLFEKYFKYWDQTYHANCVNCTDDRC
VLHCANFNVLFAMTMPKTCFGPIVRKIFVDGVPFVVSCGYHYKELGLVMNMDVSLHRH
RLSLKELMMYAADPAMHIASSNAFLDLRTSCFSVAALTTGLTFQTVRPGNFNQDFYDF
VVSKGFFKEGSSVTLKHFFFAQDGNAAITDYNYYSYNLPTMCDIKQMLFCMEVVNKYF
EIYDGGCLNASEVVVNNLDKSAGHPFNKFGKARVYYESMSYQEQDELFAMTKRNVIPT
MTQMNLKYAISAKNRARTVAGVSILSTMTNRQYHQKMLKSMAATRGATCVIGTTKFYG
GWDFMLKTLYKDVDNPHLMGWDYPKCDRAMPNMCRIFASLILARKHGTCCTTRDRFYR
LANECAQVLSEYVLCGGGYYVKPGGTSSGDATTAYANSVFNILQATTANVSALMGANG
NKIVDKEVKDMQFDLYVNVYRSTSPDPKFVDKYYAFLNKHFSMMILSDDGVVCYNSDY
AAKGYIAGIQNFKETLYYQNNVFMSEAKCWVETDLKKGPHEFCSQHTLYIKDGDDGYF
LPYPDPSRILSAGCFVDDIVKTDGTLMVERFVSLAIDAYPLTKHEDIEYQNVFWVYLQ
YIEKLYKDLTGHMLDSYSVMLCGDNSAKFWEEAFYRDLYSSPTTLQAVGSCVVCHSQT
SLRCGTCIRRPFLCCKCCYDHVIATPHKMVLSVSPYVCNAPGCGVSDVTKLYLGGMSY
FCVDHRPVCSFPLCANGLVFGLYKNMCTGSPSIVEFNRLATCDWTESGDYTLANTTTE
PLKLFAAETLRATEEASKQSYAIATIKEIVGERQLLLVWEAGKSKPPLNRNYVFTGYH
ITKNSKVQLGEYIFERIDYSDAVSYKSSTTYKLTVGDIFVLTSHSVATLTAPTIVNQE
RYVKITGLYPTITVPEEFASHVANFQKSGYSKYVTVQGPPGTGKSHFAIGLAIYYPTA
RVVYTACSHAAVDALCEKAFKYLNIAKCSRIIPAKARVECYDRFKVNETNSQYLFSTI
NALPETSADILVVDEVSMCTNYDLSIINARIKAKHIVYVGDPAQLPAPRTLLTRGTLE
PENFNSVTRLMCNLGPDIFLSMCYRCPKEIVSTVSALVYNNKLLAKKELSGQCFKILY
KGNVTHDASSAINRPQLTFVKNFITANPAWSKAVFISPYNSQNAVARSMLGLTTQTVD
SSQGSEYQYVIFCQTADTAHANNINRFNVAITRAQKGILCVMTSQALFESLEFTELSF
TNYKLQSQIVTGLFKDCSRETSGLSPAYAPTYVSVDDKYKTSDELCVNLNLPANIPYS
RVISRMGFKLDATVPGYPKLFITREEAVRQVRSWIGFDVEGAHASRNACGTNVPLQLG
FSTGVNFVVQPVGVVDTEWGNMLTGIAARPPPGEQFKHLVPLMHKGAAWPIVRRRIVQ
MLSDTLDKLSDYCTFVCWAHGFELTSASYFCKIGKEQKCCMCNRRAAAYSSPLQSYAC
WTHSCGYDYVYNPFFVDVQQWGYVGNLATNHDRYCSVHQGAHVASNDAIMTRCLAIHS
CFIERVDWDIEYPYISHEKKLNSCCRIVERNVVRAALLAGSFDKVYDIGNPKGIPIVD
DPVVDWHYFDAQPLTRKVQQLFYTEDMASRFADGLCLFWNCNVPKYPNNAIVCRFDTR
VHSEFNLPGCDGGSLYVNKHAFHTPAYDVSAFRDLKPLPFFYYSTTPCEVHGNGSMIE
DIDYVPLKSAVCITACNLGGAVCRKHATEYREYMEAYNLVSASGFRLWCYKTFDIYNL
WSTFTKVQGLENIAFNVVKQGHFIGVEGELPVAVVNDKIFTKSGVNDICMFENKTTLP
TNIAFELYAKRAVRSHPDFKLLHNLQADICYKFVLWDYERSNIYGTATIGVCKYTDID
VNSALNICFDIRDNGSLEKFMSTPNAIFISDRKIKKYPCIVGPDYAYFNGAIIRDSDV
VKQPVKFYLYKKVNNEFIDPTECIYTQSRSCSDFLPLSDMEKDFLSFDSDVFIKKYGL
ENYAFEHVVYGDFSHTTLGGLHLLIGLYKKQQEGHIIMEEMLKGSSTIHNYFITETNT
AAFKAVCSVIDLKLDDFVMILKSQDLGVVSKVVKVPIDLTMIEFMLWCKDGQVQTFYP
RLQASADWKPGHAMPSLFKVQNVNLERCELANYKQSIPMPRGVHMNIAKYMQLCQYLN
TCTLAVPANMRVIHFGAGSDKGIAPGTSVLRQWLPTDAIIIDNDLNEFVSDADITLFG
DCVTVRVSQQVDLVISDMYDPTTKNVTGSNESKALFFTYLCNLINNNLALGGSVAIKI
TEHSWSVELYELMGKFAWWTVFCTNANASSSEGFLLGINYLGTIKENIDGGAMHANYI
FWRNSTPMNLSTYSLFDLSKFQLKLKGTPVLQLKESQINELVISLLSQGKLLIRDNDT
LSVSTDVLVNTYRKLR"
CDS 273..13448
/codon_start=1
/product="ORF1a"
/protein_id="AKJ80136.1"
/db_xref="GI:827491172"
/translation="MSFVAGVIAQGARGTYRAALNSEKHQDHVSLTVPLCGSGNLVEK
LSPWFMDGENAYEVVKAMLLKKEPLLYVPIRLAGHTRHLPGPRVYLVERLIACENPFM
VNQLAYSSSANGSLVGTTLQGKPIGMFFPYDIELVTGKQNILLRKYGRGGYHYTPVHY
ERDNTSCPEWMDDFEADPKGKYAQNLLKKLIGGDVTPVDQYMCGVDGKPISAYAFLMA
KDGITKLADVEADVAARADDEGFITLKNNLYRLVWHVERKDVPYPKQSIFTINSVVQK
DGVENTPPHYFTLGCKILTLTPRNKWSGVSDLSLKQKLLYTFYGKESLENPTYIYHSA
FIECGSCGNDSWLTGNAIQGFACGCGASYTANDVEVQSSGMIKPNALLCATCPFAKGD
SCSSNCKHSVAQLVSYLSERCNVIADSKSFTLIFGGVAYAYFGCEEGTMYFVPRAKSV
VSRIGDSIFTGCTGSWNKVTQIANMFLEQTQHSLNFVGEFVVNDVVLAILSGTTTNVD
KIRQLLKGVTIDKLRDYLADYDVAVTAGPFMDNAINVGGTGLQYAAITAPYVVLTGLG
ESFKKVATIPYKVCNSVKDTLTYYAHSVLYRVFPYDMDSGVSSFSELLFDCVDLSVAS
TYFLVRLLQDKTGDFMSTIITSCQTAVSKLLDTCFEATEATFNFLLDLAGLFRIFLRN
AYVYTSQGFVVVNGKVSTLVKQVLDLLNKGMQLLHTKVSWAGSNISAVIYSGRESLIF
PSGTYYCVTTKAKSVQQDLDVILPGEFSKKQLGLLQPTDNSTTVSVTVSSNMVETVVG
QLEQTNMHSPDVIVGDYVIISEKLFVRSKEEDGFAFYPACTNGHAVPTLFRLKGGAPV
KKVAFGGDQVHEVAAVRSVTVEYNIHAVLDTLLASSSLRTFVVDKSLSIEEFADVVKE
QVSDLLVKLLRGMPIPDFDLDDFIDAPCYCFNAEGDASWSSTMIFSLHPVECDEECSE
VEASGLEEGESECISETSTEQVDVSHEVSDDEWAAAVDEAFPLDEAEDVTESVQEEAQ
PVEVPVEDIAQVVIADTLQETPVVSDTVEVPPQVVKLPSEPQTIQPEVKEVAPVYEAD
TEQTQSVTVKPKRLRKKRNVDPLSNFEHKVITECVTIVLGDAIQVAKCYGESVLVNAA
NTHLKHGGGIAGAINAASKGAVQKESDEYILAKGPLQVGDSVLLQGHSLAKNILHVVG
PDARAKQDVSLLSKCYKAMNAYPLVVTPLVSAGIFGVKPAVSFDYLIREAKTRVLVVV
NSQDVYKSLTIVDIPQSLTFSYDGLRGAIRKAKDYGFTVFVCTDNSANTKVLRNKGVD
YTKKFLTVDGVQYYCYTSKDTLDDILQQANKSVGIISMPLGYVSHGLDLIQAGSVVRR
VNVPYVCLLANKEQEAILMSEDVKLNPSEDFIKHVRTNGGYNSWHLVEGELLVQDLRL
NKLLHWSDQTICYKDSVFYVVKNSTAFPFETLSACGAYLDSRTTQQLTIEVLVTVDGV
NFRTVVLNNKNTYRSQLGCVFFNGADISDTIPDEKQNGHSLYLADNLTADETKALKEL
YGPVDPTFLHRFYSLKAAVHKWKMVVCDKVRSLKLSDNNCYLNAVIMTLDLLKDIKFV
IPALQHAFMKHKGGDSTDFIALIMAYGNCTFGAPDDASRLLHTVLAKAELCCSARMVW
REWCNVCGIKDVVLQGLKACCYVGVQTVEDLRARMTYVCQCGGERHRQIVEHTTPWLL
LSGTPNEKLVTTSTAPDFVAFNVFQGIETAVGHYVHARLKGGLILKFDSGTVSKTSDW
KCKVTDVLFPGQKYSSDCNVVRYSLDGNFRTEVDPDLSAFYVKDGKYFTSEPPVTYSP
ATILAGSVYTNSCLVSSDGQPGGDAISLSFNNLLGFDSSKPVTKKYTYSFLPKEDGDV
LLAEFDTYDPIYKNGAMYKGKPILWVNKASYDTNLNKFNRASLRQIFDVPPIELENKF
TPLSVASTPVEPPTVDVVALQQEMTIVKCKGLNKPFGKDNVSFVVDDSGTPVVEYLSK
EDLHTLYVDPKYQVIVLKDNVLSSMLRLHTVESGDINVVAASGSLTRKVKLLFRASFY
FKEFATRTFTATTAVGSCIKSVVRHLGVTKGILTGCFSFVKMLFILPLAYFSDSKLGT
TEVKVSALKTAGVVTGNVVKQCCTAAVDLSMDKLRRVDWKSTLRLLLMLCTTMVLLSS
VYHLYVFNQVLSSDVMFEDAQGLKKFYKEVRAYLGISSACDGLASAYRANSFDVPTFC
ANRSAMCNWCLISQDSITHYPALKMVQTHLSHYVLNIDWLWFAFETGLAYMLYTSAFN
WLLLAGTLHYFFAQTSIFVDWRSYNYAVSSAFWLFTHIPMAGLVRMYNLLACLWLLRK
FYQHVINGCKDTACLLCYKRNRLTRVEASTVVCGGKRTFYITANGGISFCRRHNWNCV
DCDIAGVGNTFICEEVANDLTTALRRPINATDRSHYYVDSVTVKETVVQFNYRRDGQP
FYERFPLCAFTNLDKLKFKEVCKTTTGIPEYNFIIYDSSDRGQESLARSACVYYSQVL
CKSILLVDSSLVTSVGDSSEIATKMFDSFVNSFVSLYNVTRDKLEKLISTARDGVRRG
DNFHSVLTTFIDAARGPAGVESDVETNEIVDSVQYAHKHDIQITNESYNNYVPSYVKP
DSVSTSDLGSLIDCNAASVNQIVLRNSNGACIWNAAAYMKLSDALKRQIRIACRKCNL
AFRLTTSKLRANDNILSVRFTANKIVGGAPTWFNVLRDFTLKGYVLATIIVFLCAVLM
YLCLPTFSMVPVEFYEDRILDFKVLDNGIIRDVNPDDKCFANKHRSFTQWYHEHVGGV
YDNSITCPLTVAVIAGVAGARIPDVPTTLAWVNNQIIFFVSRVFANTGSVCYTPIDEI
PYKSFSDSGCILPSECTMFMDAEGRMTPYCHDPTVLPGAFAYSQMRPHVRYDLYDGNM
FIKFPEVVFESTLRITRTLSTQYCRFGSCEYAQEGVCITTNGSWAIFNDHHLNRPGVY
CGSDFIDIVRRLAVSLFQPITYFQLTTSLVLGIGLCAFLTLLFYYINKVKRAFADYTQ
CAVIAVVAAVLNSLCICFVASIPLCIVPYTALYYYATFYFTNEPAFIMHVSWYIMFGP
IVPIWMTCVYTVAMCFRHFFWVLAYFSKKHVEVFTDGKLNCSFQDAASNIFVINKDTY
AALRNSLTNDAYSRFLGLFNKYKYFSGAMETAAYREAAACHLAKALQTYSETGSDLLY
QPPNCSITSGVLQSGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCP
ADQLSDPNYDALLISMTNHSFSVQKHIGAPANLRVVGHAMQGTLLKLTVDVANPSTPA
YTFTTVKPGAAFSVLACYNGRPTGTFTVVMRPNYTIKGSFLCGSCGSVGYTKEGSVIN
FCYMHQMELANGTHTGSAFDGTMYGAFMDKQVHQVQLTDKYCSVNVVAWLYAAILNGC
AWFVKPNRTSVVSFNEWALANQFTEFVGTQSVDMLAVKTGVAIEQLLYAIQQLYTGFQ
GKQILGSTMLEDEFTPEDVNMQIMGVVMQSGVRKVTYGTAHWLFATLVSTYVIILQAT
KFTLWNYLFETIPTQLFPLLFVTMAFVMLLVKHKHTFLTLFLLPVAICLTYANIVYEP
TTPISSALIAVANWLAPTNAYMRTTHTDIGVYISMSLVLVIVVKRLYNPSLSNFALAL
CSGVMWLYTYSIGEASSPIAYLVFVTTLTSDYTITVFVTVNLAKVCTYAIFAYSPQLT
LVFPEVKMILLLYTCLGFMCTCYFGVFSLLNLKLRAPMGVYDFKVSTQEFRFMTANNL
TAPRNSWEAMALNFKLIGIGGTPCIKVAAMQSKLTDLKCTSVVLLSVLQQLHLEANSR
AWAFCVKCHNDILAATDPSEAFEKFVSLFATLMTFSGNVDLDALASDIFDTPSVLQAT
LSEFSHLATFAELEAAQKAYQEAMDSGDTSPQVLKALQKAVNIAKNAYEKDKAVARKL
ERMADQAMTSMYKQARAEDKKAKIVSAMQTMLFGMIKKLDNDVLNGIISNARNGCIPL
SVIPLCASNKLRVVIPDFTVWNQVVTYPSLNYAGALWDITVINNVDNEIVKSSDVVDS
NENLTWPLVLECTRASTSAVKLQNNEIKPSGLKTMVVSAGQEQTNCNTSSLAYYEPVQ
GRKMLMALLSDNAYLKWARVEGKDGFVSVELQPPCKFLIAGPKGPEIRYLYFVKNLNN
LHRGQVLGHIAATVRLQAGSNTEFASNSSVLSLVNFTVDPQKAYLDFVNAGGAPLTNC
VKMLTPKTGTGIAISVKPESTADQETYGGASVCLYCRAHIEHPDVSGVCKYKGKFVQI
PAQCVRDPVGFCLSNTPCNVCQYWIGYGCNCDSLRQVALPQSKDSNFLNESGVLL"
CDS 21450..25511
/codon_start=1
/product="S protein"
/protein_id="AKJ80137.1"
/db_xref="GI:827491173"
/translation="MIHSVFLLMFLLTPTESYVDVGPDSVKSACIEVDIQQTFFDKTW
PRPIDVSKADGIIYPQGRTYSNITITYQGLFPYQGDHGDMYVYSAGHATGTTPQKLFV
ANYSQDVKQFANGFVVRIGAAANSTGTVIISPSTSATIRKIYPAFMLGSSVGNFSDGK
MGRFFNHTLVLLPDGCGTLLRAFYCILEPRSGNHCPAGNSYTSFATYHTPATDCSDGN
YNRNASLNSFKEYFNLRNCTFMYTYNITEDEILEWFGITQTAQGVHLFSSRYVDLYGG
NMFQFATLPVYDTIKYYSIIPHSIRSIQSDRKAWAAFYVYKLQPLTFLLDFSVDGYIR
RAIDCGFNDLSQLHCSYESFDVESGVYSVSSFEAKPSGSVVEQAEGVECDFSPLLSGT
PPQVYNFKRLVFTNCNYNLTKLLSLFSVNDFTCSQISPAAIASNCYSSLILDYFSYPL
SMKSDLSVSSAGPISQFNYKQSFSNPTCLILATVPHNLTTITKPLKYSYINKCSRLLS
DDRTEVPQLVNANQYSPCVSIVPSTVWEDGDYYRKQLSPLEGGGWLVASGSTVAMTEQ
LQMGFGITVQYGTDTNSVCPKLEFANDTKIASQLGNCVEYSLYGVSGRGVFQNCTAVG
VRQQRFVYDAYQNLVGYYSDDGNYYCLRACVSVPVSVIYDKETKTHATLFGSVACEHI
SSTMSQYSRSTRSMLKRRDSTYGPLQTPVGCVLGLVNSSLFVEDCKLPLGQSLCALPD
TPSTLTPRSVRSVPGEMRLASIAFNHPIQVDQLNSSYFKLSIPTNFSFGVTQEYIQTT
IQKVTVDCKQYVCNGFQKCEQLLREYGQFCSKINQALHGANLRQDDSVRNLFASVKSS
QSSPIIPGFGGDFNLTLLEPVSISTGSRSARSAIEDLLFDKVTIADPGYMQGYDDCMQ
QGPASARDLICAQYVAGYKVLPPLMDVNMEAAYTSSLLGSIAGVGWTAGLSSFAAIPF
AQSIFYRLNGVGITQQVLSENQKLIANKFNQALGAMQTGFTTTNEAFRKVQDAVNNNA
QALSKLASELSNTFGAISASIGDIIQRLDVLEQDAQIDRLINGRLTTLNAFVAQQLVR
SESAALSAQLAKDKVNECVKAQSKRSGFCGQGTHIVSFVVNAPNGLYFMHVGYYPSNH
IEVVSAYGLCDAANPTNCIAPVNGYFIKTNNTRIVDEWSYTGSSFYEPEPITSLNTKY
VAPQATYQNISTNLPPPLLGNSTGIDFQDELDEFFKNVSTSIPNFGSLTQINTTLLDL
TYEMLSLQQVVKALNESYIDLKELGNYTYYNKWPWYIWLGFIAGLVALALCVFFILCC
TGCGTNCMGKLKCNRCCDRYEEYDLEPHKVHVH"
CDS 25526..25837
/codon_start=1
/product="ORF3"
/protein_id="AKJ80138.1"
/db_xref="GI:827491174"
/translation="MRVQRPPTLLLVFSLSFLVTAFSKPLYVPEHCQNYSGCMLRACI
KTAQADTAGLYTNFRIDVPSAESTGTQSVSVDRESTSTHDGLTEHVTSVNLFDVGYSV
N"
CDS 25846..26175
/codon_start=1
/product="ORF4a"
/protein_id="AKJ80139.1"
/db_xref="GI:827491175"
/translation="MDYVSLLNQIWQKYLNSPYTTCLYIPKPTAKYTPLVGTSLHPVL
WNCQLSFAGYTESAVNSTKALAKQDAAQRIAWLLHKDGGIPDGCSLYLRHSSLFAQSE
EEESFSN"
CDS 26087..26827
/codon_start=1
/product="ORF4b"
/protein_id="AKJ80140.1"
/db_xref="GI:827491176"
/translation="MEESLTDVPSTSGTQVYSRKARKRSHSPTKKLRYVKRRFSLLRP
EDLSVIVQPTHYVRVTFSDPNMWYLRSGHHLHSVHNWLKPYGGQPVSEYHITLALLNL
TDEDLARDFSPIALFLRNVRFELHEFALLRKTLVLNASEIYCANIHRFKPVYRVNTAI
PTIKDWLLVQGFSLYHSGLPLHMSISKLHALDDVTRNYIITMPCFRTYPQQMFVTPLA
VDVVSIRSSNQGNKQIVHSYPILHHPGF"
CDS 26834..27508
/codon_start=1
/product="ORF5"
/protein_id="AKJ80141.1"
/db_xref="GI:827491177"
/translation="MAFSASLFKPVQLVPVSPAFHRIESTDSIVFTYIPASGYVAALA
VNVCLIPLLLLLRQDTCRRSIIRTMVLYFLVLYNFLLAIVLVNGVHYPTGSCLIAFLV
ILIILWFVDRIRFCLMLNSYIPLFDMRSHFIRVSTVSSHGMVPVIHTKPLFIRNFDQR
CSCSRCFYLHSSTYIECTYISRFSKISLVSVTDFSLNGNVSTVFVPATRDSVPLHIIA
PSSLIV"
CDS 27584..27832
/codon_start=1
/product="E protein"
/protein_id="AKJ80142.1"
/db_xref="GI:827491178"
/translation="MLPFVQERIGLFIVNFFIFTVVCAITLLVCMAFLTATRLCVQCM
TGFNTLLVQPALYLYNTGRSVYVKFQDSKPPLPPDEWV"
CDS 27847..28506
/codon_start=1
/product="M protein"
/protein_id="AKJ80143.1"
/db_xref="GI:827491179"
/translation="MSNMTQLTEAQIIAIIKDWNFAWSLIFLLITIVLQYGYPSRSMT
VYVFKMFVLWLLWPSSMALSIFSAIYPIDLASQIISGIVAAVSAMMWISYFVQSIRLF
MRTGSWWSFNPETNCLLNVPIGGTTVVRPLVEDSTSVTAVVTNGHLKMAGMHFGACDY
DRLPNEVTVAKPNVLIALKMVKRQSYGTNSGVAIYHRYKAGNYRSPPITADIELALLR
A"
CDS 28560..29801
/codon_start=1
/product="N protein"
/protein_id="AKJ80144.1"
/db_xref="GI:827491180"
/translation="MASPAAPRAVSFADNNDITNTNLSRGRGRNPKPRAAPNNTVSWY
TGLTQHGKVPLTFPPGQGVPLNANSTPAQNAGYWRRQDRKINTGNGIKQLAPRWYFYY
TGTGPEAALPFRAVKDGIVWVHEDGATDAPSTFGTRNPNNDSAIVTQFAPGTKLPKNF
HIEGTGGNSQSSSRASSVSRNSSRSSSQGSRSGNSTRGTSPGPSGIGAVGGDLLYLDL
LNRLQALESGKVKQSQPKVITKKDAAAAKNKMRHKRTSTKSFNMVQAFGLRGPGDLQG
NFGDLQLNKLGTEDPRWPQIAELAPTASAFMGMSQFKLTHQNNDDHGNPVYFLRYSGA
IKLDPKNPNYNKWLELLEQNIDAYKTFPKKEKKQKAPKEESTDQMSEPPKEQRVQGSI
TQRTRTRPSVQPGPMIDVNTD"
CDS 28756..29094
/codon_start=1
/product="ORF8b"
/protein_id="AKJ80145.1"
/db_xref="GI:827491181"
/translation="MPIPPLRKMLGIGGDRTEKLIPGMELSNWLPGGTSTTLELDPKQ
HSHSGLLRMASFGSMKMAPLMLLQLLGRGTLTMIQLLLHNSRPVLSFLKTSTLRGLEA
IVNHLQEPLA"

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Mon Jun 08, 2015 8:10 pm 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
1 agtgaatagc ttggctatct cacttcccct cgttctcttg cagaactttg attttaacga
61 acttaaataa aagccctgtt gtttagcgta ttgttgcact tgtctggtgg gattgtggca
121 ttaatttgcc tgctcatcta ggcagtggac atatgctcaa cactgggtat aattctaatt
181 gaatactatt tttcagttag agcgtcgtgt ctcttgtacg tctcggtcac aatatacggt
241 ttcgtccggt gcgtggcaat tcggggcaca tcatgtcttt cgtggctggt gtgatcgcgc
301 aaggtgcgcg cggtacgtat cgagcagcgc tcaactctga aaaacatcaa gaccatgtgt
361 ctctaactgt gccactctgt ggttcaggaa acctggttga aaaactttca ccatggttca
421 tggatggcga aaatgcctat gaagtggtga aggccatgtt acttaaaaaa gagccacttc
481 tctatgtgcc catccggctg gctggacaca ctagacacct cccaggtcct cgtgtgtacc
541 tggttgagag gctcattgct tgtgaaaatc cattcatggt taaccaattg gcttatagct
601 ctagtgcaaa tggcagcctg gttggcacaa ctttgcaggg caagcctatt ggtatgttct
661 tcccttatga catcgaactt gtcacaggaa agcaaaatat tctcctgcgc aagtatggcc
721 gtggtggtta tcactacacc ccagtccact atgagcgaga caacacctct tgccctgagt
781 ggatggacga ttttgaggcg gatcctaaag gcaaatatgc ccagaatctg cttaagaagt
841 tgattggcgg tgatgtcact ccagttgacc aatacatgtg tggcgttgat ggaaaaccca
901 ttagtgccta cgcattttta atggccaagg atggaataac caaactggct gatgttgaag
961 cggacgtcgc agcacgtgct gatgacgaag gcttcatcac attaaagaac aatctatata
1021 gattggtttg gcatgttgag cgtaaagacg ttccatatcc taagcaatct atttttacta
1081 ttaatagtgt ggtccaaaag gatggtgttg aaaacactcc tcctcactat tttactcttg
1141 gatgcaaaat tttaacgctc accccacgca acaagtggag tggcgtttct gacttgtccc
1201 tcaaacaaaa actcctttac accttctatg gtaaggagtc acttgagaac ccaacctaca
1261 tttaccactc cgcattcatt gagtgtggaa gttgtggtaa tgattcctgg cttacaggga
1321 atgctatcca agggtttgcc tgtggatgtg gggcatcata tacagctaat gatgtcgaag
1381 tccaatcatc tggcatgatt aagccaaatg ctcttctttg tgctacttgc ccctttgcta
1441 agggtgacag ctgttcttct aattgcaaac attcagttgc tcagttggtt agttaccttt
1501 ctgaacgctg taatgttatt gctgattcta agtccttcac acttatcttt ggtggcgtag
1561 cttacgccta ctttggatgt gaggaaggta ctatgtactt tgtgcctaga gctaagtctg
1621 ttgtctcaag gattggagac tccatcttta caggctgtac tggctcttgg aacaaggtca
1681 ctcaaattgc taacatgttc ttggaacaga ctcagcattc ccttaacttt gtgggagagt
1741 tcgttgtcaa cgatgttgtc ctcgcaattc tctctggaac cacaactaat gttgacaaaa
1801 tacgccagct tctcaaaggt gtcaccattg acaagttgcg tgattattta gctgactatg
1861 acgtagcagt cactgccggc ccattcatgg ataatgctat taatgttggt ggtacaggat
1921 tacagtatgc cgccattact gcaccttatg tagttctcac tggcttaggt gagtccttta
1981 agaaagttgc aaccataccg tacaaggttt gcaactctgt taaggatact ctgacttatt
2041 atgctcacag cgtgttgtac agagtttttc cttatgacat ggattctggt gtgtcatcct
2101 ttagtgaact actttttgat tgcgttgatc tttcagtagc ttctacctat tttttagtcc
2161 gcctcttgca agataagact ggcgacttta tgtctacaat tattacttcc tgccaaactg
2221 ctgttagtaa gcttctagat acatgttttg aagctacaga agcaacattt aacttcttgt
2281 tagatttggc aggattgttc agaatctttc ttcgcaatgc ctatgtgtac acttcacaag
2341 ggtttgtggt ggtcaatggc aaagtttcta cacttgtcaa acaagtgtta gacttgctta
2401 ataagggtat gcaacttttg catacaaagg tctcctgggc tggttctaat atcagtgctg
2461 ttatctacag cggcagggag tctctaatat tcccatcggg aacctattac tgtgtcacca
2521 ctaaggctaa gtccgttcaa caagatcttg acgttatttt gcctggtgag ttttccaaga
2581 agcagttagg actgctccaa cctactgaca attctacaac tgttagtgtt actgtatcca
2641 gtaacatggt tgaaactgtt gtgggtcaac ttgagcaaac taatatgcat agtcctgatg
2701 ttatagtagg tgactatgtc attattagtg aaaaattgtt tgtgcgtagt aaggaagaag
2761 acggattcgc cttctaccct gcttgcacta atggtcatgc tgtaccgact ctctttagac
2821 ttaagggagg tgcacctgta aaaaaagtag cctttggcgg tgatcaagta catgaggttg
2881 ctgctgtaag aagtgttact gtcgagtaca acattcatgc tgtattagac acactacttg
2941 cttcttctag tcttagaacc tttgttgtag ataagtcttt gtcaattgag gagtttgctg
3001 acgtagtaaa ggaacaagtc tcagacttgc ttgttaaatt actgcgtgga atgccgattc
3061 cagattttga tttagacgat tttattgacg caccatgcta ttgctttaac gctgagggtg
3121 atgcatcttg gtcttctact atgatcttct ctcttcaccc cgtcgagtgt gacgaggagt
3181 gttctgaagt agaggcttca ggtttagaag aaggtgaatc agagtgcatt tctgagactt
3241 caactgaaca agttgacgtt tctcatgagg tttctgacga cgagtgggct gctgcagttg
3301 atgaagcgtt ccccctcgat gaagcagaag atgttactga atctgtgcaa gaagaagcac
3361 aaccagtaga agtacctgtt gaagatattg cgcaggttgt catagctgac accttacagg
3421 aaactcctgt tgtgtctgat actgttgaag tcccaccgca agtggtgaaa cttccgtctg
3481 aacctcagac tatccagccc gaggtaaaag aagttgcacc tgtctatgag gctgataccg
3541 aacagacaca gagtgttact gttaaaccta agaggttacg caaaaagcgt aatgttgacc
3601 ctttgtccaa ttttgaacat aaggttatta cagagtgcgt taccatagtt ttaggtgacg
3661 caattcaagt agccaagtgc tatggggagt ctgtgttagt taatgctgct aacacacatc
3721 ttaagcatgg cggtggtatc gctggtgcta ttaatgcggc ttcaaaaggg gctgtccaaa
3781 aagagtcaga tgagtatatt ctggctaaag ggccgttaca agtaggagat tcagttctct
3841 tgcaaggcca ttctctagct aagaatatcc tgcatgtcgt aggcccagat gcccgcgcta
3901 aacaggatgt ttctctcctt agtaagtgct ataaggctat gaatgcatat cctcttgtag
3961 tcactcctct tgtttcagca ggcatatttg gtgtaaaacc agctgtgtct tttgattatc
4021 ttattagaga ggctaagact agagttttag tcgtcgttaa ttcccaagat gtctataaga
4081 gtcttaccat agttgacatt ccacagagtt tgactttttc atatgatggg ttacgtggcg
4141 caatacgtaa agctaaagat tatggtttta ctgtttttgt gtgcacagac aactctgcta
4201 acactaaagt tcttaggaac aagggtgttg attatactaa gaagtttctt acagttgacg
4261 gtgtgcaata ttattgctac acgtctaagg acactttaga tgatatctta caacaggcta
4321 ataagtctgt tggtattata tctatgcctt tgggatatgt gtctcatggt ttagacttaa
4381 ttcaagcagg gagtgtcgtg cgtagagtta acgtgcccta cgtgtgtctc ctagctaata
4441 aagagcaaga agctattttg atgtctgaag acgttaagtt aaacccttca gaagatttta
4501 taaagcacgt ccgcactaat ggtggttaca attcttggca tttagtcgag ggtgaactat
4561 tggtgcaaga cttacgctta aataagctcc tgcattggtc tgatcaaacc atatgctaca
4621 aggatagtgt gttttatgtt gtaaagaata gtacagcttt tccatttgaa acactttcag
4681 catgtggtgc gtatttggat tcacgcacga cacagcagtt aacaatcgaa gtcttagtga
4741 ctgtcgatgg tgtaaatttt agaacagtcg ttctaaataa taagaacact tatagatcac
4801 agcttggatg cgttttcttt aatggtgctg atatttctga taccattcct gatgagaaac
4861 agaatggtca cagtttatat ctagcagaca atttgactgc tgatgaaaca aaggcgctta
4921 aagagttata tggccccgtt gatcctactt tcttacacag attctattca cttaaggctg
4981 cagtccataa gtggaagatg gttgtgtgtg ataaggtacg ttctctcaaa ttgagtgata
5041 ataattgtta tcttaatgca gttattatga cacttgattt attgaaggac attaaatttg
5101 ttatacctgc tctacagcat gcatttatga aacataaggg cggtgattca actgacttca
5161 tagccctcat tatggcttat ggcaattgca catttggtgc tccagatgat gcctctcggt
5221 tacttcatac cgtgcttgca aaggctgagt tatgctgttc tgcacgcatg gtttggagag
5281 agtggtgcaa tgtctgtggc ataaaagatg ttgttctaca aggcttaaaa gcttgttgtt
5341 acgtgggtgt gcaaactgtt gaagatctgc gtgctcgcat gacatatgta tgccagtgtg
5401 gtggtgaacg tcatcggcaa atagtcgaac acaccacccc ctggttgctg ctctcaggca
5461 caccaaatga aaaattggtg acaacctcca cggcgcctga ttttgtagcg tttaatgtct
5521 ttcagggcat tgaaacggct gttggccatt atgttcatgc tcgcctgaag ggtggtctta
5581 ttttaaagtt tgactctggc accgttagca agacttcaga ctggaagtgc aaggtgacag
5641 atgtactttt ccccggccaa aaatacagta gcgattgtaa tgtcgtacgg tattctttgg
5701 acggtaattt cagaacagag gttgatcccg acctatctgc tttctatgtt aaggatggta
5761 aatactttac aagtgaacca cccgtaacat attcaccagc tacaatttta gctggtagtg
5821 tctacactaa tagctgcctt gtatcgtctg atggacaacc tggcggtgat gctattagtt
5881 tgagttttaa taacctttta gggtttgatt ctagtaaacc agtcactaag aaatacactt
5941 actccttctt gcctaaagaa gacggcgatg tgttgttggc tgagtttgac acttatgacc
6001 ctatttataa gaatggtgcc atgtataaag gcaaaccaat tctttgggtc aacaaagcat
6061 cttatgatac taatcttaat aagttcaata gagctagttt gcgtcaaatt tttgacgtac
6121 cccccattga actcgaaaat aaattcacac ctttgagtgt ggcgtccaca ccagttgaac
6181 ctccaactgt agatgtggta gcacttcaac aggaaatgac aattgtcaaa tgtaagggtt
6241 taaataaacc tttcgggaag gacaatgtca gtttcgttgt tgatgactca ggtactcccg
6301 ttgttgagta tctgtctaaa gaagatctac atacattgta tgtagaccct aagtatcaag
6361 tcattgtctt aaaagacaat gtactttctt ctatgcttag attgcacacc gttgagtcag
6421 gtgatattaa cgttgttgca gcttccggat ctttgacacg taaagtgaag ttactattta
6481 gggcttcatt ttatttcaaa gaatttgcta cccgcacttt cactgctacc actgctgtag
6541 gtagttgtat aaagagtgta gtgcggcatc taggtgttac taaaggcata ttgacaggct
6601 gttttagttt tgtcaagatg ttatttattc ttccactagc ttactttagt gattcaaaac
6661 tcggcaccac agaggttaaa gtgagtgctt tgaaaacagc tggcgttgtg acaggtaatg
6721 ttgtaaaaca gtgttgcact gctgctgttg atttaagtat ggataagttg cgccgtgtgg
6781 attggaaatc aaccctacgg ttgttactta tgttatgcac aactatggta ttgttgtctt
6841 ctgtgtatca cttgtatgtc ttcaatcagg tcttatcaag tgatgttatg tttgaagatg
6901 cccaaggttt gaaaaagttc tacaaagaag ttagagctta cctaggaatc tcttctgctt
6961 gtgacggtct tgcttcagct tatagggcga attcatttga tgtacctaca ttctgcgcaa
7021 accgttctgc aatgtgtaat tggtgcttga ttagccaaga ttccataact cactacccag
7081 ctcttaagat ggttcaaaca catcttagcc actatgttct taacatagat tggttgtggt
7141 ttgcattcga gactggtttg gcatacatgc tctatacctc ggccttcaac tggttgttgt
7201 tggcaggtac attgcattat ttctttgcac agacttccat atttgtagac tggcggtcat
7261 acaattatgc tgtgtctagt gccttctggt tatttaccca cattccaatg gcgggtttgg
7321 tacgaatgta taatttgtta gcatgccttt ggcttttacg caagttttat cagcatgtaa
7381 tcaatggttg caaagatacg gcatgcttgc tctgctataa gaggaaccga cttactagag
7441 ttgaagcttc taccgttgtc tgtggtggaa aacgtacgtt ttatatcaca gcaaatggcg
7501 gtatttcatt ctgtcgtagg cataattgga attgtgtgga ttgtgacatt gcaggtgtgg
7561 ggaatacctt catctgtgaa gaagtcgcaa atgacctcac taccgcccta cgcaggccta
7621 ttaacgctac ggatagatca cattattatg tggattccgt tacagttaaa gagactgttg
7681 ttcagtttaa ttatcgtaga gacggtcaac cattctacga gcggtttccc ctctgcgctt
7741 ttacaaatct agataagttg aagttcaaag aggtctgtaa aactactact ggtatacctg
7801 aatacaactt tatcatctac gactcatcag atcgtggcca ggaaagttta gctaggtctg
7861 catgtgttta ttattctcaa gtcttgtgta aatcaattct tttggttgac tcaagtttgg
7921 ttacttctgt tggtgattct agtgaaatcg ccactaaaat gtttgattcc tttgttaata
7981 gtttcgtctc gctgtataat gtcacacgcg ataagttgga aaaacttatc tctactgctc
8041 gtgatggcgt aaggcgaggc gataacttcc atagtgtctt aacaacattc attgacgcag
8101 cacgaggccc cgcaggtgtg gagtctgatg ttgagaccaa tgaaattgtt gactctgtgc
8161 agtatgctca taaacatgac atacaaatta ctaatgagag ttacaataat tatgtaccct
8221 catatgttaa acctgatagt gtgtctacca gtgatttagg tagtctcatt gattgtaatg
8281 cggcttcagt taaccaaatt gtcttgcgta attctaatgg tgcttgtatt tggaacgctg
8341 ctgcatatat gaaactctcg gatgcactta aacgacagat tcgcattgca tgccgtaagt
8401 gtaatttagc tttccggtta accacctcaa agctacgcgc taatgataat atcttatcag
8461 ttagattcac tgctaacaaa attgttggtg gtgctcctac atggtttaat gtgttgcgtg
8521 actttacgtt aaagggttac gttcttgcta ccattattgt gtttctgtgt gctgtactga
8581 tgtatttgtg tttacctaca ttttctatgg tacctgttga attttatgaa gaccgcatct
8641 tggactttaa agttcttgat aatggtatca ttagggatgt aaatcctgat gataagtgct
8701 ttgctaataa gcaccggtcc ttcacacaat ggtatcatga gcatgttggt ggtgtctatg
8761 acaactctat cacatgccca ttgacagttg cagtaattgc tggagttgct ggtgctcgca
8821 ttccagacgt acctactaca ttggcttggg tgaacaatca gataattttc tttgtttctc
8881 gagtctttgc taatacaggc agtgtttgct acactcctat agatgagata ccctataaga
8941 gtttctctga tagtggttgc attcttccat ctgagtgcac tatgtttatg gatgcagagg
9001 gccgtatgac accatactgc catgatccta ctgttttgcc tggggctttt gcgtacagtc
9061 agatgaggcc tcatgttcgt tacgacttgt atgatggtaa catgtttatt aaatttcctg
9121 aagtagtatt tgaaagtaca cttaggatta ctagaactct gtcaactcag tactgccggt
9181 tcggtagttg tgagtatgca caagagggtg tttgtattac cacaaatggc tcgtgggcca
9241 tttttaatga ccaccatctt aatagacctg gtgtctattg tggctctgat tttattgaca
9301 ttgtcaggcg gttagcagta tcactgttcc agcctattac ttatttccaa ttgactacct
9361 cattggtctt gggtataggt ttgtgtgcat tcctgacttt gctcttctat tatattaata
9421 aagtaaaacg tgcttttgca gattacaccc agtgtgctgt aattgctgtt gttgctgctg
9481 ttcttaatag cttgtgcatc tgctttgttg cctctatacc attgtgtata gtaccttaca
9541 ctgcattgta ctattatgct acattctatt ttactaatga gcctgcattt attatgcatg
9601 tttcttggta cattatgttc gggcctatcg ttcccatatg gatgacctgc gtctatacag
9661 ttgcaatgtg ctttagacac ttcttctggg ttttagctta ttttagtaag aaacatgtag
9721 aagtttttac tgatggtaag cttaattgta gtttccagga cgctgcctct aatatctttg
9781 ttattaacaa ggacacttat gcagctctta gaaactcttt aactaatgat gcctattcac
9841 gatttttggg gttgtttaac aagtataagt acttctctgg tgctatggaa acagccgctt
9901 atcgtgaagc tgcagcatgt catcttgcta aagccttaca aacatacagt gagactggta
9961 gtgatcttct ttaccaacca cccaactgta gcataacctc tggcgtgttg caaagcggtt
10021 tggtgaaaat gtcacatccc agtggagatg ttgaggcttg tatggttcag gttacctgcg
10081 gtagcatgac tcttaatggt ctttggcttg acaacacagt ctggtgccca cgacacgtaa
10141 tgtgcccggc tgaccagttg tctgatccta attatgatgc cttgttgatt tctatgacta
10201 atcatagttt cagtgtgcaa aaacacattg gcgctccagc aaacttgcgt gttgttggtc
10261 atgccatgca aggcactctt ttgaagttga ctgtcgatgt tgctaaccct agcactccag
10321 cctacacttt tacaacagtg aaacctggcg cagcatttag tgtgttagca tgctataatg
10381 gtcgtccgac tggtacattc actgttgtaa tgcgccctaa ctacacaatt aagggttcct
10441 ttctgtgtgg ttcttgtggt agtgttggtt acaccaagga gggtagtgtg atcaattttt
10501 gttacatgca tcaaatggaa cttgctaatg gtacacatac cggttcagca tttgatggta
10561 ctatgtatgg tgcctttatg gataaacaag tgcaccaagt tcagttaaca gacaaatact
10621 gcagtgttaa tgtagtagct tggctttacg cagcaatact taatggttgc gcttggtttg
10681 taaaacctaa tcgcactagt gttgtttctt ttaatgaatg ggctcttgcc aaccaattca
10741 ctgaatttgt tggcactcaa tccgttgaca tgttagctgt caaaacaggc gttgctattg
10801 aacagctgct ttatgcgatc caacaacttt atactgggtt ccagggaaag caaatccttg
10861 gcagtactat gttggaagat gaattcacac ctgaggatgt taatatgcag attatgggtg
10921 tggttatgca gagtggtgtg agaaaagtta catatggtac tgcgcattgg ttgttcgcga
10981 cccttgtttc aacctatgtg ataatcttac aagccactaa atttactttg tggaactact
11041 tgtttgagac tattcccaca cagttgttcc cactcttatt tgtgactatg gccttcgtta
11101 tgttgttggt taaacacaaa cacacctttt tgacactttt cttgttgcct gtggctattt
11161 gtttgactta tgcaaacata gtctacgagc ccactactcc catttcgtca gcgctgattg
11221 cagttgcaaa ttggcttgcc cccactaatg cttatatgcg cactacacat actgatattg
11281 gtgtctacat tagtatgtca cttgtattag tcattgtagt gaagagattg tacaacccat
11341 cactttctaa ctttgcgtta gcattgtgca gtggtgtaat gtggttgtac acttatagca
11401 ttggagaagc ctcaagcccc attgcctatc tggtttttgt cactacactc actagtgatt
11461 atacgattac agtctttgtt actgtcaacc ttgcaaaagt ttgcacttat gccatctttg
11521 cttactcacc acagcttaca cttgtgtttc cggaagtgaa gatgatactt ttattataca
11581 catgtttagg tttcatgtgt acttgctatt ttggtgtctt ctctcttttg aaccttaagc
11641 ttagagcacc tatgggtgtc tatgacttta aggtctcaac acaagagttc agattcatga
11701 ctgctaacaa tctaactgca cctagaaatt cttgggaggc tatggctctg aactttaagt
11761 taataggtat tggcggtaca ccttgtataa aggttgctgc tatgcagtct aaacttacag
11821 atcttaaatg cacatctgtg gttctcctct ctgtgctcca acagttacac ttagaggcta
11881 atagtagggc ctgggctttc tgtgttaaat gccataatga catattggca gcaacagacc
11941 ccagtgaggc tttcgagaaa ttcgtaagtc tctttgccac tttaatgact ttttctggta
12001 atgtagatct tgatgcgtta gctagtgata tttttgacac tcctagcgta cttcaagcta
12061 ctctttctga gttttcacac ttagctacct ttgctgagtt ggaagctgcg cagaaagcct
12121 atcaggaagc tatggactct ggtgacacct caccacaagt tcttaaggct ttgcagaagg
12181 ctgttaatat agctaaaaac gcctatgaga aggataaggc agtggcccgt aagttagaac
12241 gtatggctga tcaggctatg acttctatgt ataagcaagc acgtgctgaa gacaagaaag
12301 caaaaattgt cagtgctatg caaactatgt tgtttggtat gattaagaag ctcgacaacg
12361 atgttcttaa tggtatcatt tctaacgcta ggaatggttg tatacctctt agtgtcattc
12421 cactgtgtgc ttcaaataaa cttcgcgttg taattcctga cttcaccgtc tggaatcagg
12481 tagtcacata tccctcgctt aactacgctg gggctttgtg ggacattaca gttataaaca
12541 atgtggacaa tgaaattgtt aagtcttcag atgttgtaga cagcaatgaa aatttaacat
12601 ggccacttgt tttagaatgc actagggcat ccacttctgc cgttaagttg caaaataatg
12661 agatcaaacc ttcaggttta aaaaccatgg ttgtgtctgc aggtcaagag caaactaact
12721 gtaatactag ttccttagct tattacgaac ctgtgcaggg tcgtaaaatg ctgatggctc
12781 ttctttctga taatgcctat ctcaaatggg cgcgtgttga aggtaaggac ggatttgtta
12841 gtgtagagct acaacctcct tgcaaattct tgattgcggg accaaaagga cctgaaatcc
12901 gatatctcta ttttgttaaa aatcttaaca accttcatcg cgggcaagtg ttagggcaca
12961 ttgctgcgac tgttagattg caagctggtt ctaacaccga gtttgcctct aattcttcgg
13021 tgttgtcact tgttaacttc accgttgatc ctcaaaaagc ttatctcgat ttcgtcaatg
13081 cgggaggtgc cccattgaca aattgtgtta agatgcttac tcctaaaact ggtacaggta
13141 tagctatatc tgttaaacca gagagtacag ctgatcaaga gacttatggt ggagcttcag
13201 tgtgtctcta ttgccgtgcg catatagaac atcctgatgt ctctggtgtt tgtaaatata
13261 agggtaagtt tgtccaaatc cctgctcagt gtgtccgtga ccctgtggga ttttgtttgt
13321 caaatacccc ctgtaatgtc tgtcaatatt ggattggata tgggtgcaat tgtgactcgc
13381 ttaggcaagt agcactgccc caatctaaag attccaattt tttaaacgag tccggggttc
13441 tattgtaaat gcccgaatag aaccctgttc aagtggtttg tccactgatg tcgtctttag
13501 ggcatttgac atctgcaact ataaggctaa ggttgctggt attggaaaat actacaagac
13561 taatacttgt aggtttgtag aattagatga ccaagggcat catttagact cctattttgt
13621 cgttaagagg catactatgg agaattatga actagagaag cactgttacg atttgttacg
13681 tgactgtgat gctgtagctc cccatgattt cttcatcttt gatgtagaca aagttaaaac
13741 acctcatatt gtacgtcagc gtttaactga gtacactatg atggatcttg tatatgccct
13801 gaggcacttt gatcaaaata gcgaagtgct taaggctatc ttagtgaagt atggttgctg
13861 tgatgttacc tactttgaaa ataaactctg gtttgatttt gttgaaaatc ccagtgttat
13921 tggtgtttat cataaacttg gagaacgtgt acgccaagct atcttaaaca ctgttaaatt
13981 ttgtgaccac atggtcaagg ctggtttagt cggtgtgctc acactagaca accaggacct
14041 taatggcaag tggtatgatt ttggtgactt cgtaatcact caacctggtt caggagtagc
14101 tatagttgat agctactatt cttatttgat gcctgtgctc tcaatgaccg attgtctggc
14161 cgctgagaca catagggatt gtgattttaa taaaccactc attgagtggc cacttactga
14221 gtatgatttt actgattata aggtacaact ctttgagaag tactttaaat attgggatca
14281 gacgtatcac gcaaattgcg ttaattgtac tgatgaccgt tgtgtgttac attgtgctaa
14341 tttcaatgta ttgtttgcta tgaccatgcc taagacttgt ttcggaccca tagtccgaaa
14401 gatctttgtt gatggcgtgc catttgtagt atcttgtggt tatcactaca aagaattagg
14461 tttagtcatg aatatggatg ttagtctcca tagacatagg ctctctctta aggagttgat
14521 gatgtatgcc gctgatccag ccatgcacat tgcctcctct aacgcttttc ttgatttgag
14581 gacatcatgt tttagtgtcg ctgcacttac aactggtttg acttttcaaa ctgtgcggcc
14641 tggcaatttt aaccaagact tctatgattt cgtggtatct aaaggtttct ttaaggaggg
14701 ctcttcagtt acgctcaaac attttttctt tgctcaagat ggtaatgctg ctattacaga
14761 ttataattac tattcttata atctgcctac tatgtgtgac atcaaacaaa tgttgttctg
14821 catggaagtt gtaaacaagt acttcgaaat ctatgacggt ggttgtctta atgcttctga
14881 agtggttgtt aataatttag acaagagtgc tggccatcct tttaataagt ttggcaaagc
14941 tcgtgtctat tatgagagca tgtcttacca ggagcaagat gaactctttg ccatgacaaa
15001 gcgtaacgtc attcctacca tgactcaaat gaatctaaaa tatgctatta gtgctaagaa
15061 tagagctcgc actgttgcag gcgtgtccat acttagcaca atgactaatc gccagtacca
15121 tcagaaaatg cttaagtcca tggctgcaac tcgtggagcg acttgcgtca ttggtactac
15181 aaagttctat ggtggctggg atttcatgct taaaacattg tacaaagatg ttgataatcc
15241 gcatcttatg ggttgggatt accctaagtg tgatagagct atgcctaata tgtgtagaat
15301 cttcgcttca ctcatattag ctcgtaaaca tggcacttgt tgtactacaa gggacagatt
15361 ttatcgcttg gcaaatgagt gtgctcaggt gctaagcgaa tatgttctat gtggtggtgg
15421 ttactacgtc aaacctggag gtaccagtag cggagatgcc accactgcat atgccaatag
15481 tgtctttaac attttgcagg cgacaactgc taatgtcagt gcacttatgg gtgctaatgg
15541 caacaagatt gttgacaaag aagttaaaga catgcagttt gatttgtatg tcaatgttta
15601 caggagcact agcccagacc ccaaatttgt tgataaatac tatgcttttc ttaataagca
15661 cttttctatg atgatactgt ctgatgacgg tgtcgtttgc tataatagtg attatgcagc
15721 taagggttac attgctggaa tacagaattt taaggaaacg ctgtattatc agaacaatgt
15781 ctttatgtct gaagctaaat gctgggtgga aaccgatctg aagaaagggc cacatgaatt
15841 ctgttcacag catacgcttt atattaagga tggcgacgat ggttacttcc ttccttatcc
15901 agacccttca agaattttgt ctgccggttg ctttgtagat gatatcgtta agactgacgg
15961 tacactcatg gtagagcggt ttgtgtcttt ggctatagat gcttaccctc tcacaaagca
16021 tgaagatata gaataccaga atgtattctg ggtctactta cagtatatag aaaaactgta
16081 taaagacctt acaggacaca tgcttgacag ttattctgtc atgctatgtg gtgataattc
16141 tgctaagttt tgggaagagg cattctacag agatctctat agttcgccta ccactttgca
16201 ggctgtcggt tcatgcgttg tatgccattc acagacttcc ctacgctgtg ggacatgcat
16261 ccgtagacca tttctctgct gtaaatgctg ctatgatcat gttatagcaa ctccacataa
16321 gatggttttg tctgtttctc cttacgtttg taatgcccct ggttgtggcg tttcagacgt
16381 tactaagcta tatttaggtg gtatgagcta cttttgtgta gatcatagac ctgtgtgtag
16441 ttttccactt tgcgctaatg gtcttgtatt cggcttatac aagaatatgt gcacaggtag
16501 tccttctata gttgaattta ataggttggc tacctgtgac tggactgaaa gtggtgatta
16561 cacccttgcc aatactacaa cagaaccact caaacttttt gctgctgaga ctttacgtgc
16621 cactgaagag gcgtctaagc agtcttatgc tattgccacc atcaaagaaa ttgttggtga
16681 gcgccaacta ttacttgtgt gggaggctgg caagtccaaa ccaccactca atcgtaatta
16741 tgtttttact ggttatcata taaccaaaaa tagtaaagtg cagctcggtg agtacatctt
16801 cgagcgcatt gattatagtg atgctgtatc ctacaagtct agtacaacgt ataaactgac
16861 tgtaggtgac atcttcgtac ttacctctca ctctgtggct accttgacgg cgcccacaat
16921 tgtgaatcaa gagaggtatg ttaaaattac tgggttgtac ccaaccatta cggtacctga
16981 agagttcgca agtcatgttg ccaacttcca aaaatcaggt tatagtaaat atgtcactgt
17041 tcagggacca cctggcactg gcaaaagtca ttttgctata gggttagcga tttactaccc
17101 tacagcacgt gttgtttata cagcatgttc acacgcagct gttgatgctt tgtgtgaaaa
17161 agcttttaaa tatttgaaca ttgctaaatg ttcccgtatc attcctgcaa aggcacgtgt
17221 tgagtgctat gacaggttta aagttaatga gacaaattct caatatttgt ttagtactat
17281 taatgctcta ccagaaactt ctgccgatat tctggtggtt gatgaggtta gtatgtgcac
17341 taattatgat ctttcaatta ttaatgcacg tattaaagct aagcacattg tctatgtagg
17401 agatccagca cagttgccag ctcctaggac tttgttgact agaggcacat tggaaccaga
17461 aaatttcaat agtgtcacta gattgatgtg taacttaggt cctgacatat ttttaagtat
17521 gtgctacagg tgtcctaagg aaatagtaag cactgtgagc gctcttgtct acaataataa
17581 attgttagcc aagaaggagc tttcaggcca gtgctttaaa atactctata agggcaatgt
17641 gacgcatgat gctagctctg ccattaatag accacaactc acatttgtga agaattttat
17701 tactgccaat ccggcatgga gtaaggcagt ctttatttcg ccttataatt cacagaatgc
17761 tgtggctcgt tcaatgctgg gtcttactac tcagactgtt gattcctcac agggttcaga
17821 ataccagtac gttatcttct gtcaaacagc agatacggca catgctaaca acattaacag
17881 atttaatgtt gcaatcactc gtgcccaaaa aggtattctt tgtgttatga catctcaggc
17941 actctttgag tccttagagt ttactgaatt gtcttttact aattacaagc tccagtctca
18001 gattgtaact ggccttttta aagattgctc tagagaaact tctggcctct cacctgctta
18061 tgcaccaaca tacgttagtg ttgatgacaa gtataagacg agtgatgagc tttgcgtgaa
18121 tcttaattta cccgcaaata tcccatactc tcgtgttatt tccaggatgg gctttaaact
18181 cgatgcaaca gttcctggat atcctaagct tttcattact cgtgaagagg ctgtaaggca
18241 agttcgaagc tggataggct tcgatgttga gggtgctcat gcttcccgta atgcatgtgg
18301 caccaatgtg cctctacaat taggattttc aactggtgtg aactttgttg ttcagccagt
18361 tggtgttgta gacactgagt ggggtaacat gttaacgggc attgctgccc gtcctccacc
18421 aggtgaacag tttaagcacc tcgtgcctct tatgcataag ggggctgcgt ggcctattgt
18481 tagacgacgt atagtgcaaa tgttgtcaga cactttagac aaattgtctg attactgtac
18541 gtttgtttgt tgggctcatg gctttgaatt aacgtctgca tcatactttt gcaagatagg
18601 taaggaacag aagtgttgca tgtgcaatag acgcgctgca gcgtactctt cacctctgca
18661 atcttatgcc tgctggactc attcctgcgg ttatgattat gtctacaacc ctttctttgt
18721 cgatgttcaa cagtggggtt atgtaggcaa tcttgctact aatcacgatc gttattgctc
18781 tgtccatcaa ggagctcatg tggcttctaa tgatgcaata atgactcgtt gtttagctat
18841 tcattcttgt tttatagaac gtgtggattg ggatatagag tatccttata tctcacatga
18901 aaagaaattg aattcctgtt gtagaatcgt tgagcgcaac gtcgtacgtg ctgctcttct
18961 tgccggttca tttgacaaag tctatgatat tggcaatcct aaaggaattc ctattgttga
19021 tgaccctgtg gttgattggc attattttga tgcacagccc ttgaccagaa aggtacaaca
19081 gcttttctat acagaggaca tggcctcaag atttgctgat gggctctgct tattttggaa
19141 ctgtaatgta ccaaaatatc ctaataatgc aattgtatgc aggtttgaca cacgtgtgca
19201 ttctgagttc aatttgccag gttgtgatgg cggtagtttg tatgttaaca agcacgcttt
19261 tcatacacca gcatatgatg tgagtgcatt ccgtgatctg aaacctttac cattctttta
19321 ttattctact acaccatgtg aagtgcatgg taatggtagt atgatagagg atattgatta
19381 tgtaccccta aaatctgcag tctgtattac agcttgtaat ttagggggcg ctgtttgtag
19441 gaagcatgct acagagtaca gagagtatat ggaagcatat aatcttgtct ctgcatcagg
19501 tttccgcctt tggtgttata agacctttga tatttataat ctctggtcta cttttacaaa
19561 agttcaaggt ttggaaaaca ttgcttttaa tgttgttaaa caaggccatt ttattggtgt
19621 tgagggtgaa ctacctgtag ctgtagtcaa tgataagatc ttcaccaaga gtggcgttaa
19681 tgacatttgt atgtttgaga ataaaaccac tttgcctact aatatagctt ttgaactcta
19741 tgctaagcgt gctgtacgct cgcatcccga tttcaaattg ctacacaatt tacaagcaga
19801 catttgctac aagttcgtcc tttgggatta tgaacgtagc aatatttatg gtactgctac
19861 tattggtgta tgtaagtaca ctgatattga tgttaattca gctttgaata tatgttttga
19921 catacgcgat aatggttcat tggagaagtt catgtctact cccaatgcca tctttatttc
19981 tgatagaaaa attaagaaat acccttgtat tgtaggtcct gattatgctt acttcaatgg
20041 tgctatcatc cgtgatagtg atgttgttaa acaaccagtg aagttctact tgtataagaa
20101 agtcaataat gagtttattg atcctactga gtgtatttac actcagagtc gctcttgtag
20161 tgacttccta cccctgtctg acatggagaa agactttcta tcttttgata gtgatgtttt
20221 cattaagaag tatggcttgg aaaactatgc ttttgagcac gtagtctatg gagacttctc
20281 tcatactacg ttaggcggtc ttcacttgct tattggttta tacaagaagc aacaggaagg
20341 tcatattatt atggaagaaa tgctaaaagg tagctcaact attcataact attttattac
20401 tgagactaac acagcggctt ttaaggcggt gtgttctgtt atagatttaa agcttgacga
20461 ctttgttatg attttaaaga gtcaagacct tggcgtagta tccaaggttg tcaaggttcc
20521 tattgactta acaatgattg agtttatgtt atggtgtaag gatggacagg ttcaaacctt
20581 ctaccctcga ctccaggctt ctgcagattg gaaacctggt catgcaatgc catccctctt
20641 taaagttcaa aatgtaaacc ttgaacgttg tgagcttgct aattacaagc aatctattcc
20701 tatgcctcgc ggtgtgcaca tgaacatcgc taaatatatg caattgtgcc agtatttaaa
20761 tacttgcaca ttagccgtgc ctgccaatat gcgtgttata cattttggcg ctggttctga
20821 taaaggtatc gctcctggta catcagtttt acgacagtgg cttcctacag atgccattat
20881 tatagataat gatttaaatg agttcgtgtc agatgctgac ataactttat ttggagattg
20941 tgtaactgta cgtgtcagcc aacaagtgga tcttgttatt tccgacatgt atgatcctac
21001 tactaagaat gtaacaggta gtaatgagtc aaaggcttta ttctttactt acctgtgtaa
21061 cctcattaat aataatcttg ctcttggtgg gtctgttgct attaaaataa cagaacactc
21121 ttggagcgtt gaactttatg aacttatggg aaaatttgct tggtggactg ttttctgcac
21181 caatgcaaat gcatcctcat ctgaaggatt cctcttaggt attaattact tgggtactat
21241 taaagaaaat atagatggtg gtgctatgca cgccaactat atattttgga gaaattccac
21301 tcctatgaat ctgagtactt actcactttt tgatttatcc aagtttcaat taaaattaaa
21361 aggaacacca gttcttcaat taaaggagag tcaaattaac gaactcgtaa tatctctcct
21421 gtcgcagggt aagttactta tccgtgacaa tgatacactc agtgtttcta ctgatgttct
21481 tgttaacacc tacagaaagt tacgttgatg tagggccaga ttctgttaag tctgcttgta
21541 ttgaggttga tatacaacag actttctttg ataaaacttg gcctaggcca attgatgttt
21601 ctaaggctga cggtattata taccctcaag ggcgtacata ttctaacata actatcactt
21661 atcaaggtct ttttccctat cagggagacc atggtgatat gtatgtctac tctgcaggac
21721 atgctacagg cacaactcca caaaagttgt ttgtagctaa ctattctcag gacgtcaaac
21781 agtttgctaa tgggtttgtc gtccgtatag gagcagctgc caattccact ggcactgtta
21841 ttattagccc atctaccagc gctactatac gaaaaattta ccctgctttt atgctgggtt
21901 cttcagttgg taatttctca gatggtaaaa tgggccgctt cttcaatcat actctagttc
21961 ttttgcccga tggatgtggc actttactta gagcttttta ttgtattcta gagcctcgct
22021 ctggaaatca ttgtcctgct ggcaattcct atacttcttt tgccacttat cacactcctg
22081 caacagattg ttctgatggc aattacaatc gtaatgccag tctgaactct tttaaggagt
22141 attttaattt acgtaactgc acctttatgt acacttataa cattaccgaa gatgagattt
22201 tagagtggtt tggcattaca caaactgctc aaggtgttca cctcttctca tctcggtatg
22261 ttgatttgta cggcggcaat atgtttcaat ttgccacctt gcctgtttat gatactatta
22321 agtattattc tatcattcct cacagtattc gttctatcca aagtgataga aaagcttggg
22381 ctgccttcta cgtatataaa cttcaaccgt taactttcct gttggatttt tctgttgatg
22441 gttatatacg cagagctata gactgtggtt ttaatgattt gtcacaactc cactgctcat
22501 atgaatcctt cgatgttgaa tctggagttt attcagtttc gtctttcgaa gcaaaacctt
22561 ctggctcagt tgtggaacag gctgaaggtg ttgaatgtga tttttcacct cttctgtctg
22621 gcacacctcc tcaggtttat aatttcaagc gtttggtttt taccaattgc aattataatc
22681 ttaccaaatt gctttcactt ttttctgtga atgattttac ttgtagtcaa atatctccag
22741 cagcaattgc tagcaactgt tattcttcac tgattttgga ttatttttca tacccactta
22801 gtatgaaatc cgatctcagt gttagttctg ctggtccaat atcccagttt aattataaac
22861 agtccttttc taatcccaca tgtttgattt tagcgactgt tcctcataac cttactacta
22921 ttactaagcc tcttaagtac agctatatta acaagtgctc tcgtcttctt tctgatgatc
22981 gtactgaagt acctcagtta gtgaacgcta atcaatactc accctgtgta tccattgtcc
23041 catccactgt gtgggaagac ggtgattatt ataggaaaca actatctcca cttgaaggtg
23101 gtggctggct tgttgctagt ggctcaactg ttgccatgac tgagcaatta cagatgggct
23161 ttggtattac agttcaatat ggtacagaca ccaatagtgt ttgccccaag cttgaatttg
23221 ctaatgacac aaaaattgcc tctcaattag gcaattgcgt ggaatattcc ctctatggtg
23281 tttcgggccg tggtgtcttt cagaattgca cagctgtagg tgttcgacag cagcgctttg
23341 tttatgatgc gtaccagaat ttagttggct attattctga tgatggcaac tactactgtt
23401 tgcgtgcttg tgttagtgtt cctgtttctg tcatctatga taaagaaact aaaacccacg
23461 ctactctatt tggtagtgtt gcatgtgaac acatttcctc taccatgtct caatactccc
23521 gttctacgcg atcaatgctt aaacggcgag attctacata tggtcccctt cagacacctg
23581 ttggttgtgt cctaggactt gttaattcct ctttgttcgt agaggactgc aagttgcctc
23641 ttggtcaatc tctctgtgct cttcctgaca cacctagtac tctcacacct cgcagtgtgc
23701 gctctgttcc aggtgaaatg cgcttggcat ccattgcttt taatcatcct attcaggttg
23761 atcaacttaa tagtagttat tttaaattaa gtatacctac taatttttcc tttggtgtga
23821 ctcaggagta cattcagaca accattcaga aagttactgt tgattgtaaa cagtacgttt
23881 gcaatggttt ccagaagtgt gagcaattac tgcgcgagta tggccagttt tgttccaaaa
23941 taaaccaggc tctccatggt gccaatttac gccaggatga ttctgtacgt aatttgtttg
24001 cgagcgtgaa aagctctcaa tcatctccta tcataccagg ttttggaggt gactttaatt
24061 tgacacttct agaacctgtt tctatatcta ctggcagtcg tagtgcacgt agtgctattg
24121 aggatttgct atttgacaaa gtcactatag ctgatcctgg ttatatgcaa ggttacgatg
24181 attgtatgca gcaaggtcca gcatcagctc gtgatcttat ttgtgctcaa tatgtggctg
24241 gttataaagt attacctcct cttatggatg ttaatatgga agccgcgtac acttcatctt
24301 tgcttggcag catagcaggt gttggctgga ctgctggctt atcctccttt gctgctattc
24361 catttgcaca gagtattttt tataggttaa acggtgttgg cattactcaa caggttcttt
24421 cagagaacca aaagcttatt gccaataagt ttaatcaggc tctgggagct atgcaaacag
24481 gcttcactac aactaatgaa gcttttcgga aggttcagga tgctgtgaac aacaatgcac
24541 aggctctatc caaattagct agcgagctat ctaatacttt tggtgctatt tccgcctcta
24601 ttggagacat catacaacgt cttgacgttc tcgaacagga cgcccaaata gacagactta
24661 ttaatggccg tttgacaaca ctaaatgctt ttgttgcaca gcagcttgtt cgttctgaat
24721 cagctgctct ttccgctcaa ttggctaaag ataaagtcaa tgagtgtgtc aaggcacaat
24781 ccaagcgttc tggattttgc ggtcaaggca cacatatagt gtcctttgtt gtaaatgccc
24841 ctaatggtct ttactttatg catgttggtt attaccctag caaccacatt gaggttgttt
24901 ctgcttatgg tctttgcgat gcagctaacc ctactaattg tatagcccct gttaatggct
24961 actttattaa aactaataac actaggattg ttgatgagtg gtcatatact gggtcgtcct
25021 tctatgaacc tgagcccatc acctctctta atactaagta tgttgcacca caggcgacat
25081 accaaaacat ttctactaac ctccctcctc ctcttctcgg caattccacc gggattgact
25141 tccaagatga gttggatgag tttttcaaaa atgttagcac cagtatacct aattttggtt
25201 ctctaacaca gattaatact acattactcg atcttaccta cgagatgttg tctcttcaac
25261 aagttgttaa agcccttaat gagtcttaca tagaccttaa agagcttggc aattatactt
25321 attacaacaa atggccgtgg tacatttggc ttggtttcat tgctgggctt gttgccttag
25381 ctctatgcgt cttcttcata ctgtgctgca ctggttgtgg cacaaactgt atgggaaaac
25441 ttaagtgtaa tcgttgttgt gatagatacg aggaatacga cctcgagccg cataaggttc
25501 atgttcacta attaacgaac tatcaatgag agttcaaaga ccacccactc tcttgttagt
25561 gttctcactc tcttttttgg tcactgcatt ttcaaaacct ctctatgtac ctgagcattg
25621 tcagaattat tctggttgca tgcttagggc ttgtattaaa actgcccaag ctgatacagc
25681 tggtctttat acaaattttc gaattgatgt cccatctgca gaatcaactg gtactcaatc
25741 agtttctgtc gatcgtgagt ctacttcaac tcatgatggt cttaccgaac atgttactag
25801 tgtgaatctt tttgacgttg gttactcagt taattaacga actctatgga ttacgtgtct
25861 ctgcttaatc aaatttggca gaagtacctt aattcaccgt atactacttg tttgtatatc
25921 cctaaaccca cagctaagta tacaccttta gttggcactt cattgcaccc tgtgctgtgg
25981 aactgtcagc tatcctttgc tggttatact gaatctgctg ttaattctac aaaagctttg
26041 gccaaacagg acgcagctca gcgaatcgct tggttgctac ataaggatgg aggaatccct
26101 gacggatgtt ccctctacct ccggcactca agtttattcg cgcaaagcga ggaagaggag
26161 tcattctcca actaagaaac tgcgctacgt taagcgtaga ttttctcttc tgcgccctga
26221 agaccttagt gttattgtcc aaccaacaca ctatgtcagg gttacatttt cagaccccaa
26281 catgtggtat ctacgttcgg gtcatcattt acactcagtt cacaattggc ttaaacctta
26341 tggcggccaa cctgtttctg agtaccatat tactctagct ttgctaaatc tcactgatga
26401 agatttagct agagattttt cacccattgc gctctttttg cgcaatgtca gatttgagct
26461 acatgagttc gccttgctgc gcaaaactct tgttcttaat gcatcagaga tctactgtgc
26521 taacatacat agatttaagc ctgtgtatag agttaacacg gcaatcccta ctattaagga
26581 ttggcttctc gttcagggat tttcccttta ccatagtggc ctccctttac atatgtcaat
26641 ctctaaattg catgcactgg atgatgttac tcgcaattac atcattacaa tgccatgctt
26701 tagaacttat cctcaacaaa tgtttgttac tcctttggcc gtagatgttg tctccatacg
26761 gtcttccaat cagggtaata aacaaattgt tcattcttac cccattttac atcatccagg
26821 attttaacga actatggctt tctcggcgtc tttatttaaa cccgtccagc tagtcccagt
26881 ttctcctgca tttcatcgca ttgagtctac tgactctatt gttttcacat acattcctgc
26941 tagcggctat gtagctgctt tagctgtcaa tgtgtgtctc attcccctat tattactgct
27001 acgtcaagat acttgtcgtc gcagcattat cagaactatg gttctctatt tccttgttct
27061 ttataacttt ttattagcca ttgtactagt caatggtgta cattatccaa ctggaagttg
27121 cctgatagcc ttcttagtta tcctcataat actttggttt gtagatagaa ttcgtttctg
27181 tctcatgctg aattcctaca ttccactgtt tgacatgcgt tctcacttta ttcgtgttag
27241 tacagtttct tctcatggta tggtccctgt catacacacc aaaccattat ttattagaaa
27301 cttcgatcag cgttgcagct gttctcgttg tttttatttg cactcttcta cttatataga
27361 gtgcacttat attagccgtt ttagtaagat tagcctagtt tctgtaactg acttctcctt
27421 aaacggcaat gtttccactg ttttcgtgcc tgcaacgcgc gattcagttc ctcttcacat
27481 aatcgccccg agctcgctta tcgtttaagc agctctgcgc tactatgggt cccgtgtaga
27541 ggctaatcca ttagtctctc tttggacata tggaaaacga actatgttac cctttgtcca
27601 agaacgaata gggttgttca tagtaaactt tttcattttt accgtagtat gtgctataac
27661 actcttggtg tgtatggctt tccttacggc tactagatta tgtgtgcaat gtatgacagg
27721 cttcaatacc ctgttagttc agcccgcatt atacttgtat aatactggac gttcagtcta
27781 tgtaaaattc caggatagta aaccccctct accacctgac gagtgggttt aacgaactcc
27841 ttcataatgt ctaatatgac gcaactcact gaggcgcaga ttattgccat tattaaagac
27901 tggaactttg catggtccct gatctttctc ttaattacta tcgtactaca gtatggatac
27961 ccatcccgta gtatgactgt ctatgtcttt aaaatgtttg ttttatggct cctatggcca
28021 tcttccatgg cgctatcaat atttagcgcc atttatccaa ttgatctagc ttcccagata
28081 atctctggca ttgtagcagc tgtttcagct atgatgtgga tttcctactt tgtgcagagt
28141 atccggctgt ttatgagaac tggatcatgg tggtcattca atcctgagac taattgcctt
28201 ttgaatgttc caattggtgg tacaactgtc gtacgtccac tcgtagagga ctctaccagt
28261 gtaactgctg ttgtaaccaa tggtcacctc aaaatggctg gcatgcattt cggtgcttgt
28321 gactacgaca gacttcctaa tgaagtcacc gtggccaaac ccaatgtgct gattgcttta
28381 aaaatggtga agcggcaaag ctacggaact aattccggcg ttgccattta ccatagatat
28441 aaggcaggta attacaggag tccgcctatt acggcggata ttgaacttgc attgcttcga
28501 gcttaggctc tttagtaaga gtatcttaat tgattttaac gaatctcaat ttcattgtta
28561 tggcatcccc tgctgcacct cgtgctgttt cctttgccga taacaatgat ataacaaata
28621 caaacctgtc tcgaggtaga ggacgtaatc caaaaccacg agctgcacca aataacactg
28681 tctcttggta cactgggctt acccaacacg ggaaagtccc tcttaccttt ccacctgggc
28741 agggtgtacc tcttaatgcc aattccaccc ctgcgcaaaa tgctgggtat tggcggagac
28801 aggacagaaa aattaatacc gggaatggaa ttaagcaact ggctcccagg tggtacttct
28861 actacactgg aactggaccc gaagcagcac tcccattccg ggctgttaag gatggcatcg
28921 tttgggtcca tgaagatggc gccactgatg ctccttcaac ttttgggacg cggaacccta
28981 acaatgattc agctattgtt acacaattcg cgcccggtac taagcttcct aaaaacttcc
29041 acattgaggg gactggaggc aatagtcaat catcttcaag agcctctagc gtaagcagaa
29101 actcttccag atctagttca caaggttcaa gatcaggaaa ctctacccgc ggcacttctc
29161 caggtccatc tggaatcgga gcagtaggag gtgatctact ttaccttgat cttctgaaca
29221 gactacaagc ccttgagtct ggcaaagtaa agcaatcgca gccaaaagta atcactaaga
29281 aagatgctgc tgctgctaaa aataagatgc gccacaagcg cacttccacc aaaagtttca
29341 acatggtgca agcttttggt cttcgcggac caggagacct ccagggaaac tttggtgatc
29401 ttcaattgaa taaactcggc actgaggacc cacgttggcc ccaaattgct gagcttgctc
29461 ctacagccag tgcttttatg ggtatgtcgc aatttaaact tacccatcaa aacaatgatg
29521 atcatggcaa ccctgtgtac ttccttcggt acagtggagc cattaaactt gacccaaaga
29581 atcccaacta caataagtgg ttggagcttc ttgagcaaaa tattgatgcc tacaaaacct
29641 tccctaagaa ggaaaagaaa caaaaggcac caaaagaaga atcaacagac caaatgtctg
29701 aacctccaaa ggagcagcgt gtgcaaggta gcatcactca gcgcactcgc acccgtccaa
29761 gtgttcagcc tggtccaatg attgatgtta acactgatta gtgtcactca aagtaacaag
29821 atcgcggcaa tcgtttgtgt ttggtaaccc catctcacca tcgcttgtcc actcttgcac
29881 agaatggaat catgttgtaa ttacagtgca ataaggtaat tataacccat ttaattgata
29941 gctatgcttt attaaagtgt gtagctgtag agagaatgtt aaagactgtc acctctgcgt
30001 gattgcaagt gaacagtgcc ccccgggaag agctctacag tgtgaaatgt aaataaaaat
30061 agctattatt caattagatt aggctaatta gatgatttgc aaaaaaaaaa aaaa

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Mon Jun 08, 2015 8:10 pm 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
LOCUS KT006149 30114 bp RNA linear VRL 08-JUN-2015
DEFINITION Middle East respiratory syndrome coronavirus strain ChinaGD01,
complete genome.
ACCESSION KT006149
VERSION KT006149.2 GI:828177937
KEYWORDS .
SOURCE Middle East respiratory syndrome coronavirus (MERS-CoV)
ORGANISM Middle East respiratory syndrome coronavirus
Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA
stage; Nidovirales; Coronaviridae; Coronavirinae; Betacoronavirus;
unclassified Betacoronavirus.
REFERENCE 1 (bases 1 to 30114)
AUTHORS Lu,R., Nie,K., Ke,C., Zhao,Y., Wang,Y., Li,Y., Deng,Y., Wang,W.,
Zhang,Y., Zhou,W., Wang,H., Zou,L., Niu,P., Zhang,S., Wu,J.,
Wang,W., Wu,G., Ma,X. and Tan,W.
TITLE Phylogenetic Analysis of an Imported Middle East Respirtory
Syndrome Coronavirus Case in China
JOURNAL Unpublished
REFERENCE 2 (bases 1 to 30114)
AUTHORS Lu,R., Nie,K., Ke,C., Zhao,Y., Wang,Y., Li,Y., Deng,Y., Wang,W.,
Zhang,Y., Zhou,W., Wang,H., Zou,L., Niu,P., Zhang,S., Wu,J.,
Wang,W., Wu,G., Ma,X. and Tan,W.
TITLE Direct Submission
JOURNAL Submitted (03-JUN-2015) China CDC, National Institute for Viral
Disease Control and Prevention, 155 Changbai Road, ChangPing
District, Beijing, Beijing 102206, China
REFERENCE 3 (bases 1 to 30114)
AUTHORS Lu,R., Nie,K., Ke,C., Zhao,Y., Wang,Y., Li,Y., Deng,Y., Wang,W.,
Zhang,Y., Zhou,W., Wang,H., Zou,L., Niu,P., Zhang,S., Wu,J.,
Wang,W., Wu,G., Ma,X. and Tan,W.
TITLE Direct Submission
JOURNAL Submitted (08-JUN-2015) China CDC, National Institute for Viral
Disease Control and Prevention, 155 Changbai Road, ChangPing
District, Beijing, Beijing 102206, China
REMARK Sequence update by submitter
COMMENT On Jun 8, 2015 this sequence version replaced gi:827491170.

##Assembly-Data-START##
Assembly Method :: Seqman v. version5.0
Sequencing Technology :: IonTorrent; Sanger dideoxy sequencing
##Assembly-Data-END##
FEATURES Location/Qualifiers
source 1..30114
/organism="Middle East respiratory syndrome coronavirus"
/mol_type="genomic RNA"
/strain="ChinaGD01"
/isolation_source="nasopharyngeal swab"
/host="Homo sapiens"
/db_xref="taxon:1335626"
/country="China"
/collection_date="27-May-2015"
CDS join(273..13427,13427..21508)
/ribosomal_slippage
/codon_start=1
/product="ORF1ab"
/protein_id="AKJ80135.2"
/db_xref="GI:828177938"
/translation="MSFVAGVIAQGARGTYRAALNSEKHQDHVSLTVPLCGSGNLVEK
LSPWFMDGENAYEVVKAMLLKKEPLLYVPIRLAGHTRHLPGPRVYLVERLIACENPFM
VNQLAYSSSANGSLVGTTLQGKPIGMFFPYDIELVTGKQNILLRKYGRGGYHYTPVHY
ERDNTSCPEWMDDFEADPKGKYAQNLLKKLIGGDVTPVDQYMCGVDGKPISAYAFLMA
KDGITKLADVEADVAARADDEGFITLKNNLYRLVWHVERKDVPYPKQSIFTINSVVQK
DGVENTPPHYFTLGCKILTLTPRNKWSGVSDLSLKQKLLYTFYGKESLENPTYIYHSA
FIECGSCGNDSWLTGNAIQGFACGCGASYTANDVEVQSSGMIKPNALLCATCPFAKGD
SCSSNCKHSVAQLVSYLSERCNVIADSKSFTLIFGGVAYAYFGCEEGTMYFVPRAKSV
VSRIGDSIFTGCTGSWNKVTQIANMFLEQTQHSLNFVGEFVVNDVVLAILSGTTTNVD
KIRQLLKGVTIDKLRDYLADYDVAVTAGPFMDNAINVGGTGLQYAAITAPYVVLTGLG
ESFKKVATIPYKVCNSVKDTLTYYAHSVLYRVFPYDMDSGVSSFSELLFDCVDLSVAS
TYFLVRLLQDKTGDFMSTIITSCQTAVSKLLDTCFEATEATFNFLLDLAGLFRIFLRN
AYVYTSQGFVVVNGKVSTLVKQVLDLLNKGMQLLHTKVSWAGSNISAVIYSGRESLIF
PSGTYYCVTTKAKSVQQDLDVILPGEFSKKQLGLLQPTDNSTTVSVTVSSNMVETVVG
QLEQTNMHSPDVIVGDYVIISEKLFVRSKEEDGFAFYPACTNGHAVPTLFRLKGGAPV
KKVAFGGDQVHEVAAVRSVTVEYNIHAVLDTLLASSSLRTFVVDKSLSIEEFADVVKE
QVSDLLVKLLRGMPIPDFDLDDFIDAPCYCFNAEGDASWSSTMIFSLHPVECDEECSE
VEASGLEEGESECISETSTEQVDVSHEVSDDEWAAAVDEAFPLDEAEDVTESVQEEAQ
PVEVPVEDIAQVVIADTLQETPVVSDTVEVPPQVVKLPSEPQTIQPEVKEVAPVYEAD
TEQTQSVTVKPKRLRKKRNVDPLSNFEHKVITECVTIVLGDAIQVAKCYGESVLVNAA
NTHLKHGGGIAGAINAASKGAVQKESDEYILAKGPLQVGDSVLLQGHSLAKNILHVVG
PDARAKQDVSLLSKCYKAMNAYPLVVTPLVSTGIFGVKPAVSFDYLIREAKTRVLVVV
NSQDVYKSLTIVDIPQSLTFSYDGLRGAIRKAKDYGFTVFVCTDNSANTKVLRNKGVD
YTKKFLTVDGVQYYCYTSKDTLDDILQQANKSVGIISMPLGYVSHGLDLIQAGSVVRR
VNVPYVCLLANKEQEAILMSEDVKLNPSEDFIKHVRTNGGYNSWHLVEGELLVQDLRL
NKLLHWSDQTICYKDSVFYVVKNSTAFPFETLSACRAYLDSRTTQQLTIEVLVTVDGV
NFRTVVLNNKNTYRSQLGCVFFNGADISDTIPDEKQNGHSLYLADNLTADETKALKEL
YGPVDPTFLHRFYSLKAAVHKWKMVVCDKVRSLKLSDNNCYLNAVIMTLDLLKDIKFV
IPALQHAFMKHKGGDSTDFIALIMAYGNCTFGAPDDASRLLHTVLAKAELCCSARMVW
REWCNVCGIKDVVLQGLKACCYVGVQTVEDLRARMTYVCQCGGERHRQIVEHTTPWLL
LSGTPNEKLVTTSTAPDFVAFNVFQGIETAVGHYVHACLKGGLILKFDSGTVSKTSDW
KCKVTDVLFPGQKYSSDCNVVRYSLDGNFRTEVDPDLSAFYVKDGKYFTSEPPVTYSP
ATILAGSVYTNSCLVSSDGQPGGDAISLSFNNLLGFDSSKPVTKKYTYSFLPKEDGDV
LLAEFDTYDPIYKNGAMYKGKPILWVNKASYDTNLNKFNRASLRQIFDVPPIELENKF
TPLSVASTPVEPPTVDVVALQQEMTIVKCKGLNKPFVKDNVSFVVDDSGTPVVEYLSK
EDLHTLYVDPKYQVIVLKDNVLSSMLRLHTVESGDINVVAASGSLTRKVKLLFRASFY
FKEFATRTFTATTAVGSCIKSVVRHLGVTKGILTGCFSFVKMLFILPLAYFSDSKLGT
TEVKVSALKTAGVVTGNVVKQCCTAAVDLSMDKLRRVDWKSTLRLLLMLCTTMVLLSS
VYHLYVFNQVLSSDVMFEDAQGLKKFYKEVRAYLGISSACDGLASAYRANSFDVPTFC
ANRSAMCNWCLISQDSITHYPALKMVQTHLSHYVLNIDWLWFAFETGLAYMLYTSAFN
WLLLAGTLHYFFAQTSIFVDWRSYNYAVSSAFWLFTHIPMAGLVRMYNLLACLWLLRK
FYQHVINGCKDTACLLCYKRNRLTRVEASTVVCGGKRTFYITANGGISFCRRHNWNCV
DCDIAGVGNTFICEEVANDLTTALRRPINATDRSHYYVDSVTVKETVVQFNYRRDGQP
FYERFPLCAFTNLDKLKFKEVCKTTTGIPEYNFIIYDSSDRGQESLARSACVYYSQVL
CKSILLVDSSLVTSVGDSSEIATKMFDSFVNSFVSLYNVTRDKLEKLISTARDGVRRG
DNFHSVLTTFIDAARGPAGVESDVETNEIVDSVQYAHKHDIQITNESYNNYVPSYVKP
DSVSTSDLGSLIDCNAASVNQIVLRNSNGACIWNAAAYMKLSDALKRQIRIACRKCNL
AFRLTTSKLRANDNILSVRFTANKIVGGAPTWFNVLRDFTLKGYVLATIIVFLCAVLM
YLCLPTFSMVPVEFYEDRILDFKVLDNGIIRDVNPDDKCFANKHRSFTQWYHEHVGGV
YDNSITCPLTVAVIAGVAGARIPDVPTTLAWVNNQIIFFVSRVFANTGSVCYTPIDEI
PYKSFSDSGCILPSECTMFMDAEGRMTPYCHDPTVLPGAFAYSQMRPHVRYDLYDGNM
FIKFPEVVFESTLRITRTLSTQYCRFGSCEYAQEGVCITTNGSWAIFNDHHLNRPGVY
CGSDFIDIVRRLAVSLFQPITYFQLTTSLVLGIGLCAFLTLLFYYINKVKRAFADYTQ
CAVIAVVAAVLNSLCICFVASIPLCIVPYTALYYYATFYFTNEPAFIMHVSWYIMFGP
IVPIWMTCVYTVAMCFRHFFWVLAYFSKKHVEVFTDGKLNCSFQDAASNIFVINKDTY
AALRNSLTNDAYSRFLGLFNKYKYFSGAMETAAYREAAACHLAKALQTYSETGSDLLY
QPPNCSITSGVLQSGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCP
ADQLSDPNYDALLISMTNHSFSVQKHIGAPANLRVVGHAMQGTLLKLTVDVANPSTPA
YTFTTVKPGAAFSVLACYNGRPTGTFTVVMRPNYTIKGSFLCGSCGSVGYTKEGSVIN
FCYMHQMELANGTHTGSAFDGTMYGAFMDKQVHQVQLTDKYCSVNVVAWLYAAILNGC
AWFVKPNRTSVVSFNEWALANQFTEFVGTQSVDMLAVKTGVAIEQLLYAIQQLYTGFQ
GKQILGSTMLEDEFTPEDVNMQIMGVVMQSGVRKVTYGTAHWLFATLVSTYVIILQAT
KFTLWNYLFETIPTQLFPLLFVTMAFVMLLVKHKHTFLTLFLLPVAICLTYANIVYEP
TTPISSALIAVANWLAPTNAYMRTTHTDIGVYISMSLVLVIVVKRLYNPSLSNFALAL
CSGVMWLYTYSIGEASSPIAYLVFVTTLTSDYTITVFVTVNLAKVCTYAIFAYSPQLT
LVFPEVKMILLLYTCLGFMCTCYFGVFSFLNLKLRAPMGVYDFKVSTQEFRFMTANNL
TAPRNSWEAMALNFKLIGIGGTPCIKVAAMQSKLTDLKCTSVVLLSVLQQLHLEANSR
AWAFCVKCHNDILAATDPSEAFEKFVSLFATLMTFSGNVDLDALASDIFDTPSVLQAT
LSEFSHLATFAELEAAQKAYQEAMDSGDTSPQVLKALQKAVNIAKNAYEKDKAVARKL
ERMADQAMTSMYKQARAEDKKAKIVSAMQTMLFGMIKKLDNDVLNGIISNARNGCIPL
SVIPLCASNKLRVVIPDFTVWNQVVTYPSLNYAGALWDITVINNVDNEIVKSSDVVDS
NENLTWPLVLECTRASTSAVKLQNNEIKPSGLKTMVVSAGQEQTNCNTSSLAYYEPVQ
GRKMLMALLSDNAYLKWARVEGKDGFVSVELQPPCKFLIAGPKGPEIRYLYFVKNLNN
LHRGQVLGHIAATVRLQAGSNTEFASNSSVLSLVNFTVDPQKAYLDFVNAGGAPLTNC
VKMLTPKTGTGIAISVKPESTADQETYGGASVCLYCRAHIEHPDVSGVCKYKGKFVQI
PAQCVRDPVGFCLSNTPCNVCQYWIGYGCNCDSLRQVALPQSKDSNFLNRVRGSIVNA
RIEPCSSGLSTDVVFRAFDICNYKAKVAGIGKYYKTNTCRFVELDDQGHHLDSYFVVK
RHTMENYELEKHCYDLLRDCDAVAPHDFFIFDVDKVKTPHIVRQRLTEYTMMDLVYAL
RHFDQNSEVLKAILVKYGCCDVTYFENKLWFDFVENPSVIGVYHKLGERVRQAILNTV
KFCDHMVKAGLVGVLTLDNQDLNGKWYDFGDFVITQPGSGVAIVDSYYSYLMPVLSMT
DCLAAETHRDCDFNKPLIEWPLTEYDFTDYKVQLFEKYFKYWDQTYHANCVNCTDDRC
VLHCANFNVLFAMTMPKTCFGPIVRKIFVDGVPFVVSCGYHYKELGLVMNMDVSLHRH
RLSLKELMMYAADPAMHIASSNAFLDLRTSCFSVAALTTGLTFQTVRPGNFNQDFYDF
VVSKGFFKEGSSVTLKHFFFAQDGNAAITDYNYYSYNLPTMCDIKQMLFCMEVVNKYF
EIYDGGCLNASEVVVNNLDKSAGHPFNKFGKARVYYESMSYQEQDELFAMTKRNVIPT
MTQMNLKYAISAKNRARTVAGVSILSTMTNRQYHQKMLKSMAATRGATCVIGTTKFYG
GWDFMLKTLYKDVDNPHLMGWDYPKCDRAMPNMCRIFASLILARKHGTCCTTRDRFYR
LANECAQVLSEYVLCGGGYYVKPGGTSSGDATTAYANSVFNILQATTANVSALMGANG
NKIVDKEVKDMQFDLYVNVYRSTSPDPKFVDKYYAFLNKHFSMMILSDDGVVCYNSDY
AAKGYIAGIQNFKETLYYQNNVFMSEAKCWVETDLKKGPHEFCSQHTLYIKDGDDGYF
LPYPDPSRILSAGCFVDDIVKTDGTLMVERFVSLAIDAYPLTKHEDIEYQNVFWVYLQ
YIEKLYKDLTGHMLDSYSVMLCGDNSAKFWEEAFYRDLYSSPTTLQAVGSCVVCHSQT
SLRCGTCIRRPFLCCKCCYDHVIATPHKMVLSVSPYVCNAPGCGVSDVTKLYLGGMSY
FCVDHRPVCSFPLCANGLVFGLYKNMCTGSPSIVEFNRLATCDWTESGDYTLANTTTE
PLKLFAAETLRATEEASKQSYAIATIKEIVGERQLLLVWEAGKSKPPLNRNYVFTGYH
ITKNSKVQLGEYIFERIDYSDAVSYKSSTTYKLTVGDIFVLTSHSVATLTAPTIVNQE
RYVKITGLYPTITVPEEFASHVANFQKSGYSKYVTVQGPPGTGKSHFAIGLAIYYPTA
RVVYTACSHAAVDALCEKAFKYLNIAKCSRIIPAKARVECYDRFKVNETNSQYLFSTI
NALPETSADILVVDEVSMCTNYDLSIINARIKAKHIVYVGDPAQLPAPRTLLTRGTLE
PENFNSVTRLMCNLGPDIFLSMCYRCPKEIVSTVSALVYNNKLLAKKELSGQCFKILY
KGNVTHDASSAINRPQLTFVKNFITANPAWSKAVFISPYNSQNAVARSMLGLTTQTVD
SSQGSEYQYVIFCQTADTAHANNINRFNVAITRAQKGILCVMTSQALFESLEFTELSF
TNYKLQSQIVTGLFKDCSRETSGLSPAYAPTYVSVDDKYKTSDELCVNLNLPANIPYS
RVISRMGFKLDATVPGYPKLFITREEAVRQVRSWIGFDVEGAHASRNACGTNVPLQLG
FSTGVNFVVQPVGVVDTEWGNMLTGIAARPPPGEQFKHLVPLMHKGAAWPIVRRRIVQ
MLSDTLDKLSDYCTFVCWAHGFELTSASYFCKIGKEQKCCMCNRRAAAYSSPLQSYAC
WTHSCGYDYVYNPFFVDVQQWGYVGNLATNHDRYCSVHQGAHVASNDAIMTRCLAIHS
CFIERVDWDIEYPYISHEKKLNSCCRIVERNVVRAALLAGSFDKVYDIGNPKGIPIVD
DPVVDWHYFDAQPLTRKVQQLFYTEDMASRFADGLCLFWNCNVPKYPNNAIVCRFDTR
VHSEFNLPGCDGGSLYVNKHAFHTPAYDVSAFRDLKPLPFFYYSTTPCEVHGNGSMIE
DIDYVPLKSAVCITACNLGGAVCRKHATEYREYMEAYNLVSASGFRLWCYKTFDIYNL
WSTFTKVQGLENIAFNVVKQGHFIGVEGELPVAVVNDKIFTKSGVNDICMFENKTTLP
TNIAFELYAKRAVRSHPDFKLLHNLQADICYKFVLWDYERSNIYGTATIGVCKYTDID
VNSALNICFDIRDNGSLEKFMSTPNAIFISDRKIKKYPCIVGPDYAYFNGAIIRDSDV
VKQPVKFYLYKKVNNEFIDPTECIYTQSRSCSDFLPLSDMEKDFLSFDSDVFIKKYGL
ENYAFEHVVYGDFSHTTLGGLHLLIGLYKKQQEGHIIMEEMLKGSSTIHNYFITETNT
AAFKAVCSVIDLKLDDFVMILKSQDLGVVSKVVKVPIDLTMIEFMLWCKDGQVQTFYP
RLQASADWKPGHAMPSLFKVQNVNLERCELANYKQSIPMPRGVHMNIAKYMQLCQYLN
TCTLAVPANMRVIHFGAGSDKGIAPGTSVLRQWLPTDAIIIDNDLNEFVSDADITLFG
DCVTVRVSQQVDLVISDMYDPTTKNVTGSNESKALFFTYLCNLINNNLALGGSVAIKI
TEHSWSVELYELMGKFAWWTVFCTNANASSSEGFLLGINYLGTIKENIDGGAMHANYI
FWRNSTPMNLSTYSLFDLSKFQLKLKGTPVLQLKESQINELVISLLSQGKLLIRDNDT
LSVSTDVLVNTYRKLR"
CDS 273..13448
/codon_start=1
/product="ORF1a"
/protein_id="AKJ80136.2"
/db_xref="GI:828177939"
/translation="MSFVAGVIAQGARGTYRAALNSEKHQDHVSLTVPLCGSGNLVEK
LSPWFMDGENAYEVVKAMLLKKEPLLYVPIRLAGHTRHLPGPRVYLVERLIACENPFM
VNQLAYSSSANGSLVGTTLQGKPIGMFFPYDIELVTGKQNILLRKYGRGGYHYTPVHY
ERDNTSCPEWMDDFEADPKGKYAQNLLKKLIGGDVTPVDQYMCGVDGKPISAYAFLMA
KDGITKLADVEADVAARADDEGFITLKNNLYRLVWHVERKDVPYPKQSIFTINSVVQK
DGVENTPPHYFTLGCKILTLTPRNKWSGVSDLSLKQKLLYTFYGKESLENPTYIYHSA
FIECGSCGNDSWLTGNAIQGFACGCGASYTANDVEVQSSGMIKPNALLCATCPFAKGD
SCSSNCKHSVAQLVSYLSERCNVIADSKSFTLIFGGVAYAYFGCEEGTMYFVPRAKSV
VSRIGDSIFTGCTGSWNKVTQIANMFLEQTQHSLNFVGEFVVNDVVLAILSGTTTNVD
KIRQLLKGVTIDKLRDYLADYDVAVTAGPFMDNAINVGGTGLQYAAITAPYVVLTGLG
ESFKKVATIPYKVCNSVKDTLTYYAHSVLYRVFPYDMDSGVSSFSELLFDCVDLSVAS
TYFLVRLLQDKTGDFMSTIITSCQTAVSKLLDTCFEATEATFNFLLDLAGLFRIFLRN
AYVYTSQGFVVVNGKVSTLVKQVLDLLNKGMQLLHTKVSWAGSNISAVIYSGRESLIF
PSGTYYCVTTKAKSVQQDLDVILPGEFSKKQLGLLQPTDNSTTVSVTVSSNMVETVVG
QLEQTNMHSPDVIVGDYVIISEKLFVRSKEEDGFAFYPACTNGHAVPTLFRLKGGAPV
KKVAFGGDQVHEVAAVRSVTVEYNIHAVLDTLLASSSLRTFVVDKSLSIEEFADVVKE
QVSDLLVKLLRGMPIPDFDLDDFIDAPCYCFNAEGDASWSSTMIFSLHPVECDEECSE
VEASGLEEGESECISETSTEQVDVSHEVSDDEWAAAVDEAFPLDEAEDVTESVQEEAQ
PVEVPVEDIAQVVIADTLQETPVVSDTVEVPPQVVKLPSEPQTIQPEVKEVAPVYEAD
TEQTQSVTVKPKRLRKKRNVDPLSNFEHKVITECVTIVLGDAIQVAKCYGESVLVNAA
NTHLKHGGGIAGAINAASKGAVQKESDEYILAKGPLQVGDSVLLQGHSLAKNILHVVG
PDARAKQDVSLLSKCYKAMNAYPLVVTPLVSTGIFGVKPAVSFDYLIREAKTRVLVVV
NSQDVYKSLTIVDIPQSLTFSYDGLRGAIRKAKDYGFTVFVCTDNSANTKVLRNKGVD
YTKKFLTVDGVQYYCYTSKDTLDDILQQANKSVGIISMPLGYVSHGLDLIQAGSVVRR
VNVPYVCLLANKEQEAILMSEDVKLNPSEDFIKHVRTNGGYNSWHLVEGELLVQDLRL
NKLLHWSDQTICYKDSVFYVVKNSTAFPFETLSACRAYLDSRTTQQLTIEVLVTVDGV
NFRTVVLNNKNTYRSQLGCVFFNGADISDTIPDEKQNGHSLYLADNLTADETKALKEL
YGPVDPTFLHRFYSLKAAVHKWKMVVCDKVRSLKLSDNNCYLNAVIMTLDLLKDIKFV
IPALQHAFMKHKGGDSTDFIALIMAYGNCTFGAPDDASRLLHTVLAKAELCCSARMVW
REWCNVCGIKDVVLQGLKACCYVGVQTVEDLRARMTYVCQCGGERHRQIVEHTTPWLL
LSGTPNEKLVTTSTAPDFVAFNVFQGIETAVGHYVHACLKGGLILKFDSGTVSKTSDW
KCKVTDVLFPGQKYSSDCNVVRYSLDGNFRTEVDPDLSAFYVKDGKYFTSEPPVTYSP
ATILAGSVYTNSCLVSSDGQPGGDAISLSFNNLLGFDSSKPVTKKYTYSFLPKEDGDV
LLAEFDTYDPIYKNGAMYKGKPILWVNKASYDTNLNKFNRASLRQIFDVPPIELENKF
TPLSVASTPVEPPTVDVVALQQEMTIVKCKGLNKPFVKDNVSFVVDDSGTPVVEYLSK
EDLHTLYVDPKYQVIVLKDNVLSSMLRLHTVESGDINVVAASGSLTRKVKLLFRASFY
FKEFATRTFTATTAVGSCIKSVVRHLGVTKGILTGCFSFVKMLFILPLAYFSDSKLGT
TEVKVSALKTAGVVTGNVVKQCCTAAVDLSMDKLRRVDWKSTLRLLLMLCTTMVLLSS
VYHLYVFNQVLSSDVMFEDAQGLKKFYKEVRAYLGISSACDGLASAYRANSFDVPTFC
ANRSAMCNWCLISQDSITHYPALKMVQTHLSHYVLNIDWLWFAFETGLAYMLYTSAFN
WLLLAGTLHYFFAQTSIFVDWRSYNYAVSSAFWLFTHIPMAGLVRMYNLLACLWLLRK
FYQHVINGCKDTACLLCYKRNRLTRVEASTVVCGGKRTFYITANGGISFCRRHNWNCV
DCDIAGVGNTFICEEVANDLTTALRRPINATDRSHYYVDSVTVKETVVQFNYRRDGQP
FYERFPLCAFTNLDKLKFKEVCKTTTGIPEYNFIIYDSSDRGQESLARSACVYYSQVL
CKSILLVDSSLVTSVGDSSEIATKMFDSFVNSFVSLYNVTRDKLEKLISTARDGVRRG
DNFHSVLTTFIDAARGPAGVESDVETNEIVDSVQYAHKHDIQITNESYNNYVPSYVKP
DSVSTSDLGSLIDCNAASVNQIVLRNSNGACIWNAAAYMKLSDALKRQIRIACRKCNL
AFRLTTSKLRANDNILSVRFTANKIVGGAPTWFNVLRDFTLKGYVLATIIVFLCAVLM
YLCLPTFSMVPVEFYEDRILDFKVLDNGIIRDVNPDDKCFANKHRSFTQWYHEHVGGV
YDNSITCPLTVAVIAGVAGARIPDVPTTLAWVNNQIIFFVSRVFANTGSVCYTPIDEI
PYKSFSDSGCILPSECTMFMDAEGRMTPYCHDPTVLPGAFAYSQMRPHVRYDLYDGNM
FIKFPEVVFESTLRITRTLSTQYCRFGSCEYAQEGVCITTNGSWAIFNDHHLNRPGVY
CGSDFIDIVRRLAVSLFQPITYFQLTTSLVLGIGLCAFLTLLFYYINKVKRAFADYTQ
CAVIAVVAAVLNSLCICFVASIPLCIVPYTALYYYATFYFTNEPAFIMHVSWYIMFGP
IVPIWMTCVYTVAMCFRHFFWVLAYFSKKHVEVFTDGKLNCSFQDAASNIFVINKDTY
AALRNSLTNDAYSRFLGLFNKYKYFSGAMETAAYREAAACHLAKALQTYSETGSDLLY
QPPNCSITSGVLQSGLVKMSHPSGDVEACMVQVTCGSMTLNGLWLDNTVWCPRHVMCP
ADQLSDPNYDALLISMTNHSFSVQKHIGAPANLRVVGHAMQGTLLKLTVDVANPSTPA
YTFTTVKPGAAFSVLACYNGRPTGTFTVVMRPNYTIKGSFLCGSCGSVGYTKEGSVIN
FCYMHQMELANGTHTGSAFDGTMYGAFMDKQVHQVQLTDKYCSVNVVAWLYAAILNGC
AWFVKPNRTSVVSFNEWALANQFTEFVGTQSVDMLAVKTGVAIEQLLYAIQQLYTGFQ
GKQILGSTMLEDEFTPEDVNMQIMGVVMQSGVRKVTYGTAHWLFATLVSTYVIILQAT
KFTLWNYLFETIPTQLFPLLFVTMAFVMLLVKHKHTFLTLFLLPVAICLTYANIVYEP
TTPISSALIAVANWLAPTNAYMRTTHTDIGVYISMSLVLVIVVKRLYNPSLSNFALAL
CSGVMWLYTYSIGEASSPIAYLVFVTTLTSDYTITVFVTVNLAKVCTYAIFAYSPQLT
LVFPEVKMILLLYTCLGFMCTCYFGVFSFLNLKLRAPMGVYDFKVSTQEFRFMTANNL
TAPRNSWEAMALNFKLIGIGGTPCIKVAAMQSKLTDLKCTSVVLLSVLQQLHLEANSR
AWAFCVKCHNDILAATDPSEAFEKFVSLFATLMTFSGNVDLDALASDIFDTPSVLQAT
LSEFSHLATFAELEAAQKAYQEAMDSGDTSPQVLKALQKAVNIAKNAYEKDKAVARKL
ERMADQAMTSMYKQARAEDKKAKIVSAMQTMLFGMIKKLDNDVLNGIISNARNGCIPL
SVIPLCASNKLRVVIPDFTVWNQVVTYPSLNYAGALWDITVINNVDNEIVKSSDVVDS
NENLTWPLVLECTRASTSAVKLQNNEIKPSGLKTMVVSAGQEQTNCNTSSLAYYEPVQ
GRKMLMALLSDNAYLKWARVEGKDGFVSVELQPPCKFLIAGPKGPEIRYLYFVKNLNN
LHRGQVLGHIAATVRLQAGSNTEFASNSSVLSLVNFTVDPQKAYLDFVNAGGAPLTNC
VKMLTPKTGTGIAISVKPESTADQETYGGASVCLYCRAHIEHPDVSGVCKYKGKFVQI
PAQCVRDPVGFCLSNTPCNVCQYWIGYGCNCDSLRQVALPQSKDSNFLNESGVLL"
CDS 21450..25511
/codon_start=1
/product="S protein"
/protein_id="AKJ80137.2"
/db_xref="GI:828177940"
/translation="MIHSVFLLMFLLTPTESYVDVGPDSVKSACIEVDIQQTFFDKTW
PRPIDVSKADGIIYPQGRTYSNITITYQGLFPYQGDHGDMYVYSAGHATGTTPQKLFV
ANYSQDVKQFANGFVVRIGAAANSTGTVIISPSTSATIRKIYPAFMLGSSVGNFSDGK
MGRFFNHTLVLLPDGCGTLLRAFYCILEPRSGNHCPAGNSYTSFATYHTPATDCSDGN
YNRNASLNSFKEYFNLRNCTFMYTYNITEDEILEWFGITQTAQGVHLFSSRYVDLYGG
NMFQFATLPVYDTIKYYSIIPHSIRSIQSDRKAWAAFYVYKLQPLTFLLDFSVDGYIR
RAIDCGFNDLSQLHCSYESFDVESGVYSVSSFEAKPSGSVVEQAEGVECDFSPLLSGT
PPQVYNFKRLVFTNCNYNLTKLLSLFSVNDFTCSQISPAAIASNCYSSLILDYFSYPL
SMKSDLSVSSAGPISQFNYKQSFSNPTCLILATVPHNLTTITKPLKYSYINKCSRLLS
DDRTEVPQLVNANQYSPCVSIVPSTVWEDGDYYRKQLSPLEGGGWLVASGSTVAMTEQ
LQMGFGITVQYGTDTNSVCPKLEFANDTKIASQLGNCVEYSLYGVSGRGVFQNCTAVG
VRQQRFVYDAYQNLVGYYSDDGNYYCLRACVSVPVSVIYDKETKTHATLFGSVACEHI
SSTMSQYSRSTRSMLKRRDSTYGPLQTPVGCVLGLVNSSLFVEDCKLPLGQSLCALPD
TPSTLTPRSVRSVPGEMRLASIAFNHPIQVDQLNSSYFKLSIPTNFSFGVTQEYIQTT
IQKVTVDCKQYVCNGFQKCEQLLREYGQFCSKINQALHGANLRQDDSVRNLFASVKSS
QSSPIIPGFGGDFNLTLLEPVSISTGSRSARSAIEDLLFDKVTIADPGYMQGYDDCMQ
QGPASARDLICAQYVAGYKVLPPLMDVNMEAAYTSSLLGSIAGVGWTAGLSSFAAIPF
AQSIFYRLNGVGITQQVLSENQKLIANKFNQALGAMQTGFTTTNEAFRKVQDAVNNNA
QALSKLASELSNTFGAISASIGDIIQRLDVLEQDAQIDRLINGRLTTLNAFVAQQLVR
SESAALSAQLAKDKVNECVKAQSKRSGFCGQGTHIVSFVVNAPNGLYFMHVGYYPSNH
IEVVSAYGLCDAANPTNCIAPVNGYFIKTNNTRIVDEWSYTGSSFYAPEPITSLNTKY
VAPQVTYQNISTNLPPPLLGNSTGIDFQDELDEFFKNVSTSIPNFGSLTQINTTLLDL
TYEMLSLQQVVKALNESYIDLKELGNYTYYNKWPWYIWLGFIAGLVALALCVFFILCC
TGCGTNCMGKLKCNRCCDRYEEYDLEPHKVHVH"
CDS 25526..25837
/codon_start=1
/product="ORF3"
/protein_id="AKJ80138.1"
/db_xref="GI:827491174"
/translation="MRVQRPPTLLLVFSLSFLVTAFSKPLYVPEHCQNYSGCMLRACI
KTAQADTAGLYTNFRIDVPSAESTGTQSVSVDRESTSTHDGLTEHVTSVNLFDVGYSV
N"
CDS 25846..26175
/codon_start=1
/product="ORF4a"
/protein_id="AKJ80139.1"
/db_xref="GI:827491175"
/translation="MDYVSLLNQIWQKYLNSPYTTCLYIPKPTAKYTPLVGTSLHPVL
WNCQLSFAGYTESAVNSTKALAKQDAAQRIAWLLHKDGGIPDGCSLYLRHSSLFAQSE
EEESFSN"
CDS 26087..26827
/codon_start=1
/product="ORF4b"
/protein_id="AKJ80140.1"
/db_xref="GI:827491176"
/translation="MEESLTDVPSTSGTQVYSRKARKRSHSPTKKLRYVKRRFSLLRP
EDLSVIVQPTHYVRVTFSDPNMWYLRSGHHLHSVHNWLKPYGGQPVSEYHITLALLNL
TDEDLARDFSPIALFLRNVRFELHEFALLRKTLVLNASEIYCANIHRFKPVYRVNTAI
PTIKDWLLVQGFSLYHSGLPLHMSISKLHALDDVTRNYIITMPCFRTYPQQMFVTPLA
VDVVSIRSSNQGNKQIVHSYPILHHPGF"
CDS 26834..27508
/codon_start=1
/product="ORF5"
/protein_id="AKJ80141.1"
/db_xref="GI:827491177"
/translation="MAFSASLFKPVQLVPVSPAFHRIESTDSIVFTYIPASGYVAALA
VNVCLIPLLLLLRQDTCRRSIIRTMVLYFLVLYNFLLAIVLVNGVHYPTGSCLIAFLV
ILIILWFVDRIRFCLMLNSYIPLFDMRSHFIRVSTVSSHGMVPVIHTKPLFIRNFDQR
CSCSRCFYLHSSTYIECTYISRFSKISLVSVTDFSLNGNVSTVFVPATRDSVPLHIIA
PSSLIV"
CDS 27584..27832
/codon_start=1
/product="E protein"
/protein_id="AKJ80142.1"
/db_xref="GI:827491178"
/translation="MLPFVQERIGLFIVNFFIFTVVCAITLLVCMAFLTATRLCVQCM
TGFNTLLVQPALYLYNTGRSVYVKFQDSKPPLPPDEWV"
CDS 27847..28506
/codon_start=1
/product="M protein"
/protein_id="AKJ80143.1"
/db_xref="GI:827491179"
/translation="MSNMTQLTEAQIIAIIKDWNFAWSLIFLLITIVLQYGYPSRSMT
VYVFKMFVLWLLWPSSMALSIFSAIYPIDLASQIISGIVAAVSAMMWISYFVQSIRLF
MRTGSWWSFNPETNCLLNVPIGGTTVVRPLVEDSTSVTAVVTNGHLKMAGMHFGACDY
DRLPNEVTVAKPNVLIALKMVKRQSYGTNSGVAIYHRYKAGNYRSPPITADIELALLR
A"
CDS 28560..29801
/codon_start=1
/product="N protein"
/protein_id="AKJ80144.1"
/db_xref="GI:827491180"
/translation="MASPAAPRAVSFADNNDITNTNLSRGRGRNPKPRAAPNNTVSWY
TGLTQHGKVPLTFPPGQGVPLNANSTPAQNAGYWRRQDRKINTGNGIKQLAPRWYFYY
TGTGPEAALPFRAVKDGIVWVHEDGATDAPSTFGTRNPNNDSAIVTQFAPGTKLPKNF
HIEGTGGNSQSSSRASSVSRNSSRSSSQGSRSGNSTRGTSPGPSGIGAVGGDLLYLDL
LNRLQALESGKVKQSQPKVITKKDAAAAKNKMRHKRTSTKSFNMVQAFGLRGPGDLQG
NFGDLQLNKLGTEDPRWPQIAELAPTASAFMGMSQFKLTHQNNDDHGNPVYFLRYSGA
IKLDPKNPNYNKWLELLEQNIDAYKTFPKKEKKQKAPKEESTDQMSEPPKEQRVQGSI
TQRTRTRPSVQPGPMIDVNTD"
CDS 28756..29094
/codon_start=1
/product="ORF8b"
/protein_id="AKJ80145.1"
/db_xref="GI:827491181"
/translation="MPIPPLRKMLGIGGDRTEKLIPGMELSNWLPGGTSTTLELDPKQ
HSHSGLLRMASFGSMKMAPLMLLQLLGRGTLTMIQLLLHNSRPVLSFLKTSTLRGLEA
IVNHLQEPLA"

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Mon Jun 08, 2015 8:11 pm 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
1 agtgaatagc ttggctatct cacttcccct cgttctcttg cagaactttg attttaacga
61 acttaaataa aagccctgtt gtttagcgta ttgttgcact tgtctggtgg gattgtggca
121 ttaatttgcc tgctcatcta ggcagtggac atatgctcaa cactgggtat aattctaatt
181 gaatactatt tttcagttag agcgtcgtgt ctcttgtacg tctcggtcac aatatacggt
241 ttcgtccggt gcgtggcaat tcggggcaca tcatgtcttt cgtggctggt gtgatcgcgc
301 aaggtgcgcg cggtacgtat cgagcagcgc tcaactctga aaaacatcaa gaccatgtgt
361 ctctaactgt gccactctgt ggttcaggaa acctggttga aaaactttca ccatggttca
421 tggatggcga aaatgcctat gaagtggtga aggccatgtt acttaaaaaa gagccacttc
481 tctatgtgcc catccggctg gctggacaca ctagacacct cccaggtcct cgtgtgtacc
541 tggttgagag gctcattgct tgtgaaaatc cattcatggt taaccaattg gcttatagct
601 ctagtgcaaa tggcagcctg gttggcacaa ctttgcaggg caagcctatt ggtatgttct
661 tcccttatga catcgaactt gtcacaggaa agcaaaatat tctcctgcgc aagtatggcc
721 gtggtggtta tcactacacc ccagtccact atgagcgaga caacacctct tgccctgagt
781 ggatggacga ttttgaggcg gatcctaaag gcaaatatgc ccagaatctg cttaagaagt
841 tgattggcgg tgatgtcact ccagttgacc aatacatgtg tggcgttgat ggaaaaccca
901 ttagtgccta cgcattttta atggccaagg atggaataac caaactggct gatgttgaag
961 cggacgtcgc agcacgtgct gatgacgaag gcttcatcac attaaagaac aatctatata
1021 gattggtttg gcatgttgag cgtaaagacg ttccatatcc taagcaatct atttttacta
1081 ttaatagtgt ggtccaaaag gatggtgttg aaaacactcc tcctcactat tttactcttg
1141 gatgcaaaat tttaacgctc accccacgca acaagtggag tggcgtttct gacttgtccc
1201 tcaaacaaaa actcctttac accttctatg gtaaggagtc acttgagaac ccaacctaca
1261 tttaccactc cgcattcatt gagtgtggaa gttgtggtaa tgattcctgg cttacaggga
1321 atgctatcca agggtttgcc tgtggatgtg gggcatcata tacagctaat gatgtcgaag
1381 tccaatcatc tggcatgatt aagccaaatg ctcttctttg tgctacttgc ccctttgcta
1441 agggtgacag ctgttcttct aattgcaaac attcagttgc tcagttggtt agttaccttt
1501 ctgaacgctg taatgttatt gctgattcta agtccttcac acttatcttt ggtggcgtag
1561 cttacgccta ctttggatgt gaggaaggta ctatgtactt tgtgcctaga gctaagtctg
1621 ttgtctcaag gattggagac tccatcttta caggctgtac tggctcttgg aacaaggtca
1681 ctcaaattgc taacatgttc ttggaacaga ctcagcattc ccttaacttt gtgggagagt
1741 tcgttgtcaa cgatgttgtc ctcgcaattc tctctggaac cacaactaat gttgacaaaa
1801 tacgccagct tctcaaaggt gtcaccattg acaagttgcg tgattattta gctgactatg
1861 acgtagcagt cactgccggc ccattcatgg ataatgctat taatgttggt ggtacaggat
1921 tacagtatgc cgccattact gcaccttatg tagttctcac tggcttaggt gagtccttta
1981 agaaagttgc aaccataccg tacaaggttt gcaactctgt taaggatact ctgacttatt
2041 atgctcacag cgtgttgtac agagtttttc cttatgacat ggattctggt gtgtcatcct
2101 ttagtgaact actttttgat tgcgttgatc tttcagtagc ttctacctat tttttagtcc
2161 gcctcttgca agataagact ggcgacttta tgtctacaat tattacttcc tgccaaactg
2221 ctgttagtaa gcttctagat acatgttttg aagctacaga agcaacattt aacttcttgt
2281 tagatttggc aggattgttc agaatctttc ttcgcaatgc ctatgtgtac acttcacaag
2341 ggtttgtggt ggtcaatggc aaagtttcta cacttgtcaa acaagtgtta gacttgctta
2401 ataagggtat gcaacttttg catacaaagg tctcctgggc tggttctaat atcagtgctg
2461 ttatctacag cggcagggag tctctaatat tcccatcggg aacctattac tgtgtcacca
2521 ctaaggctaa gtccgttcaa caagatcttg acgttatttt gcctggtgag ttttccaaga
2581 agcagttagg actgctccaa cctactgaca attctacaac tgttagtgtt actgtatcca
2641 gtaacatggt tgaaactgtt gtgggtcaac ttgagcaaac taatatgcat agtcctgatg
2701 ttatagtagg tgactatgtc attattagtg aaaaattgtt tgtgcgtagt aaggaagaag
2761 acggattcgc cttctaccct gcttgcacta atggtcatgc tgtaccgact ctctttagac
2821 ttaagggagg tgcacctgta aaaaaagtag cctttggcgg tgatcaagta catgaggttg
2881 ctgctgtaag aagtgttact gtcgagtaca acattcatgc tgtattagac acactacttg
2941 cttcttctag tcttagaacc tttgttgtag ataagtcttt gtcaattgag gagtttgctg
3001 acgtagtaaa ggaacaagtc tcagacttgc ttgttaaatt actgcgtgga atgccgattc
3061 cagattttga tttagacgat tttattgacg caccatgcta ttgctttaac gctgagggtg
3121 atgcatcttg gtcttctact atgatcttct ctcttcaccc cgtcgagtgt gacgaggagt
3181 gttctgaagt agaggcttca ggtttagaag aaggtgaatc agagtgcatt tctgagactt
3241 caactgaaca agttgacgtt tctcatgagg tttctgacga cgagtgggct gctgcagttg
3301 atgaagcgtt ccccctcgat gaagcagaag atgttactga atctgtgcaa gaagaagcac
3361 aaccagtaga agtacctgtt gaagatattg cgcaggttgt catagctgac accttacagg
3421 aaactcctgt tgtgtctgat actgttgaag tcccaccgca agtggtgaaa cttccgtctg
3481 aacctcagac tatccagccc gaggtaaaag aagttgcacc tgtctatgag gctgataccg
3541 aacagacaca gagtgttact gttaaaccta agaggttacg caaaaagcgt aatgttgacc
3601 ctttgtccaa ttttgaacat aaggttatta cagagtgcgt taccatagtt ttaggtgacg
3661 caattcaagt agccaagtgc tatggggagt ctgtgttagt taatgctgct aacacacatc
3721 ttaagcatgg cggtggtatc gctggtgcta ttaatgcggc ttcaaaaggg gctgtccaaa
3781 aagagtcaga tgagtatatt ctggctaaag ggccgttaca agtaggagat tcagttctct
3841 tgcaaggcca ttctctagct aagaatatcc tgcatgtcgt aggcccagat gcccgcgcta
3901 aacaggatgt ttctctcctt agtaagtgct ataaggctat gaatgcatat cctcttgtag
3961 tcactcctct tgtttcaaca ggcatatttg gtgtaaaacc agctgtgtct tttgattatc
4021 ttattagaga ggctaagact agagttttag tcgtcgttaa ttcccaagat gtctataaga
4081 gtcttaccat agttgacatt ccacagagtt tgactttttc atatgatggg ttacgtggcg
4141 caatacgtaa agctaaagat tatggtttta ctgtttttgt gtgcacagac aactctgcta
4201 acactaaagt tcttaggaac aagggtgttg attatactaa gaagtttctt acagttgacg
4261 gtgtgcaata ttattgctac acgtctaagg acactttaga tgatatctta caacaggcta
4321 ataagtctgt tggtattata tctatgcctt tgggatatgt gtctcatggt ttagacttaa
4381 ttcaagcagg gagtgtcgtg cgtagagtta acgtgcccta cgtgtgtctc ctagctaata
4441 aagagcaaga agctattttg atgtctgaag acgttaagtt aaacccttca gaagatttta
4501 taaagcacgt ccgcactaat ggtggttaca attcttggca tttagtcgag ggtgaactat
4561 tggtgcaaga cttacgctta aataagctcc tgcattggtc tgatcaaacc atatgctaca
4621 aggatagtgt gttttatgtt gtaaagaata gtacagcttt tccatttgaa acactttcag
4681 catgtcgtgc gtatttggat tcacgcacga cacagcagtt aacaatcgaa gtcttagtga
4741 ctgtcgatgg tgtaaatttt agaacagtcg ttctaaataa taagaacact tatagatcac
4801 agcttggatg cgttttcttt aatggtgctg atatttctga taccattcct gatgagaaac
4861 agaatggtca cagtttatat ctagcagaca atttgactgc tgatgaaaca aaggcgctta
4921 aagagttata tggccccgtt gatcctactt tcttacacag attctattca cttaaggctg
4981 cagtccataa gtggaagatg gttgtgtgtg ataaggtacg ttctctcaaa ttgagtgata
5041 ataattgtta tcttaatgca gttattatga cacttgattt attgaaggac attaaatttg
5101 ttatacctgc tctacagcat gcatttatga aacataaggg cggtgattca actgacttca
5161 tagccctcat tatggcttat ggcaattgca catttggtgc tccagatgat gcctctcggt
5221 tacttcatac cgtgcttgca aaggctgagt tatgctgttc tgcacgcatg gtttggagag
5281 agtggtgcaa tgtctgtggc ataaaagatg ttgttctaca aggcttaaaa gcttgttgtt
5341 acgtgggtgt gcaaactgtt gaagatctgc gtgctcgcat gacatatgta tgccagtgtg
5401 gtggtgaacg tcatcggcaa atagtcgaac acaccacccc ctggttgctg ctctcaggca
5461 caccaaatga aaaattggtg acaacctcca cggcgcctga ttttgtagcg tttaatgtct
5521 ttcagggcat tgaaacggct gttggccatt atgttcatgc ttgcctgaag ggtggtctta
5581 ttttaaagtt tgactctggc accgttagca agacttcaga ctggaagtgc aaggtgacag
5641 atgtactttt ccccggccaa aaatacagta gcgattgtaa tgtcgtacgg tattctttgg
5701 acggtaattt cagaacagag gttgatcccg acctatctgc tttctatgtt aaggatggta
5761 aatactttac aagtgaacca cccgtaacat attcaccagc tacaatttta gctggtagtg
5821 tctacactaa tagctgcctt gtatcgtctg atggacaacc tggcggtgat gctattagtt
5881 tgagttttaa taacctttta gggtttgatt ctagtaaacc agtcactaag aaatacactt
5941 actccttctt gcctaaagaa gacggcgatg tgttgttggc tgagtttgac acttatgacc
6001 ctatttataa gaatggtgcc atgtataaag gcaaaccaat tctttgggtc aacaaagcat
6061 cttatgatac taatcttaat aagttcaata gagctagttt gcgtcaaatt tttgacgtac
6121 cccccattga actcgaaaat aaattcacac ctttgagtgt ggcgtccaca ccagttgaac
6181 ctccaactgt agatgtggta gcacttcaac aggaaatgac aattgtcaaa tgtaagggtt
6241 taaataaacc tttcgtgaag gacaatgtca gtttcgttgt tgatgactca ggtactcccg
6301 ttgttgagta tctgtctaaa gaagatctac atacattgta tgtagaccct aagtatcaag
6361 tcattgtctt aaaagacaat gtactttctt ctatgcttag attgcacacc gttgagtcag
6421 gtgatattaa cgttgttgca gcttccggat ctttgacacg taaagtgaag ttactattta
6481 gggcttcatt ttatttcaaa gaatttgcta cccgcacttt cactgctacc actgctgtag
6541 gtagttgtat aaagagtgta gtgcggcatc taggtgttac taaaggcata ttgacaggct
6601 gttttagttt tgtcaagatg ttatttattc ttccactagc ttactttagt gattcaaaac
6661 tcggcaccac agaggttaaa gtgagtgctt tgaaaacagc tggcgttgtg acaggtaatg
6721 ttgtaaaaca gtgttgcact gctgctgttg atttaagtat ggataagttg cgccgtgtgg
6781 attggaaatc aaccctacgg ttgttactta tgttatgcac aactatggta ttgttgtctt
6841 ctgtgtatca cttgtatgtc ttcaatcagg tcttatcaag tgatgttatg tttgaagatg
6901 cccaaggttt gaaaaagttc tacaaagaag ttagagctta cctaggaatc tcttctgctt
6961 gtgacggtct tgcttcagct tatagggcga attcatttga tgtacctaca ttctgcgcaa
7021 accgttctgc aatgtgtaat tggtgcttga ttagccaaga ttccataact cactacccag
7081 ctcttaagat ggttcaaaca catcttagcc actatgttct taacatagat tggttgtggt
7141 ttgcattcga gactggtttg gcatacatgc tctatacctc ggccttcaac tggttgttgt
7201 tggcaggtac attgcattat ttctttgcac agacttccat atttgtagac tggcggtcat
7261 acaattatgc tgtgtctagt gccttctggt tatttaccca cattccaatg gcgggtttgg
7321 tacgaatgta taatttgtta gcatgccttt ggcttttacg caagttttat cagcatgtaa
7381 tcaatggttg caaagatacg gcatgcttgc tctgctataa gaggaaccga cttactagag
7441 ttgaagcttc taccgttgtc tgtggtggaa aacgtacgtt ttatatcaca gcaaatggcg
7501 gtatttcatt ctgtcgtagg cataattgga attgtgtgga ttgtgacatt gcaggtgtgg
7561 ggaatacctt catctgtgaa gaagtcgcaa atgacctcac taccgcccta cgcaggccta
7621 ttaacgctac ggatagatca cattattatg tggattccgt tacagttaaa gagactgttg
7681 ttcagtttaa ttatcgtaga gacggtcaac cattctacga gcggtttccc ctctgcgctt
7741 ttacaaatct agataagttg aagttcaaag aggtctgtaa aactactact ggtatacctg
7801 aatacaactt tatcatctac gactcatcag atcgtggcca ggaaagttta gctaggtctg
7861 catgtgttta ttattctcaa gtcttgtgta aatcaattct tttggttgac tcaagtttgg
7921 ttacttctgt tggtgattct agtgaaatcg ccactaaaat gtttgattcc tttgttaata
7981 gtttcgtctc gctgtataat gtcacacgcg ataagttgga aaaacttatc tctactgctc
8041 gtgatggcgt aaggcgaggc gataacttcc atagtgtctt aacaacattc attgacgcag
8101 cacgaggccc cgcaggtgtg gagtctgatg ttgagaccaa tgaaattgtt gactctgtgc
8161 agtatgctca taaacatgac atacaaatta ctaatgagag ttacaataat tatgtaccct
8221 catatgttaa acctgatagt gtgtctacca gtgatttagg tagtctcatt gattgtaatg
8281 cggcttcagt taaccaaatt gtcttgcgta attctaatgg tgcttgtatt tggaacgctg
8341 ctgcatatat gaaactctcg gatgcactta aacgacagat tcgcattgca tgccgtaagt
8401 gtaatttagc tttccggtta accacctcaa agctacgcgc taatgataat atcttatcag
8461 ttagattcac tgctaacaaa attgttggtg gtgctcctac atggtttaat gtgttgcgtg
8521 actttacgtt aaagggttac gttcttgcta ccattattgt gtttctgtgt gctgtactga
8581 tgtatttgtg tttacctaca ttttctatgg tacctgttga attttatgaa gaccgcatct
8641 tggactttaa agttcttgat aatggtatca ttagggatgt aaatcctgat gataagtgct
8701 ttgctaataa gcaccggtcc ttcacacaat ggtatcatga gcatgttggt ggtgtctatg
8761 acaactctat cacatgccca ttgacagttg cagtaattgc tggagttgct ggtgctcgca
8821 ttccagacgt acctactaca ttggcttggg tgaacaatca gataattttc tttgtttctc
8881 gagtctttgc taatacaggc agtgtttgct acactcctat agatgagata ccctataaga
8941 gtttctctga tagtggttgc attcttccat ctgagtgcac tatgtttatg gatgcagagg
9001 gccgtatgac accatactgc catgatccta ctgttttgcc tggggctttt gcgtacagtc
9061 agatgaggcc tcatgttcgt tacgacttgt atgatggtaa catgtttatt aaatttcctg
9121 aagtagtatt tgaaagtaca cttaggatta ctagaactct gtcaactcag tactgccggt
9181 tcggtagttg tgagtatgca caagagggtg tttgtattac cacaaatggc tcgtgggcca
9241 tttttaatga ccaccatctt aatagacctg gtgtctattg tggctctgat tttattgaca
9301 ttgtcaggcg gttagcagta tcactgttcc agcctattac ttatttccaa ttgactacct
9361 cattggtctt gggtataggt ttgtgtgcat tcctgacttt gctcttctat tatattaata
9421 aagtaaaacg tgcttttgca gattacaccc agtgtgctgt aattgctgtt gttgctgctg
9481 ttcttaatag cttgtgcatc tgctttgttg cctctatacc attgtgtata gtaccttaca
9541 ctgcattgta ctattatgct acattctatt ttactaatga gcctgcattt attatgcatg
9601 tttcttggta cattatgttc gggcctatcg ttcccatatg gatgacctgc gtctatacag
9661 ttgcaatgtg ctttagacac ttcttctggg ttttagctta ttttagtaag aaacatgtag
9721 aagtttttac tgatggtaag cttaattgta gtttccagga cgctgcctct aatatctttg
9781 ttattaacaa ggacacttat gcagctctta gaaactcttt aactaatgat gcctattcac
9841 gatttttggg gttgtttaac aagtataagt acttctctgg tgctatggaa acagccgctt
9901 atcgtgaagc tgcagcatgt catcttgcta aagccttaca aacatacagt gagactggta
9961 gtgatcttct ttaccaacca cccaactgta gcataacctc tggcgtgttg caaagcggtt
10021 tggtgaaaat gtcacatccc agtggagatg ttgaggcttg tatggttcag gttacctgcg
10081 gtagcatgac tcttaatggt ctttggcttg acaacacagt ctggtgccca cgacacgtaa
10141 tgtgcccggc tgaccagttg tctgatccta attatgatgc cttgttgatt tctatgacta
10201 atcatagttt cagtgtgcaa aaacacattg gcgctccagc aaacttgcgt gttgttggtc
10261 atgccatgca aggcactctt ttgaagttga ctgtcgatgt tgctaaccct agcactccag
10321 cctacacttt tacaacagtg aaacctggcg cagcatttag tgtgttagca tgctataatg
10381 gtcgtccgac tggtacattc actgttgtaa tgcgccctaa ctacacaatt aagggttcct
10441 ttctgtgtgg ttcttgtggt agtgttggtt acaccaagga gggtagtgtg atcaattttt
10501 gttacatgca tcaaatggaa cttgctaatg gtacacatac cggttcagca tttgatggta
10561 ctatgtatgg tgcctttatg gataaacaag tgcaccaagt tcagttaaca gacaaatact
10621 gcagtgttaa tgtagtagct tggctttacg cagcaatact taatggttgc gcttggtttg
10681 taaaacctaa tcgcactagt gttgtttctt ttaatgaatg ggctcttgcc aaccaattca
10741 ctgaatttgt tggcactcaa tccgttgaca tgttagctgt caaaacaggc gttgctattg
10801 aacagctgct ttatgcgatc caacaacttt atactgggtt ccagggaaag caaatccttg
10861 gcagtactat gttggaagat gaattcacac ctgaggatgt taatatgcag attatgggtg
10921 tggttatgca gagtggtgtg agaaaagtta catatggtac tgcgcattgg ttgttcgcga
10981 cccttgtttc aacctatgtg ataatcttac aagccactaa atttactttg tggaactact
11041 tgtttgagac tattcccaca cagttgttcc cactcttatt tgtgactatg gccttcgtta
11101 tgttgttggt taaacacaaa cacacctttt tgacactttt cttgttgcct gtggctattt
11161 gtttgactta tgcaaacata gtctacgagc ccactactcc catttcgtca gcgctgattg
11221 cagttgcaaa ttggcttgcc cccactaatg cttatatgcg cactacacat actgatattg
11281 gtgtctacat tagtatgtca cttgtattag tcattgtagt gaagagattg tacaacccat
11341 cactttctaa ctttgcgtta gcattgtgca gtggtgtaat gtggttgtac acttatagca
11401 ttggagaagc ctcaagcccc attgcctatc tggtttttgt cactacactc actagtgatt
11461 atacgattac agtctttgtt actgtcaacc ttgcaaaagt ttgcacttat gccatctttg
11521 cttactcacc acagcttaca cttgtgtttc cggaagtgaa gatgatactt ttattataca
11581 catgtttagg tttcatgtgt acttgctatt ttggtgtctt ctcttttttg aaccttaagc
11641 ttagagcacc tatgggtgtc tatgacttta aggtctcaac acaagagttc agattcatga
11701 ctgctaacaa tctaactgca cctagaaatt cttgggaggc tatggctctg aactttaagt
11761 taataggtat tggcggtaca ccttgtataa aggttgctgc tatgcagtct aaacttacag
11821 atcttaaatg cacatctgtg gttctcctct ctgtgctcca acagttacac ttagaggcta
11881 atagtagggc ctgggctttc tgtgttaaat gccataatga catattggca gcaacagacc
11941 ccagtgaggc tttcgagaaa ttcgtaagtc tctttgccac tttaatgact ttttctggta
12001 atgtagatct tgatgcgtta gctagtgata tttttgacac tcctagcgta cttcaagcta
12061 ctctttctga gttttcacac ttagctacct ttgctgagtt ggaagctgcg cagaaagcct
12121 atcaggaagc tatggactct ggtgacacct caccacaagt tcttaaggct ttgcagaagg
12181 ctgttaatat agctaaaaac gcctatgaga aggataaggc agtggcccgt aagttagaac
12241 gtatggctga tcaggctatg acttctatgt ataagcaagc acgtgctgaa gacaagaaag
12301 caaaaattgt cagtgctatg caaactatgt tgtttggtat gattaagaag ctcgacaacg
12361 atgttcttaa tggtatcatt tctaacgcta ggaatggttg tatacctctt agtgtcattc
12421 cactgtgtgc ttcaaataaa cttcgcgttg taattcctga cttcaccgtc tggaatcagg
12481 tagtcacata tccctcgctt aactacgctg gggctttgtg ggacattaca gttataaaca
12541 atgtggacaa tgaaattgtt aagtcttcag atgttgtaga cagcaatgaa aatttaacat
12601 ggccacttgt tttagaatgc actagggcat ccacttctgc cgttaagttg caaaataatg
12661 agatcaaacc ttcaggttta aaaaccatgg ttgtgtctgc aggtcaagag caaactaact
12721 gtaatactag ttccttagct tattacgaac ctgtgcaggg tcgtaaaatg ctgatggctc
12781 ttctttctga taatgcctat ctcaaatggg cgcgtgttga aggtaaggac ggatttgtta
12841 gtgtagagct acaacctcct tgcaaattct tgattgcggg accaaaagga cctgaaatcc
12901 gatatctcta ttttgttaaa aatcttaaca accttcatcg cgggcaagtg ttagggcaca
12961 ttgctgcgac tgttagattg caagctggtt ctaacaccga gtttgcctct aattcttcgg
13021 tgttgtcact tgttaacttc accgttgatc ctcaaaaagc ttatctcgat ttcgtcaatg
13081 cgggaggtgc cccattgaca aattgtgtta agatgcttac tcctaaaact ggtacaggta
13141 tagctatatc tgttaaacca gagagtacag ctgatcaaga gacttatggt ggagcttcag
13201 tgtgtctcta ttgccgtgcg catatagaac atcctgatgt ctctggtgtt tgtaaatata
13261 agggtaagtt tgtccaaatc cctgctcagt gtgtccgtga ccctgtggga ttttgtttgt
13321 caaatacccc ctgtaatgtc tgtcaatatt ggattggata tgggtgcaat tgtgactcgc
13381 ttaggcaagt agcactgccc caatctaaag attccaattt tttaaacgag tccggggttc
13441 tattgtaaat gcccgaatag aaccctgttc aagtggtttg tccactgatg tcgtctttag
13501 ggcatttgac atctgcaact ataaggctaa ggttgctggt attggaaaat actacaagac
13561 taatacttgt aggtttgtag aattagatga ccaagggcat catttagact cctattttgt
13621 cgttaagagg catactatgg agaattatga actagagaag cactgttacg atttgttacg
13681 tgactgtgat gctgtagctc cccatgattt cttcatcttt gatgtagaca aagttaaaac
13741 acctcatatt gtacgtcagc gtttaactga gtacactatg atggatcttg tatatgccct
13801 gaggcacttt gatcaaaata gcgaagtgct taaggctatc ttagtgaagt atggttgctg
13861 tgatgttacc tactttgaaa ataaactctg gtttgatttt gttgaaaatc ccagtgttat
13921 tggtgtttat cataaacttg gagaacgtgt acgccaagct atcttaaaca ctgttaaatt
13981 ttgtgaccac atggtcaagg ctggtttagt cggtgtgctc acactagaca accaggacct
14041 taatggcaag tggtatgatt ttggtgactt cgtaatcact caacctggtt caggagtagc
14101 tatagttgat agctactatt cttatttgat gcctgtgctc tcaatgaccg attgtctggc
14161 cgctgagaca catagggatt gtgattttaa taaaccactc attgagtggc cacttactga
14221 gtatgatttt actgattata aggtacaact ctttgagaag tactttaaat attgggatca
14281 gacgtatcac gcaaattgcg ttaattgtac tgatgaccgt tgtgtgttac attgtgctaa
14341 tttcaatgta ttgtttgcta tgaccatgcc taagacttgt ttcggaccca tagtccgaaa
14401 gatctttgtt gatggcgtgc catttgtagt atcttgtggt tatcactaca aagaattagg
14461 tttagtcatg aatatggatg ttagtctcca tagacatagg ctctctctta aggagttgat
14521 gatgtatgcc gctgatccag ccatgcacat tgcctcctct aacgcttttc ttgatttgag
14581 gacatcatgt tttagtgtcg ctgcacttac aactggtttg acttttcaaa ctgtgcggcc
14641 tggcaatttt aaccaagact tctatgattt cgtggtatct aaaggtttct ttaaggaggg
14701 ctcttcagtt acgctcaaac attttttctt tgctcaagat ggtaatgctg ctattacaga
14761 ttataattac tattcttata atctgcctac tatgtgtgac atcaaacaaa tgttgttctg
14821 catggaagtt gtaaacaagt acttcgaaat ctatgacggt ggttgtctta atgcttctga
14881 agtggttgtt aataatttag acaagagtgc tggccatcct tttaataagt ttggcaaagc
14941 tcgtgtctat tatgagagca tgtcttacca ggagcaagat gaactctttg ccatgacaaa
15001 gcgtaacgtc attcctacca tgactcaaat gaatctaaaa tatgctatta gtgctaagaa
15061 tagagctcgc actgttgcag gcgtgtccat acttagcaca atgactaatc gccagtacca
15121 tcagaaaatg cttaagtcca tggctgcaac tcgtggagcg acttgcgtca ttggtactac
15181 aaagttctat ggtggctggg atttcatgct taaaacattg tacaaagatg ttgataatcc
15241 gcatcttatg ggttgggatt accctaagtg tgatagagct atgcctaata tgtgtagaat
15301 cttcgcttca ctcatattag ctcgtaaaca tggcacttgt tgtactacaa gggacagatt
15361 ttatcgcttg gcaaatgagt gtgctcaggt gctaagcgaa tatgttctat gtggtggtgg
15421 ttactacgtc aaacctggag gtaccagtag cggagatgcc accactgcat atgccaatag
15481 tgtctttaac attttgcagg cgacaactgc taatgtcagt gcacttatgg gtgctaatgg
15541 caacaagatt gttgacaaag aagttaaaga catgcagttt gatttgtatg tcaatgttta
15601 caggagcact agcccagacc ccaaatttgt tgataaatac tatgcttttc ttaataagca
15661 cttttctatg atgatactgt ctgatgacgg tgtcgtttgc tataatagtg attatgcagc
15721 taagggttac attgctggaa tacagaattt taaggaaacg ctgtattatc agaacaatgt
15781 ctttatgtct gaagctaaat gctgggtgga aaccgatctg aagaaagggc cacatgaatt
15841 ctgttcacag catacgcttt atattaagga tggcgacgat ggttacttcc ttccttatcc
15901 agacccttca agaattttgt ctgccggttg ctttgtagat gatatcgtta agactgacgg
15961 tacactcatg gtagagcggt ttgtgtcttt ggctatagat gcttaccctc tcacaaagca
16021 tgaagatata gaataccaga atgtattctg ggtctactta cagtatatag aaaaactgta
16081 taaagacctt acaggacaca tgcttgacag ttattctgtc atgctatgtg gtgataattc
16141 tgctaagttt tgggaagagg cattctacag agatctctat agttcgccta ccactttgca
16201 ggctgtcggt tcatgcgttg tatgccattc acagacttcc ctacgctgtg ggacatgcat
16261 ccgtagacca tttctctgct gtaaatgctg ctatgatcat gttatagcaa ctccacataa
16321 gatggttttg tctgtttctc cttacgtttg taatgcccct ggttgtggcg tttcagacgt
16381 tactaagcta tatttaggtg gtatgagcta cttttgtgta gatcatagac ctgtgtgtag
16441 ttttccactt tgcgctaatg gtcttgtatt cggcttatac aagaatatgt gcacaggtag
16501 tccttctata gttgaattta ataggttggc tacctgtgac tggactgaaa gtggtgatta
16561 cacccttgcc aatactacaa cagaaccact caaacttttt gctgctgaga ctttacgtgc
16621 cactgaagag gcgtctaagc agtcttatgc tattgccacc atcaaagaaa ttgttggtga
16681 gcgccaacta ttacttgtgt gggaggctgg caagtccaaa ccaccactca atcgtaatta
16741 tgtttttact ggttatcata taaccaaaaa tagtaaagtg cagctcggtg agtacatctt
16801 cgagcgcatt gattatagtg atgctgtatc ctacaagtct agtacaacgt ataaactgac
16861 tgtaggtgac atcttcgtac ttacctctca ctctgtggct accttgacgg cgcccacaat
16921 tgtgaatcaa gagaggtatg ttaaaattac tgggttgtac ccaaccatta cggtacctga
16981 agagttcgca agtcatgttg ccaacttcca aaaatcaggt tatagtaaat atgtcactgt
17041 tcagggacca cctggcactg gcaaaagtca ttttgctata gggttagcga tttactaccc
17101 tacagcacgt gttgtttata cagcatgttc acacgcagct gttgatgctt tgtgtgaaaa
17161 agcttttaaa tatttgaaca ttgctaaatg ttcccgtatc attcctgcaa aggcacgtgt
17221 tgagtgctat gacaggttta aagttaatga gacaaattct caatatttgt ttagtactat
17281 taatgctcta ccagaaactt ctgccgatat tctggtggtt gatgaggtta gtatgtgcac
17341 taattatgat ctttcaatta ttaatgcacg tattaaagct aagcacattg tctatgtagg
17401 agatccagca cagttgccag ctcctaggac tttgttgact agaggcacat tggaaccaga
17461 aaatttcaat agtgtcacta gattgatgtg taacttaggt cctgacatat ttttaagtat
17521 gtgctacagg tgtcctaagg aaatagtaag cactgtgagc gctcttgtct acaataataa
17581 attgttagcc aagaaggagc tttcaggcca gtgctttaaa atactctata agggcaatgt
17641 gacgcatgat gctagctctg ccattaatag accacaactc acatttgtga agaattttat
17701 tactgccaat ccggcatgga gtaaggcagt ctttatttcg ccttataatt cacagaatgc
17761 tgtggctcgt tcaatgctgg gtcttactac tcagactgtt gattcctcac agggttcaga
17821 ataccagtac gttatcttct gtcaaacagc agatacggca catgctaaca acattaacag
17881 atttaatgtt gcaatcactc gtgcccaaaa aggtattctt tgtgttatga catctcaggc
17941 actctttgag tccttagagt ttactgaatt gtcttttact aattacaagc tccagtctca
18001 gattgtaact ggccttttta aagattgctc tagagaaact tctggcctct cacctgctta
18061 tgcaccaaca tacgttagtg ttgatgacaa gtataagacg agtgatgagc tttgcgtgaa
18121 tcttaattta cccgcaaata tcccatactc tcgtgttatt tccaggatgg gctttaaact
18181 cgatgcaaca gttcctggat atcctaagct tttcattact cgtgaagagg ctgtaaggca
18241 agttcgaagc tggataggct tcgatgttga gggtgctcat gcttcccgta atgcatgtgg
18301 caccaatgtg cctctacaat taggattttc aactggtgtg aactttgttg ttcagccagt
18361 tggtgttgta gacactgagt ggggtaacat gttaacgggc attgctgccc gtcctccacc
18421 aggtgaacag tttaagcacc tcgtgcctct tatgcataag ggggctgcgt ggcctattgt
18481 tagacgacgt atagtgcaaa tgttgtcaga cactttagac aaattgtctg attactgtac
18541 gtttgtttgt tgggctcatg gctttgaatt aacgtctgca tcatactttt gcaagatagg
18601 taaggaacag aagtgttgca tgtgcaatag acgcgctgca gcgtactctt cacctctgca
18661 atcttatgcc tgctggactc attcctgcgg ttatgattat gtctacaacc ctttctttgt
18721 cgatgttcaa cagtggggtt atgtaggcaa tcttgctact aatcacgatc gttattgctc
18781 tgtccatcaa ggagctcatg tggcttctaa tgatgcaata atgactcgtt gtttagctat
18841 tcattcttgt tttatagaac gtgtggattg ggatatagag tatccttata tctcacatga
18901 aaagaaattg aattcctgtt gtagaatcgt tgagcgcaac gtcgtacgtg ctgctcttct
18961 tgccggttca tttgacaaag tctatgatat tggcaatcct aaaggaattc ctattgttga
19021 tgaccctgtg gttgattggc attattttga tgcacagccc ttgaccagaa aggtacaaca
19081 gcttttctat acagaggaca tggcctcaag atttgctgat gggctctgct tattttggaa
19141 ctgtaatgta ccaaaatatc ctaataatgc aattgtatgc aggtttgaca cacgtgtgca
19201 ttctgagttc aatttgccag gttgtgatgg cggtagtttg tatgttaaca agcacgcttt
19261 tcatacacca gcatatgatg tgagtgcatt ccgtgatctg aaacctttac cattctttta
19321 ttattctact acaccatgtg aagtgcatgg taatggtagt atgatagagg atattgatta
19381 tgtaccccta aaatctgcag tctgtattac agcttgtaat ttagggggcg ctgtttgtag
19441 gaagcatgct acagagtaca gagagtatat ggaagcatat aatcttgtct ctgcatcagg
19501 tttccgcctt tggtgttata agacctttga tatttataat ctctggtcta cttttacaaa
19561 agttcaaggt ttggaaaaca ttgcttttaa tgttgttaaa caaggccatt ttattggtgt
19621 tgagggtgaa ctacctgtag ctgtagtcaa tgataagatc ttcaccaaga gtggcgttaa
19681 tgacatttgt atgtttgaga ataaaaccac tttgcctact aatatagctt ttgaactcta
19741 tgctaagcgt gctgtacgct cgcatcccga tttcaaattg ctacacaatt tacaagcaga
19801 catttgctac aagttcgtcc tttgggatta tgaacgtagc aatatttatg gtactgctac
19861 tattggtgta tgtaagtaca ctgatattga tgttaattca gctttgaata tatgttttga
19921 catacgcgat aatggttcat tggagaagtt catgtctact cccaatgcca tctttatttc
19981 tgatagaaaa attaagaaat acccttgtat tgtaggtcct gattatgctt acttcaatgg
20041 tgctatcatc cgtgatagtg atgttgttaa acaaccagtg aagttctact tgtataagaa
20101 agtcaataat gagtttattg atcctactga gtgtatttac actcagagtc gctcttgtag
20161 tgacttccta cccctgtctg acatggagaa agactttcta tcttttgata gtgatgtttt
20221 cattaagaag tatggcttgg aaaactatgc ttttgagcac gtagtctatg gagacttctc
20281 tcatactacg ttaggcggtc ttcacttgct tattggttta tacaagaagc aacaggaagg
20341 tcatattatt atggaagaaa tgctaaaagg tagctcaact attcataact attttattac
20401 tgagactaac acagcggctt ttaaggcggt gtgttctgtt atagatttaa agcttgacga
20461 ctttgttatg attttaaaga gtcaagacct tggcgtagta tccaaggttg tcaaggttcc
20521 tattgactta acaatgattg agtttatgtt atggtgtaag gatggacagg ttcaaacctt
20581 ctaccctcga ctccaggctt ctgcagattg gaaacctggt catgcaatgc catccctctt
20641 taaagttcaa aatgtaaacc ttgaacgttg tgagcttgct aattacaagc aatctattcc
20701 tatgcctcgc ggtgtgcaca tgaacatcgc taaatatatg caattgtgcc agtatttaaa
20761 tacttgcaca ttagccgtgc ctgccaatat gcgtgttata cattttggcg ctggttctga
20821 taaaggtatc gctcctggta catcagtttt acgacagtgg cttcctacag atgccattat
20881 tatagataat gatttaaatg agttcgtgtc agatgctgac ataactttat ttggagattg
20941 tgtaactgta cgtgtcagcc aacaagtgga tcttgttatt tccgacatgt atgatcctac
21001 tactaagaat gtaacaggta gtaatgagtc aaaggcttta ttctttactt acctgtgtaa
21061 cctcattaat aataatcttg ctcttggtgg gtctgttgct attaaaataa cagaacactc
21121 ttggagcgtt gaactttatg aacttatggg aaaatttgct tggtggactg ttttctgcac
21181 caatgcaaat gcatcctcat ctgaaggatt cctcttaggt attaattact tgggtactat
21241 taaagaaaat atagatggtg gtgctatgca cgccaactat atattttgga gaaattccac
21301 tcctatgaat ctgagtactt actcactttt tgatttatcc aagtttcaat taaaattaaa
21361 aggaacacca gttcttcaat taaaggagag tcaaattaac gaactcgtaa tatctctcct
21421 gtcgcagggt aagttactta tccgtgacaa tgatacactc agtgtttcta ctgatgttct
21481 tgttaacacc tacagaaagt tacgttgatg tagggccaga ttctgttaag tctgcttgta
21541 ttgaggttga tatacaacag actttctttg ataaaacttg gcctaggcca attgatgttt
21601 ctaaggctga cggtattata taccctcaag ggcgtacata ttctaacata actatcactt
21661 atcaaggtct ttttccctat cagggagacc atggtgatat gtatgtctac tctgcaggac
21721 atgctacagg cacaactcca caaaagttgt ttgtagctaa ctattctcag gacgtcaaac
21781 agtttgctaa tgggtttgtc gtccgtatag gagcagctgc caattccact ggcactgtta
21841 ttattagccc atctaccagc gctactatac gaaaaattta ccctgctttt atgctgggtt
21901 cttcagttgg taatttctca gatggtaaaa tgggccgctt cttcaatcat actctagttc
21961 ttttgcccga tggatgtggc actttactta gagcttttta ttgtattcta gagcctcgct
22021 ctggaaatca ttgtcctgct ggcaattcct atacttcttt tgccacttat cacactcctg
22081 caacagattg ttctgatggc aattacaatc gtaatgccag tctgaactct tttaaggagt
22141 attttaattt acgtaactgc acctttatgt acacttataa cattaccgaa gatgagattt
22201 tagagtggtt tggcattaca caaactgctc aaggtgttca cctcttctca tctcggtatg
22261 ttgatttgta cggcggcaat atgtttcaat ttgccacctt gcctgtttat gatactatta
22321 agtattattc tatcattcct cacagtattc gttctatcca aagtgataga aaagcttggg
22381 ctgccttcta cgtatataaa cttcaaccgt taactttcct gttggatttt tctgttgatg
22441 gttatatacg cagagctata gactgtggtt ttaatgattt gtcacaactc cactgctcat
22501 atgaatcctt cgatgttgaa tctggagttt attcagtttc gtctttcgaa gcaaaacctt
22561 ctggctcagt tgtggaacag gctgaaggtg ttgaatgtga tttttcacct cttctgtctg
22621 gcacacctcc tcaggtttat aatttcaagc gtttggtttt taccaattgc aattataatc
22681 ttaccaaatt gctttcactt ttttctgtga atgattttac ttgtagtcaa atatctccag
22741 cagcaattgc tagcaactgt tattcttcac tgattttgga ttatttttca tacccactta
22801 gtatgaaatc cgatctcagt gttagttctg ctggtccaat atcccagttt aattataaac
22861 agtccttttc taatcccaca tgtttgattt tagcgactgt tcctcataac cttactacta
22921 ttactaagcc tcttaagtac agctatatta acaagtgctc tcgtcttctt tctgatgatc
22981 gtactgaagt acctcagtta gtgaacgcta atcaatactc accctgtgta tccattgtcc
23041 catccactgt gtgggaagac ggtgattatt ataggaaaca actatctcca cttgaaggtg
23101 gtggctggct tgttgctagt ggctcaactg ttgccatgac tgagcaatta cagatgggct
23161 ttggtattac agttcaatat ggtacagaca ccaatagtgt ttgccccaag cttgaatttg
23221 ctaatgacac aaaaattgcc tctcaattag gcaattgcgt ggaatattcc ctctatggtg
23281 tttcgggccg tggtgtcttt cagaattgca cagctgtagg tgttcgacag cagcgctttg
23341 tttatgatgc gtaccagaat ttagttggct attattctga tgatggcaac tactactgtt
23401 tgcgtgcttg tgttagtgtt cctgtttctg tcatctatga taaagaaact aaaacccacg
23461 ctactctatt tggtagtgtt gcatgtgaac acatttcctc taccatgtct caatactccc
23521 gttctacgcg atcaatgctt aaacggcgag attctacata tggtcccctt cagacacctg
23581 ttggttgtgt cctaggactt gttaattcct ctttgttcgt agaggactgc aagttgcctc
23641 ttggtcaatc tctctgtgct cttcctgaca cacctagtac tctcacacct cgcagtgtgc
23701 gctctgttcc aggtgaaatg cgcttggcat ccattgcttt taatcatcct attcaggttg
23761 atcaacttaa tagtagttat tttaaattaa gtatacctac taatttttcc tttggtgtga
23821 ctcaggagta cattcagaca accattcaga aagttactgt tgattgtaaa cagtacgttt
23881 gcaatggttt ccagaagtgt gagcaattac tgcgcgagta tggccagttt tgttccaaaa
23941 taaaccaggc tctccatggt gccaatttac gccaggatga ttctgtacgt aatttgtttg
24001 cgagcgtgaa aagctctcaa tcatctccta tcataccagg ttttggaggt gactttaatt
24061 tgacacttct agaacctgtt tctatatcta ctggcagtcg tagtgcacgt agtgctattg
24121 aggatttgct atttgacaaa gtcactatag ctgatcctgg ttatatgcaa ggttacgatg
24181 attgtatgca gcaaggtcca gcatcagctc gtgatcttat ttgtgctcaa tatgtggctg
24241 gttataaagt attacctcct cttatggatg ttaatatgga agccgcgtac acttcatctt
24301 tgcttggcag catagcaggt gttggctgga ctgctggctt atcctccttt gctgctattc
24361 catttgcaca gagtattttt tataggttaa acggtgttgg cattactcaa caggttcttt
24421 cagagaacca aaagcttatt gccaataagt ttaatcaggc tctgggagct atgcaaacag
24481 gcttcactac aactaatgaa gcttttcgga aggttcagga tgctgtgaac aacaatgcac
24541 aggctctatc caaattagct agcgagctat ctaatacttt tggtgctatt tccgcctcta
24601 ttggagacat catacaacgt cttgacgttc tcgaacagga cgcccaaata gacagactta
24661 ttaatggccg tttgacaaca ctaaatgctt ttgttgcaca gcagcttgtt cgttctgaat
24721 cagctgctct ttccgctcaa ttggctaaag ataaagtcaa tgagtgtgtc aaggcacaat
24781 ccaagcgttc tggattttgc ggtcaaggca cacatatagt gtcctttgtt gtaaatgccc
24841 ctaatggcct ttactttatg catgttggtt attaccctag caaccacatt gaggttgttt
24901 ctgcttatgg tctttgcgat gcagctaacc ctactaattg tatagcccct gttaatggct
24961 actttattaa aactaataac actaggattg ttgatgagtg gtcatatact ggctcgtcct
25021 tctatgcacc tgagcccatc acctctctta atactaagta tgttgcacca caggtgacat
25081 accaaaacat ttctactaac ctccctcctc ctcttctcgg caattccacc gggattgact
25141 tccaagatga gttggatgag tttttcaaaa atgttagcac cagtatacct aattttggtt
25201 ctctaacaca gattaatact acattactcg atcttaccta cgagatgttg tctcttcaac
25261 aagttgttaa agcccttaat gagtcttaca tagaccttaa agagcttggc aattatactt
25321 attacaacaa atggccgtgg tacatttggc ttggtttcat tgctgggctt gttgccttag
25381 ctctatgcgt cttcttcata ctgtgctgca ctggttgtgg cacaaactgt atgggaaaac
25441 ttaagtgtaa tcgttgttgt gatagatacg aggaatacga cctcgagccg cataaggttc
25501 atgttcacta attaacgaac tatcaatgag agttcaaaga ccacccactc tcttgttagt
25561 gttctcactc tcttttttgg tcactgcatt ttcaaaacct ctctatgtac ctgagcattg
25621 tcagaattat tctggttgca tgcttagggc ttgtattaaa actgcccaag ctgatacagc
25681 tggtctttat acaaattttc gaattgatgt cccatctgca gaatcaactg gtactcaatc
25741 agtttctgtc gatcgtgagt ctacttcaac tcatgatggt cttaccgaac atgttactag
25801 tgtgaatctt tttgacgttg gttactcagt taattaacga actctatgga ttacgtgtct
25861 ctgcttaatc aaatttggca gaagtacctt aattcaccgt atactacttg tttgtatatc
25921 cctaaaccca cagctaagta tacaccttta gttggcactt cattgcaccc tgtgctgtgg
25981 aactgtcagc tatcctttgc tggttatact gaatctgctg ttaattctac aaaagctttg
26041 gccaaacagg acgcagctca gcgaatcgct tggttgctac ataaggatgg aggaatccct
26101 gacggatgtt ccctctacct ccggcactca agtttattcg cgcaaagcga ggaagaggag
26161 tcattctcca actaagaaac tgcgctacgt taagcgtaga ttttctcttc tgcgccctga
26221 agaccttagt gttattgtcc aaccaacaca ctatgtcagg gttacatttt cagaccccaa
26281 catgtggtat ctacgttcgg gtcatcattt acactcagtt cacaattggc ttaaacctta
26341 tggcggccaa cctgtttctg agtaccatat tactctagct ttgctaaatc tcactgatga
26401 agatttagct agagattttt cacccattgc gctctttttg cgcaatgtca gatttgagct
26461 acatgagttc gccttgctgc gcaaaactct tgttcttaat gcatcagaga tctactgtgc
26521 taacatacat agatttaagc ctgtgtatag agttaacacg gcaatcccta ctattaagga
26581 ttggcttctc gttcagggat tttcccttta ccatagtggc ctccctttac atatgtcaat
26641 ctctaaattg catgcactgg atgatgttac tcgcaattac atcattacaa tgccatgctt
26701 tagaacttat cctcaacaaa tgtttgttac tcctttggcc gtagatgttg tctccatacg
26761 gtcttccaat cagggtaata aacaaattgt tcattcttac cccattttac atcatccagg
26821 attttaacga actatggctt tctcggcgtc tttatttaaa cccgtccagc tagtcccagt
26881 ttctcctgca tttcatcgca ttgagtctac tgactctatt gttttcacat acattcctgc
26941 tagcggctat gtagctgctt tagctgtcaa tgtgtgtctc attcccctat tattactgct
27001 acgtcaagat acttgtcgtc gcagcattat cagaactatg gttctctatt tccttgttct
27061 ttataacttt ttattagcca ttgtactagt caatggtgta cattatccaa ctggaagttg
27121 cctgatagcc ttcttagtta tcctcataat actttggttt gtagatagaa ttcgtttctg
27181 tctcatgctg aattcctaca ttccactgtt tgacatgcgt tctcacttta ttcgtgttag
27241 tacagtttct tctcatggta tggtccctgt catacacacc aaaccattat ttattagaaa
27301 cttcgatcag cgttgcagct gttctcgttg tttttatttg cactcttcta cttatataga
27361 gtgcacttat attagccgtt ttagtaagat tagcctagtt tctgtaactg acttctcctt
27421 aaacggcaat gtttccactg ttttcgtgcc tgcaacgcgc gattcagttc ctcttcacat
27481 aatcgccccg agctcgctta tcgtttaagc agctctgcgc tactatgggt cccgtgtaga
27541 ggctaatcca ttagtctctc tttggacata tggaaaacga actatgttac cctttgtcca
27601 agaacgaata gggttgttca tagtaaactt tttcattttt accgtagtat gtgctataac
27661 actcttggtg tgtatggctt tccttacggc tactagatta tgtgtgcaat gtatgacagg
27721 cttcaatacc ctgttagttc agcccgcatt atacttgtat aatactggac gttcagtcta
27781 tgtaaaattc caggatagta aaccccctct accacctgac gagtgggttt aacgaactcc
27841 ttcataatgt ctaatatgac gcaactcact gaggcgcaga ttattgccat tattaaagac
27901 tggaactttg catggtccct gatctttctc ttaattacta tcgtactaca gtatggatac
27961 ccatcccgta gtatgactgt ctatgtcttt aaaatgtttg ttttatggct cctatggcca
28021 tcttccatgg cgctatcaat atttagcgcc atttatccaa ttgatctagc ttcccagata
28081 atctctggca ttgtagcagc tgtttcagct atgatgtgga tttcctactt tgtgcagagt
28141 atccggctgt ttatgagaac tggatcatgg tggtcattca atcctgagac taattgcctt
28201 ttgaatgttc caattggtgg tacaactgtc gtacgtccac tcgtagagga ctctaccagt
28261 gtaactgctg ttgtaaccaa tggtcacctc aaaatggctg gcatgcattt cggtgcttgt
28321 gactacgaca gacttcctaa tgaagtcacc gtggccaaac ccaatgtgct gattgcttta
28381 aaaatggtga agcggcaaag ctacggaact aattccggcg ttgccattta ccatagatat
28441 aaggcaggta attacaggag tccgcctatt acggcggata ttgaacttgc attgcttcga
28501 gcttaggctc tttagtaaga gtatcttaat tgattttaac gaatctcaat ttcattgtta
28561 tggcatcccc tgctgcacct cgtgctgttt cctttgccga taacaatgat ataacaaata
28621 caaacctgtc tcgaggtaga ggacgtaatc caaaaccacg agctgcacca aataacactg
28681 tctcttggta cactgggctt acccaacacg ggaaagtccc tcttaccttt ccacctgggc
28741 agggtgtacc tcttaatgcc aattccaccc ctgcgcaaaa tgctgggtat tggcggagac
28801 aggacagaaa aattaatacc gggaatggaa ttaagcaact ggctcccagg tggtacttct
28861 actacactgg aactggaccc gaagcagcac tcccattccg ggctgttaag gatggcatcg
28921 tttgggtcca tgaagatggc gccactgatg ctccttcaac ttttgggacg cggaacccta
28981 acaatgattc agctattgtt acacaattcg cgcccggtac taagcttcct aaaaacttcc
29041 acattgaggg gactggaggc aatagtcaat catcttcaag agcctctagc gtaagcagaa
29101 actcttccag atctagttca caaggttcaa gatcaggaaa ctctacccgc ggcacttctc
29161 caggtccatc tggaatcgga gcagtaggag gtgatctact ttaccttgat cttctgaaca
29221 gactacaagc ccttgagtct ggcaaagtaa agcaatcgca gccaaaagta atcactaaga
29281 aagatgctgc tgctgctaaa aataagatgc gccacaagcg cacttccacc aaaagtttca
29341 acatggtgca agcttttggt cttcgcggac caggagacct ccagggaaac tttggtgatc
29401 ttcaattgaa taaactcggc actgaggacc cacgttggcc ccaaattgct gagcttgctc
29461 ctacagccag tgcttttatg ggtatgtcgc aatttaaact tacccatcag aacaatgatg
29521 atcatggcaa ccctgtgtac ttccttcggt acagtggagc cattaaactt gacccaaaga
29581 atcccaacta caataagtgg ttggagcttc ttgagcaaaa tattgatgcc tacaaaacct
29641 tccctaagaa ggaaaagaaa caaaaggcac caaaagaaga atcaacagac caaatgtctg
29701 aacctccaaa ggagcagcgt gtgcaaggta gcatcactca gcgcactcgc acccgtccaa
29761 gtgttcagcc tggtccaatg attgatgtta acactgatta gtgtcactca aagtaacaag
29821 atcgcggcaa tcgtttgtgt ttggtaaccc catctcacca tcgcttgtcc actcttgcac
29881 agaatggaat catgttgtaa ttacagtgca ataaggtaat tataacccat ttaattgata
29941 gctatgcttt attaaagtgt gtagctgtag agagaatgtt aaagactgtc acctctgcgt
30001 gattgcaagt gaacagtgcc ccccgggaag agctctacag tgtgaaatgt aaataaaaat
30061 agctattatt caattagatt aggctaatta gatgatttgc aaaaaaaaaa aaaa

_________________
www.twitter.com/hniman


Top
 Profile  
 
Display posts from previous:  Sort by  
Post new topic Reply to topic  [ 6 posts ] 

All times are UTC - 5 hours [ DST ]


Who is online

Users browsing this forum: Google [Bot], Majestic-12 [Bot] and 64 guests


You cannot post new topics in this forum
You cannot reply to topics in this forum
You cannot edit your posts in this forum
You cannot delete your posts in this forum
You cannot post attachments in this forum

Search for:
Jump to:  
cron
Powered by phpBB® Forum Software © phpBB Group