Rhiza Labs FluTracker Forum

The place to discuss the flu
It is currently Thu Oct 19, 2017 12:04 pm

All times are UTC - 5 hours [ DST ]




Post new topic Reply to topic  [ 19 posts ]  Go to page 1, 2  Next
Author Message
PostPosted: Fri May 01, 2015 1:40 pm 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
Fujian H5N2 Pheasant Backyard Farm Okanogan Co WA 2015 Seqs

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Fri May 01, 2015 1:43 pm 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
LOCUS KR150909 1704 bp cRNA linear VRL 27-APR-2015
DEFINITION Influenza A virus (A/pheasant/Washington/3147-2/2015(H5N2)) segment
4 hemagglutinin (HA) gene, complete cds.
ACCESSION KR150909
VERSION KR150909.1 GI:810275603
KEYWORDS .
SOURCE Influenza A virus (A/pheasant/Washington/3147-2/2015(H5N2))
ORGANISM Influenza A virus (A/pheasant/Washington/3147-2/2015(H5N2))
Viruses; ssRNA negative-strand viruses; Orthomyxoviridae;
Influenzavirus A.
REFERENCE 1 (bases 1 to 1704)
AUTHORS Killian,M.L.
TITLE Direct Submission
JOURNAL Submitted (20-APR-2015) Diagnostic Virology Laboratory, National
Veterinary Services Laboratories (NVSL), USDA APHIS VS, 1920 Dayton
Avenue, Ames, IA 50010, USA
COMMENT GenBank Accession Numbers KR150906-KR150913 represent sequences
from the 8 segments of Influenza A virus
(A/pheasant/Washington/3147-2/2015(H5N2)).

##Assembly-Data-START##
Assembly Method :: SeqMan NGen v. 4
Sequencing Technology :: IonTorrent
##Assembly-Data-END##
FEATURES Location/Qualifiers
source 1..1704
/organism="Influenza A virus
(A/pheasant/Washington/3147-2/2015(H5N2))"
/mol_type="viral cRNA"
/strain="A/pheasant/Washington/3147-2/2015"
/serotype="H5N2"
/isolation_source="tracheal swab"
/host="pheasant; backyard"
/db_xref="taxon:1643760"
/segment="4"
/country="USA: Okanogan County, Washington"
/collection_date="26-Jan-2015"
/collected_by="Washington State Department of Agriculture"
/note="NVSL 15-003147; EP1; Eurasian origin (EA-H5N8 clade
2.3.4.4)-North American reassortant"
gene 1..1704
/gene="HA"
CDS 1..1704
/gene="HA"
/function="receptor binding and fusion protein"
/codon_start=1
/product="hemagglutinin"
/protein_id="AKE14397.1"
/db_xref="GI:810275604"
/translation="MEKIVLLFAVISLVKSDQICIGYHANNSTKQVDTIMEKNVTVTH
AQDILEKTHNGKLCDLNGVKPLILKDCSVAGWLLGNPMCDEFIRVPEWSYIVERANPA
NDLCYPGTLNDYEELKHLLSRINHFEKTLIIPRSSWPNHETSLGVSAACPYQGASSFF
RNVVWLIKKNDAYPTIKISYNNTNREDLLILWGIHHSNNAAEQTNLYKNPDTYVSVGT
STLNQRLVPKIATRSQVNGQSGRMDFFWTILKPNDAIHFESNGNFIAPEYAYKIVKKG
DSTIMKSEMEYGHCNTKCQTPIGAINSSMPFHNIHPLTIGECPKYVKSNKLVLATGLR
NSPLRERRRKRGLFGAIAGFIEGGWQGMVDGWYGYHHSNEQGSGYAADKESTQKAIDG
VTNKVNSIIDKMNTQFEAVGREFNNLERRIENLNKKMEDGFLDVWTYNAELLVLMENE
RTLDFHDSNVKNLYDKVRLQLRDNAKELGNGCFEFYHKCDNECMESVRNGTYDYPKYS
EEAILKREEISGVKLESIGTYQILSIYSTVASSLALAIIVAGLSLWMCSNGSLQCRIC
I"
mat_peptide 49..1035
/gene="HA"
/product="HA1"
mat_peptide 1036..1701
/gene="HA"
/product="HA2"
ORIGIN
1 atggagaaaa tagtgcttct ttttgcagtg attagccttg ttaaaagtga tcagatttgc
61 attggttacc atgcaaacaa ctcaacaaag caggttgaca cgataatgga gaaaaacgtc
121 actgttacac atgcccaaga catactggaa aagacacaca acgggaagct ctgcgatctt
181 aatggagtga agcccctgat tctaaaggat tgtagcgtag ctgggtggct ccttggaaat
241 ccaatgtgcg acgagttcat cagggtaccg gaatggtctt acatcgtgga gagggctaac
301 ccagccaacg acctctgtta cccagggacc ctcaatgact atgaggaact gaaacaccta
361 ttgagcagaa taaatcattt tgagaaaact ctgatcatcc ccaggagttc ttggcccaat
421 catgaaacat cattaggggt gagcgcagca tgtccatacc agggagcatc ctcatttttc
481 agaaatgtgg tatggctcat caaaaagaac gatgcatacc cgacaataaa gataagctac
541 aataatacca atcgggaaga tcttttgata ctgtggggga ttcatcattc caacaatgca
601 gcagagcaga caaatctcta taaaaaccca gacacttatg tttccgttgg gacatcaaca
661 ttaaaccaga gattggtgcc aaaaatagct actagatccc aagtaaacgg gcagagtgga
721 agaatggatt tcttctggac aattttaaaa ccgaatgatg caatccactt tgagagtaat
781 ggaaatttca ttgctccaga atatgcatac aaaattgtca agaaagggga ctcaacaatt
841 atgaaaagtg aaatggagta tggccactgc aacaccaaat gtcaaactcc aataggggcg
901 ataaactcta gcatgccatt ccacaatata caccctctca ccatcgggga atgccccaaa
961 tacgtgaagt caaacaaatt agtccttgcg actgggctca gaaatagtcc tctaagagaa
1021 agaagaagaa aaagaggact atttggagct atagcagggt ttatagaggg aggatggcag
1081 ggaatggtag acggttggta tgggtatcat catagcaatg agcaggggag tgggtacgct
1141 gcagacaaag aatcaaccca aaaggcaata gatggagtta ccaataaggt caactcaatc
1201 attgacaaaa tgaacactca atttgaggcc gttggaaggg aatttaataa cttagaaagg
1261 agaatagaga atttaaacaa gaaaatggaa gacggattcc tagatgtctg gacttataat
1321 gctgaacttt tagttctcat ggaaaatgag agaactctag atttccatga ctcaaatgtc
1381 aagaaccttt acgacaaagt ccgactacag cttagggata atgcaaagga gctgggtaat
1441 ggttgtttcg agttctatca caaatgtgat aacgaatgta tggagagcgt aagaaatggg
1501 acgtatgact accctaagta ttcagaagaa gcaatattaa aaagagaaga aataagcgga
1561 gtgaaattag aatcaatagg aacttaccag atactgtcaa tttattcaac agtggcgagt
1621 tccctagcac tggcaatcat agtggctggt ctatctttat ggatgtgctc taatgggtcg
1681 ttacaatgta gaatttgcat ctaa

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Fri May 01, 2015 1:45 pm 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
EPI584079 A/turkey/BC/FAV14/2014 (A/H5N2) segment 4 (HA) 3142.3 0.000000e+00 1703/1704 (99%)
EPI573298 A/turkey/BC/FAV10/2014 (A/H5N2) segment 4 (HA) 3142.3 0.000000e+00 1703/1704 (99%)
EPI576470 A/chicken/BC/FAV8/2014 (A/H5N2) segment 4 (HA) 3136.7 0.000000e+00 1702/1704 (99%)
EPI576477 A/chicken/BC/FAV9/2014 (A/H5N2) segment 4 (HA) 3131.2 0.000000e+00 1701/1704 (99%)
EPI573281 A/turkey/Washington/61-22/2014 (A/H5N2) segment 4 (HA) 3131.2 0.000000e+00 1701/1704 (99%)
EPI569383 A/Northern pintail/Washington/40964/2014 (A/H5N2) segment 4 (HA) 3131.2 0.000000e+00 1701/1704 (99%)
EPI573271 A/chicken/Washington/61-9/2014 (A/H5N2) segment 4 (HA) 3125.7 0.000000e+00 1700/1704 (99%)
EPI573276 A/domestic duck/Washington/61-16/2014 (A/H5N2) segment 4 (HA) 3120.1 0.000000e+00 1699/1704 (99%)
EPI569390 A/gyrfalcon/Washington/41088-6/2014 (A/H5N8) segment 4 (HA) 3114.6 0.000000e+00 1698/1704 (99%)
EPI569376 A/guinea fowl/Oregon/41613-1/2014 (A/H5N8) segment 4 (HA) 3114.6 0.000000e+00 1698/1704 (99%)
EPI569372 A/chicken/Oregon/41613-2/2014 (A/H5N8) segment 4 (HA) 3114.6 0.000000e+00 1698/1704 (99%)
EPI573638 A/crane/Kagoshima/KU13/2014(H5N8) (A/H5N8) segment 4 (HA) 3098.0 0.000000e+00 1695/1704 (99%)
EPI573286 A/American green-winged teal/Washington/195750/2014 (A/H5N1) segment 4 (HA) 3092.4 0.000000e+00 1694/1704 (99%)
EPI553208 A/crane/Kagoshima/KU1/2014 (A/H5N8) segment 4 (HA) 3072.1 0.000000e+00 1689/1702 (99%)
EPI561570 A/Baikal teal/Korea/H96/2014 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%)
EPI561646 A/breeder duck/Korea/H249/2014 (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1690/1705 (99%)
EPI561626 A/mallard/Korea/H207/2014 (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1690/1705 (99%)
EPI561605 A/broiler duck/Korea/H145/2014 (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1690/1705 (99%)
EPI561591 A/breeder duck/Korea/H128/2014 (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1690/1705 (99%)
EPI561529 A/Baikal teal/Korea/H66/2014 (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1690/1705 (99%)
EPI561508 A/bean goose/Korea/H53/2014 (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1690/1705 (99%)
EPI561341 A/Baikal teal/Korea/H41/2014 (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1690/1705 (99%)
EPI561674 A/bean goose/Korea/H328/2014 (A/H5N8) segment 4 (HA) 3059.2 0.000000e+00 1689/1705 (99%)
EPI561612 A/breeder duck/Korea/H158/2014 (A/H5N8) segment 4 (HA) 3059.2 0.000000e+00 1689/1705 (99%)
EPI561577 A/breeder chicken/Korea/H122/2014 (A/H5N8) segment 4 (HA) 3059.2 0.000000e+00 1689/1705 (99%)
EPI561563 A/Baikal teal/Korea/H84/2014 (A/H5N8) segment 4 (HA) 3059.2 0.000000e+00 1689/1705 (99%)
EPI561542 A/Baikal teal/Korea/H68/2014 (A/H5N8) segment 4 (HA) 3059.2 0.000000e+00 1689/1705 (99%)
EPI561522 A/broiler duck/Korea/H65/2014 (A/H5N8) segment 4 (HA) 3059.2 0.000000e+00 1689/1705 (99%)
EPI561705 A/bean goose/Korea/H40/2014 (A/H5N8) segment 4 (HA) 3053.6 0.000000e+00 1688/1705 (99%)
EPI561667 A/mallard/Korea/H297/2014 (A/H5N8) segment 4 (HA) 3053.6 0.000000e+00 1689/1706 (99%)
EPI561653 A/breeder chicken/Korea/H250/2014 (A/H5N8) segment 4 (HA) 3053.6 0.000000e+00 1688/1705 (99%)
EPI561633 A/white-fronted goose/Korea/H231/2014 (A/H5N8) segment 4 (HA) 3053.6 0.000000e+00 1688/1705 (99%)
EPI509704 A/broiler duck/Korea/Buan2/2014 (A/H5N8) segment 4 (HA) 3053.6 0.000000e+00 1688/1705 (99%)
EPI573196 A/broiler duck/Korea/H651/2014 (A/H5N8) segment 4 (HA) 3048.1 0.000000e+00 1687/1705 (98%)
EPI573194 A/breeder chicken/Korea/H818/2014 (A/H5N8) segment 4 (HA) 3048.1 0.000000e+00 1687/1705 (98%)
EPI561697 A/spot-billed duck/Korea/H455-42/2014 (A/H5N8) segment 4 (HA) 3048.1 0.000000e+00 1687/1705 (98%)
EPI561681 A/tundra swan/Korea/H411/2014 (A/H5N8) segment 4 (HA) 3048.1 0.000000e+00 1687/1705 (98%)
EPI561660 A/Korean native chicken/Korea/H257/2014 (A/H5N8) segment 4 (HA) 3048.1 0.000000e+00 1687/1705 (98%)
EPI561598 A/broiler duck/Korea/H133/2014 (A/H5N8) segment 4 (HA) 3048.1 0.000000e+00 1687/1705 (98%)
EPI561360 A/broiler duck/Korea/H49/2014 (A/H5N8) segment 4 (HA) 3048.1 0.000000e+00 1687/1705 (98%)
EPI561348 A/broiler duck/Korea/H47/2014 (A/H5N8) segment 4 (HA) 3048.1 0.000000e+00 1687/1705 (98%)
EPI561336 A/broiler duck/Korea/H48/2014 (A/H5N8) segment 4 (HA) 3048.1 0.000000e+00 1687/1705 (98%)
EPI561204 A/broiler duck/Korea/H31/2014 (A/H5N8) segment 4 (HA) 3048.1 0.000000e+00 1687/1705 (98%)
EPI561196 A/broiler duck/Korea/H29/2014 (A/H5N8) segment 4 (HA) 3048.1 0.000000e+00 1687/1705 (98%)
EPI561187 A/waterfowl/Korea/S005/2014 (A/H5N8) segment 4 (HA) 3048.1 0.000000e+00 1687/1705 (98%)
EPI517161 A/Chicken/Kumamoto/1-7/2014 (A/H5N8) segment 4 (HA) 3048.1 0.000000e+00 1687/1705 (98%)
EPI573192 A/breeder chicken/Korea/H503/2014 (A/H5N8) segment 4 (HA) 3042.6 0.000000e+00 1686/1705 (98%)
EPI561690 A/common teal/Korea/H455-30/2014 (A/H5N8) segment 4 (HA) 3042.6 0.000000e+00 1686/1705 (98%)
EPI561556 A/Coot/Korea/H81/2014 (A/H5N8) segment 4 (HA) 3042.6 0.000000e+00 1686/1705 (98%)
EPI561549 A/Baikal teal/Korea/H80/2014 (A/H5N8) segment 4 (HA) 3042.6 0.000000e+00 1686/1705 (98%)
EPI561515 A/Baikal teal/Korea/H62/2014 (A/H5N8) segment 4 (HA) 3042.6 0.000000e+00 1686/1705 (98%)
EPI509709 A/baikal teal/Korea/Donglim3/2014 (A/H5N8) segment 4 (HA) 3042.6 0.000000e+00 1686/1705 (98%)
EPI573195 A/breeder chicken/Korea/H818/2014 (A/H5N8) segment 4 (HA) 3037.0 0.000000e+00 1685/1705 (98%)
EPI561619 A/breeder duck/Korea/H200/2014 (A/H5N8) segment 4 (HA) 3031.5 0.000000e+00 1685/1706 (98%)
EPI542628 A/mallard/Korea/W452/2014 (A/H5N8) segment 4 (HA) 3025.9 0.000000e+00 1683/1705 (98%)
EPI550849 A/duck/England/36226/14 (A/H5N8) segment 4 (HA) 3014.9 0.000000e+00 1681/1705 (98%)
EPI550848 A/duck/England/36038/14 (A/H5N8) segment 4 (HA) 3014.9 0.000000e+00 1681/1705 (98%)
EPI553349 A/wigeon/Sakha/1/2014 (A/H5N8) segment 4 (HA) 3009.3 0.000000e+00 1680/1705 (98%)
EPI547673 A/duck/England/36254/14 (A/H5N8) segment 4 (HA) 3003.8 0.000000e+00 1679/1705 (98%)
EPI552746 A/turkey/Germany/R2474-L00899/2014 (A/H5N8) segment 4 (HA) 2992.7 0.000000e+00 1677/1705 (98%)
EPI548493 A/duck/Chiba/26-372-61/2014 (A/H5N8) segment 4 (HA) 2992.7 0.000000e+00 1677/1705 (98%)
EPI548485 A/duck/Chiba/26-372-48/2014 (A/H5N8) segment 4 (HA) 2992.7 0.000000e+00 1677/1705 (98%)
EPI547678 A/Chicken/Netherlands/14015526/2014 (A/H5N8) segment 4 (HA) 2992.7 0.000000e+00 1677/1705 (98%)
EPI548623 A/chicken/Netherlands/14015531/2014 (A/H5N8) segment 4 (HA) 2987.2 0.000000e+00 1676/1705 (98%)
EPI553362 A/environment/Kagoshima/KU-ngr-H/2014 (A/H5N8) segment 4 (HA) 2981.6 0.000000e+00 1675/1705 (98%)
EPI553343 A/chicken/Miyazaki/7/2014 (A/H5N8) segment 4 (HA) 2981.6 0.000000e+00 1676/1706 (98%)
EPI573654 A/crane/Kagoshima/KU41/2014(H5N8) (A/H5N8) segment 4 (HA) 2976.1 0.000000e+00 1675/1706 (98%)
EPI573646 A/crane/Kagoshima/KU21/2014(H5N8) (A/H5N8) segment 4 (HA) 2976.1 0.000000e+00 1675/1706 (98%)
EPI573664 A/crane/Kagoshima/KU53/2015(H5N8) (A/H5N8) segment 4 (HA) 2970.5 0.000000e+00 1674/1706 (98%)
EPI544756 A/turkey/Germany-MV/R2472/2014 (A/H5N8) segment 4 (HA) 2970.5 0.000000e+00 1665/1693 (98%)
EPI573680 A/mallard duck/Kagoshima/KU116/2015(H5N8) (A/H5N8) segment 4 (HA) 2965.0 0.000000e+00 1673/1706 (98%)
EPI573672 A/mallard duck/Kagoshima/KU70/2015(H5N8) (A/H5N8) segment 4 (HA) 2965.0 0.000000e+00 1673/1706 (98%)
EPI568474 A/green-winged teal/Korea/KU-12/2015 (A/H5) segment 4 (HA) 2948.4 0.000000e+00 1660/1691 (98%)
EPI552776 A/chicken/Netherlands/emc-3/2014 (A/H5N8) segment 4 (HA) 2946.5 0.000000e+00 1655/1684 (98%)
EPI552768 A/eurasian wigeon/Netherlands/emc-2/2014 (A/H5N8) segment 4 (HA) 2946.5 0.000000e+00 1661/1693 (98%)
EPI552760 A/eurasian wigeon/Netherlands/emc-1/2014 (A/H5N8) segment 4 (HA) 2915.1 0.000000e+00 1627/1651 (98%)
EPI551149 A/eurasian wigeon/Netherlands/emc-2/2014 (A/H5N8) segment 4 (HA) 2905.9 0.000000e+00 1637/1668 (98%)
EPI543010 A/duck/Beijing/CT01/2014 (A/H5N8) segment 4 (HA) 2854.2 0.000000e+00 1588/1609 (98%)
EPI551143 A/eurasian wigeon/Netherlands/emc-1/2014 (A/H5N8) segment 4 (HA) 2843.1 0.000000e+00 1588/1612 (98%)
EPI543002 A/duck/Beijing/FS01/2014 (A/H5N8) segment 4 (HA) 2843.1 0.000000e+00 1587/1610 (98%)
EPI542617 A/duck/Beijing/FS01/2013 (A/H5N8) segment 4 (HA) 2837.6 0.000000e+00 1584/1609 (98%)
EPI442017 A/duck/Jiangsu/k1203/2010 (A/H5N8) segment 4 (HA) 2826.5 0.000000e+00 1650/1708 (96%)
EPI475579 A/wild duck/Shandong/628/2011 (A/H5N1) segment 4 (HA) 2821.0 0.000000e+00 1650/1709 (96%)
EPI399960 A/duck/Jiangsu/m234/2012 (A/H5N2) segment 4 (HA) 2782.2 0.000000e+00 1644/1710 (96%)
EPI398966 A/goose/Eastern China/1112/2011 (A/H5N2) segment 4 (HA) 2782.2 0.000000e+00 1643/1709 (96%)
EPI431456 A/duck/Hebei/3/2011 (A/H5N2) segment 4 (HA) 2771.1 0.000000e+00 1641/1709 (96%)
EPI398965 A/duck/Eastern China/1111/2011 (A/H5N2) segment 4 (HA) 2765.6 0.000000e+00 1640/1709 (95%)
EPI530054 A/duck/Jiangxi/95/2014 (A/H5N6) segment 4 (HA) 2754.5 0.000000e+00 1637/1708 (95%)
EPI544892 A/duck/Shandong/Q1/2013 (A/H5N8) segment 4 (HA) 2748.9 0.000000e+00 1639/1711 (95%)
EPI531456 A/duck/Guangdong/GD01/2014 (A/H5N6) segment 4 (HA) 2748.9 0.000000e+00 1636/1708 (95%)
EPI509698 A/breeder duck/Korea/Gochang1/2014 (A/H5N8) segment 4 (HA) 2748.9 0.000000e+00 1637/1709 (95%)
EPI561495 A/Baikal teal/Korea/H52/2014 (A/H5N8) segment 4 (HA) 2737.9 0.000000e+00 1635/1709 (95%)
EPI530985 A/duck/Zhejiang/W24/2013 (A/H5N8) segment 4 (HA) 2737.9 0.000000e+00 1633/1707 (95%)
EPI553144 A/turkey/Italy/14VIR7898-10/2014 (A/H5N8) segment 4 (HA) 2734.2 0.000000e+00 1524/1546 (98%)
EPI507673 A/mallard duck/Shanghai/SH-9/2013 (A/H5N8) segment 4 (HA) 2732.3 0.000000e+00 1633/1708 (95%)
EPI530063 A/environment/Shenzhen/25-24/2013 (A/H5N6) segment 4 (HA) 2726.8 0.000000e+00 1632/1708 (95%)
EPI530986 A/duck/Zhejiang/6D18/2013 (A/H5N8) segment 4 (HA) 2721.2 0.000000e+00 1632/1709 (95%)
EPI550768 A/duck/Laos/XBY004/2014 (A/H5N6) segment 4 (HA) 2715.7 0.000000e+00 1631/1709 (95%)
EPI550763 A/duck/Laos/XBY004/2014 (A/H5N6) segment 4 (HA) 2715.7 0.000000e+00 1631/1709 (95%)
EPI550759 A/chicken/Laos/XBY003/2014 (A/H5N6) segment 4 (HA) 2715.7 0.000000e+00 1631/1709 (95%)

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Fri May 01, 2015 1:47 pm 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
EPI584081 A/turkey/BC/FAV14/2014 (A/H5N2) segment 6 (NA) 2599.4 0.000000e+00 1409/1410 (99%)
EPI573282 A/turkey/Washington/61-22/2014 (A/H5N2) segment 6 (NA) 2593.8 0.000000e+00 1408/1410 (99%)
EPI573278 A/domestic duck/Washington/61-16/2014 (A/H5N2) segment 6 (NA) 2588.3 0.000000e+00 1407/1410 (99%)
EPI573273 A/chicken/Washington/61-9/2014 (A/H5N2) segment 6 (NA) 2588.3 0.000000e+00 1407/1410 (99%)
EPI569385 A/Northern pintail/Washington/40964/2014 (A/H5N2) segment 6 (NA) 2588.3 0.000000e+00 1407/1410 (99%)
EPI576479 A/chicken/BC/FAV9/2014 (A/H5N2) segment 6 (NA) 2582.7 0.000000e+00 1406/1410 (99%)
EPI576472 A/chicken/BC/FAV8/2014 (A/H5N2) segment 6 (NA) 2582.7 0.000000e+00 1406/1410 (99%)
EPI573300 A/turkey/BC/FAV10/2014 (A/H5N2) segment 6 (NA) 2582.7 0.000000e+00 1406/1410 (99%)
EPI418959 A/American green-winged teal/Wisconsin/10OS3127/2010 (A/H5N2) segment 6 (NA) 2505.2 0.000000e+00 1392/1410 (98%)
EPI512135 A/northern pintail/Mississippi/12OS420/2012 (A/H0) segment 6 (NA) 2499.6 0.000000e+00 1391/1410 (98%)
EPI450007 A/blue-winged teal/Louisiana/AI09-5234/2009 (A/H11N2) segment 6 (NA) 2499.6 0.000000e+00 1391/1410 (98%)
EPI418609 A/American green-winged teal/Mississippi/11OS98/2011 (A/H0) segment 6 (NA) 2488.6 0.000000e+00 1389/1410 (98%)
EPI332004 A/blue-winged teal/Guatemala/CIP049-10/2009 (A/H11N2) segment 6 (NA) 2488.6 0.000000e+00 1389/1410 (98%)
EPI331988 A/blue-winged teal/Guatemala/CIP049-03/2009 (A/H11N2) segment 6 (NA) 2488.6 0.000000e+00 1389/1410 (98%)
EPI512150 A/northern shoveler/Mississippi/12OS456/2012 (A/H14N2) segment 6 (NA) 2483.0 0.000000e+00 1388/1410 (98%)
EPI420145 A/northern shoveler/California/3676/2010 (A/H8N2) segment 6 (NA) 2483.0 0.000000e+00 1388/1410 (98%)
EPI419288 A/American wigeon/Iowa/10OS2748/2010 (A/H2N2) segment 6 (NA) 2483.0 0.000000e+00 1388/1410 (98%)
EPI418807 A/American green-winged teal/Illinois/10OS3589/2010 (A/H6N2) segment 6 (NA) 2483.0 0.000000e+00 1388/1410 (98%)
EPI418497 A/blue-winged teal/Illinois/10OS3610/2010 (A/H6N2) segment 6 (NA) 2483.0 0.000000e+00 1388/1410 (98%)
EPI418472 A/mallard/Illinois/10OS3245/2010 (A/H0) segment 6 (NA) 2483.0 0.000000e+00 1388/1410 (98%)
EPI387177 A/mallard/California/2396/2010 (A/H5N2) segment 6 (NA) 2483.0 0.000000e+00 1388/1410 (98%)
EPI333605 A/American green-winged teal/Mississippi/404/2010 (A/H0) segment 6 (NA) 2483.0 0.000000e+00 1388/1410 (98%)
EPI331996 A/blue-winged teal/Guatemala/CIP049-11/2009 (A/H11N2) segment 6 (NA) 2483.0 0.000000e+00 1388/1410 (98%)
EPI512531 A/gadwall/Mississippi/11OS6084/2011 (A/H11N2) segment 6 (NA) 2466.4 0.000000e+00 1385/1410 (98%)
EPI512524 A/northern shoveler/Mississippi/11OS6077/2011 (A/H11N2) segment 6 (NA) 2466.4 0.000000e+00 1385/1410 (98%)
EPI418721 A/mallard/Wisconsin/10OS2538/2010 (A/H3N2) segment 6 (NA) 2466.4 0.000000e+00 1385/1410 (98%)
EPI512591 A/northern shoveler/Mississippi/11OS5875/2011 (A/H5N2) segment 6 (NA) 2460.9 0.000000e+00 1384/1410 (98%)
EPI419077 A/mallard/Wisconsin/10OS3066/2010 (A/H6N2) segment 6 (NA) 2455.3 0.000000e+00 1383/1410 (98%)
EPI419118 A/mallard/Mississippi/10OS4593/2010 (A/H1N2) segment 6 (NA) 2449.8 0.000000e+00 1382/1410 (98%)
EPI221406 A/American green-winged teal/California/HKWF609/2007 (A/H5N2) segment 6 (NA) 2449.8 0.000000e+00 1382/1410 (98%)
EPI419654 A/gadwall/Missouri/10MO0280/2010 (A/H5N2) segment 6 (NA) 2444.2 0.000000e+00 1381/1410 (97%)
EPI419647 A/mallard/Missouri/10MO0253/2010 (A/H1N2) segment 6 (NA) 2444.2 0.000000e+00 1381/1410 (97%)
EPI419111 A/gadwall/Mississippi/10OS4531/2010 (A/H6N2) segment 6 (NA) 2444.2 0.000000e+00 1381/1410 (97%)
EPI419138 A/northern shoveler/Mississippi/10OS4526/2010 (A/H6N2) segment 6 (NA) 2438.7 0.000000e+00 1380/1410 (97%)
EPI413459 A/mallard/Ohio/11OS2213/2011 (A/H11N2) segment 6 (NA) 2438.7 0.000000e+00 1380/1410 (97%)
EPI328608 A/northern shoveler/California/8855/2008 (A/H5N2) segment 6 (NA) 2438.7 0.000000e+00 1380/1410 (97%)
EPI280744 A/avian/Missouri/466554-6/2006 (A/H5N2) segment 6 (NA) 2438.7 0.000000e+00 1380/1410 (97%)
EPI513011 A/northern pintail/Wisconsin/11OS4111/2011 (A/H6N2) segment 6 (NA) 2433.2 0.000000e+00 1380/1411 (97%)
EPI328639 A/mallard/California/11100/2008 (A/H11N2) segment 6 (NA) 2433.2 0.000000e+00 1379/1410 (97%)
EPI328582 A/northern shoveler/California/9680/2008 (A/H6N2) segment 6 (NA) 2433.2 0.000000e+00 1379/1410 (97%)
EPI328476 A/green-winged teal/California/11285/2008 (A/H0) segment 6 (NA) 2433.2 0.000000e+00 1379/1410 (97%)
EPI328156 A/mallard/California/11353/2008 (A/H10N2) segment 6 (NA) 2433.2 0.000000e+00 1379/1410 (97%)
EPI328489 A/green-winged teal/California/7972/2008 (A/H6N2) segment 6 (NA) 2427.6 0.000000e+00 1378/1410 (97%)
EPI328108 A/northern shoveler/California/9017/2008 (A/H11N2) segment 6 (NA) 2427.6 0.000000e+00 1378/1410 (97%)
EPI419755 A/northern shoveler/California/2815/2011 (A/H5N2) segment 6 (NA) 2422.1 0.000000e+00 1377/1410 (97%)
EPI327900 A/northern pintail/California/6791/2008 (A/H11N2) segment 6 (NA) 2422.1 0.000000e+00 1377/1410 (97%)
EPI420032 A/mallard/California/2571V/2011 (A/H0) segment 6 (NA) 2416.5 0.000000e+00 1376/1410 (97%)
EPI420024 A/mallard/California/2571P/2011 (A/H11N2) segment 6 (NA) 2416.5 0.000000e+00 1376/1410 (97%)
EPI418643 A/mallard/Illinois/10OS3249/2010 (A/H11N2) segment 6 (NA) 2416.5 0.000000e+00 1376/1410 (97%)
EPI334262 A/mallard/Iowa/3195/2009 (A/H0) segment 6 (NA) 2416.5 0.000000e+00 1377/1411 (97%)
EPI285601 A/wild bird/Wisconsin/433163-1/2006 (A/H5N2) segment 6 (NA) 2411.0 0.000000e+00 1375/1410 (97%)
EPI328316 A/mallard/California/6420/2008 (A/H6N2) segment 6 (NA) 2399.9 0.000000e+00 1374/1411 (97%)
EPI442430 A/brant/Alaska/44332-426/2007 (A/H10N2) segment 6 (NA) 2394.4 0.000000e+00 1372/1410 (97%)
EPI285602 A/wild bird/Wisconsin/439436-2/2006 (A/H5N2) segment 6 (NA) 2394.4 0.000000e+00 1372/1410 (97%)
EPI285592 A/wild bird/Wisconsin/439436/2006 (A/H5N2) segment 6 (NA) 2394.4 0.000000e+00 1372/1410 (97%)
EPI299469 A/American green-winged teal/Wisconsin/08OS2291/2008 (A/H3N2) segment 6 (NA) 2388.8 0.000000e+00 1371/1410 (97%)
EPI299389 A/gadwall/Wisconsin/08OS2293/2008 (A/H3N2) segment 6 (NA) 2388.8 0.000000e+00 1371/1410 (97%)
EPI299381 A/American green-winged teal/Wisconsin/08OS2292/2008 (A/H3N2) segment 6 (NA) 2388.8 0.000000e+00 1371/1410 (97%)
EPI280848 A/wild bird/Minnesota/460613-12/2006 (A/H5N2) segment 6 (NA) 2388.8 0.000000e+00 1371/1410 (97%)
EPI449517 A/mallard/Minnesota/Sg-00847/2008 (A/H0) segment 6 (NA) 2383.3 0.000000e+00 1370/1410 (97%)
EPI413390 A/mallard/Ohio/10OS1470/2010 (A/H3N2) segment 6 (NA) 2383.3 0.000000e+00 1370/1410 (97%)
EPI413383 A/mallard/Ohio/10OS1469/2010 (A/H3N2) segment 6 (NA) 2383.3 0.000000e+00 1370/1410 (97%)
EPI413369 A/mallard/Ohio/10OS1467/2010 (A/H3N2) segment 6 (NA) 2383.3 0.000000e+00 1370/1410 (97%)
EPI285597 A/mallard/NV/450206/2006 (A/H5N2) segment 6 (NA) 2383.3 0.000000e+00 1370/1410 (97%)
EPI285595 A/mallard/NV/449567-4/2006 (A/H5N2) segment 6 (NA) 2383.3 0.000000e+00 1370/1410 (97%)
EPI285594 A/mallard/NV/449567-2/2006 (A/H5N2) segment 6 (NA) 2383.3 0.000000e+00 1370/1410 (97%)
EPI280656 A/mallard/Arkansas/473507-9/2006 (A/H5N2) segment 6 (NA) 2383.3 0.000000e+00 1370/1410 (97%)
EPI280544 A/mallard/Nevada/450206-4/2006 (A/H5N2) segment 6 (NA) 2383.3 0.000000e+00 1370/1410 (97%)
EPI222394 A/northern pintail/Saskatchewan/22910/2007 (A/H3N2) segment 6 (NA) 2383.3 0.000000e+00 1370/1410 (97%)
EPI187901 A/mallard/Minnesota/Sg-00129/2007 (A/H6N2) segment 6 (NA) 2379.6 0.000000e+00 1362/1399 (97%)
EPI449695 A/green-winged teal/Minnesota/Sg-01073/2008 (A/H6N2) segment 6 (NA) 2377.8 0.000000e+00 1369/1410 (97%)
EPI449653 A/mallard/Minnesota/Sg-01040/2008 (A/H3N2) segment 6 (NA) 2377.8 0.000000e+00 1369/1410 (97%)
EPI285593 A/mallard/NV/449567-1/2006 (A/H5N2) segment 6 (NA) 2377.8 0.000000e+00 1369/1410 (97%)
EPI280552 A/mallard/Nevada/449567-3/2006 (A/H5N2) segment 6 (NA) 2377.8 0.000000e+00 1369/1410 (97%)
EPI76383 A/mallard/Maryland/182/2006 (A/H5N2) segment 6 (NA) 2377.8 0.000000e+00 1369/1410 (97%)
EPI512972 A/blue-winged teal/Wisconsin/11OS3052/2011 (A/H3N2) segment 6 (NA) 2372.2 0.000000e+00 1368/1410 (97%)
EPI512920 A/mallard/Wisconsin/11OS3106/2011 (A/H3N2) segment 6 (NA) 2372.2 0.000000e+00 1368/1410 (97%)
EPI512832 A/mallard/Wisconsin/11OS3491/2011 (A/H4N2) segment 6 (NA) 2372.2 0.000000e+00 1368/1410 (97%)
EPI512507 A/mallard/Wisconsin/11OS3171/2011 (A/H3N2) segment 6 (NA) 2372.2 0.000000e+00 1368/1410 (97%)
EPI419063 A/American green-winged teal/Wisconsin/10OS2955/2010 (A/H5N2) segment 6 (NA) 2372.2 0.000000e+00 1368/1410 (97%)
EPI334137 A/blue-winged teal/Wisconsin/3060/2009 (A/H3N2) segment 6 (NA) 2372.2 0.000000e+00 1368/1410 (97%)
EPI299648 A/American green-winged teal/Illinois/08OS2311/2008 (A/H0) segment 6 (NA) 2372.2 0.000000e+00 1369/1411 (97%)
EPI299477 A/gadwall/Wisconsin/08OS2296/2008 (A/H6N2) segment 6 (NA) 2372.2 0.000000e+00 1369/1411 (97%)
EPI285598 A/mallard/NV/453350-8/2006 (A/H5N2) segment 6 (NA) 2372.2 0.000000e+00 1368/1410 (97%)
EPI513071 A/American green-winged teal/Wisconsin/11OS3580/2011 (A/H12N2) segment 6 (NA) 2366.7 0.000000e+00 1367/1410 (96%)
EPI513025 A/blue-winged teal/Iowa/44555-551/2011 (A/H3N2) segment 6 (NA) 2366.7 0.000000e+00 1367/1410 (96%)
EPI512986 A/mallard/Wisconsin/11OS3079/2011 (A/H3N2) segment 6 (NA) 2366.7 0.000000e+00 1367/1410 (96%)
EPI455888 A/mallard/New Jersey/Sg-00884/2008 (A/H11N2) segment 6 (NA) 2366.7 0.000000e+00 1367/1410 (96%)
EPI419090 A/mallard/Wisconsin/10OS3067/2010 (A/H4N2) segment 6 (NA) 2366.7 0.000000e+00 1367/1410 (96%)
EPI413404 A/mallard/Michigan/10OS1497/2010 (A/H3N2) segment 6 (NA) 2366.7 0.000000e+00 1367/1410 (96%)
EPI285578 A/northern pintail/Wisconsin/462764/2006 (A/H5N2) segment 6 (NA) 2366.7 0.000000e+00 1367/1410 (96%)
EPI220636 A/mallard/South Dakota/Sg-00457/2008 (A/H4N2) segment 6 (NA) 2364.8 0.000000e+00 1360/1400 (97%)
EPI513141 A/American green-winged teal/Wisconsin/11OS3069/2011 (A/H0) segment 6 (NA) 2361.1 0.000000e+00 1366/1410 (96%)
EPI513105 A/mallard/Wisconsin/11OS4492/2011 (A/H4N2) segment 6 (NA) 2361.1 0.000000e+00 1366/1410 (96%)
EPI513085 A/mallard/Wisconsin/11OS4104/2011 (A/H1N2) segment 6 (NA) 2361.1 0.000000e+00 1366/1410 (96%)
EPI512955 A/greater scaup/Wisconsin/11OS5760/2011 (A/H10N2) segment 6 (NA) 2361.1 0.000000e+00 1366/1410 (96%)
EPI419070 A/mallard/Wisconsin/10OS3051/2010 (A/H4N2) segment 6 (NA) 2361.1 0.000000e+00 1366/1410 (96%)
EPI418714 A/mallard/Wisconsin/10OS2524/2010 (A/H11N2) segment 6 (NA) 2361.1 0.000000e+00 1366/1410 (96%)
EPI513133 A/mallard/Wisconsin/11OS4085/2011 (A/H0) segment 6 (NA) 2355.6 0.000000e+00 1365/1410 (96%)
EPI512993 A/mallard/Wisconsin/11OS3092/2011 (A/H3N2) segment 6 (NA) 2355.6 0.000000e+00 1365/1410 (96%)

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Fri May 01, 2015 1:49 pm 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
EPI584082 A/turkey/BC/FAV14/2014 (A/H5N2) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI576480 A/chicken/BC/FAV9/2014 (A/H5N2) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI576473 A/chicken/BC/FAV8/2014 (A/H5N2) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI573301 A/turkey/BC/FAV10/2014 (A/H5N2) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI569386 A/Northern pintail/Washington/40964/2014 (A/H5N2) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI561700 A/spot-billed duck/Korea/H455-42/2014 (A/H5N8) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI561693 A/common teal/Korea/H455-30/2014 (A/H5N8) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI561684 A/tundra swan/Korea/H411/2014 (A/H5N8) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI561677 A/bean goose/Korea/H328/2014 (A/H5N8) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI561670 A/mallard/Korea/H297/2014 (A/H5N8) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI561656 A/breeder chicken/Korea/H250/2014 (A/H5N8) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI561649 A/breeder duck/Korea/H249/2014 (A/H5N8) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI561636 A/white-fronted goose/Korea/H231/2014 (A/H5N8) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI561629 A/mallard/Korea/H207/2014 (A/H5N8) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI561622 A/breeder duck/Korea/H200/2014 (A/H5N8) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI561601 A/broiler duck/Korea/H133/2014 (A/H5N8) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI561594 A/breeder duck/Korea/H128/2014 (A/H5N8) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI561580 A/breeder chicken/Korea/H122/2014 (A/H5N8) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI561573 A/Baikal teal/Korea/H96/2014 (A/H5N8) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI561566 A/Baikal teal/Korea/H84/2014 (A/H5N8) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI561559 A/Coot/Korea/H81/2014 (A/H5N8) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI561552 A/Baikal teal/Korea/H80/2014 (A/H5N8) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI561532 A/Baikal teal/Korea/H66/2014 (A/H5N8) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI561525 A/broiler duck/Korea/H65/2014 (A/H5N8) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI561511 A/bean goose/Korea/H53/2014 (A/H5N8) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI561351 A/broiler duck/Korea/H47/2014 (A/H5N8) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI561344 A/Baikal teal/Korea/H41/2014 (A/H5N8) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI561211 A/broiler duck/Korea/H31/2014 (A/H5N8) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI561199 A/broiler duck/Korea/H29/2014 (A/H5N8) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI561190 A/waterfowl/Korea/S005/2014 (A/H5N8) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI553211 A/crane/Kagoshima/KU1/2014 (A/H5N8) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI542633 A/mallard/Korea/W452/2014 (A/H5N8) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI517164 A/Chicken/Kumamoto/1-7/2014 (A/H5N8) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI509756 A/baikal teal/Korea/Donglim3/2014 (A/H5N8) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI509711 A/broiler duck/Korea/Buan2/2014 (A/H5N8) segment 7 (MP) 1809.0 0.000000e+00 981/982 (99%)
EPI573289 A/American green-winged teal/Washington/195750/2014 (A/H5N1) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI569393 A/gyrfalcon/Washington/41088-6/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI568702 A/guinea fowl/Oregon/41613-1/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI568701 A/domestic duck/Washington/61-16/2014 (A/H5N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI568699 A/chicken/Oregon/41613-2/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI568698 A/turkey/Washington/61-22/2014 (A/H5N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI568697 A/chicken/Washington/61-9/2014 (A/H5N2) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI561708 A/bean goose/Korea/H40/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI561663 A/Korean native chicken/Korea/H257/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI561615 A/breeder duck/Korea/H158/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI561608 A/broiler duck/Korea/H145/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI561545 A/Baikal teal/Korea/H68/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI561518 A/Baikal teal/Korea/H62/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI561363 A/broiler duck/Korea/H49/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI561356 A/broiler duck/Korea/H48/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI554603 A/turkey/Germany-NI/R3372/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI553346 A/chicken/Miyazaki/7/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI552749 A/turkey/Germany/R2474-L00899/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI548627 A/chicken/Netherlands/14015531/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI547684 A/Chicken/Netherlands/14015526/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI573641 A/crane/Kagoshima/KU13/2014(H5N8) (A/H5N8) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI558012 A/duck/England/36038/14 (A/H5N8) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI558005 A/duck/England/36226/14 (A/H5N8) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI553365 A/environment/Kagoshima/KU-ngr-H/2014 (A/H5N8) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI548496 A/duck/Chiba/26-372-61/2014 (A/H5N8) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI548488 A/duck/Chiba/26-372-48/2014 (A/H5N8) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI547676 A/duck/England/36254/14 (A/H5N8) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI555124 A/domestic duck/Germany-NI/R3468/2014 (A/H5N8) segment 7 (MP) 1796.1 0.000000e+00 976/978 (99%)
EPI553181 A/turkey/Italy/14VIR7898-10/2014 (A/H5N8) segment 7 (MP) 1796.1 0.000000e+00 976/978 (99%)
EPI548426 A/turkey/Germany-MV/R2472/2014 (A/H5N8) segment 7 (MP) 1796.1 0.000000e+00 976/978 (99%)
EPI573683 A/mallard duck/Kagoshima/KU116/2015(H5N8) (A/H5N8) segment 7 (MP) 1792.4 0.000000e+00 978/982 (99%)
EPI573675 A/mallard duck/Kagoshima/KU70/2015(H5N8) (A/H5N8) segment 7 (MP) 1792.4 0.000000e+00 978/982 (99%)
EPI573667 A/crane/Kagoshima/KU53/2015(H5N8) (A/H5N8) segment 7 (MP) 1792.4 0.000000e+00 978/982 (99%)
EPI573657 A/crane/Kagoshima/KU41/2014(H5N8) (A/H5N8) segment 7 (MP) 1792.4 0.000000e+00 978/982 (99%)
EPI573649 A/crane/Kagoshima/KU21/2014(H5N8) (A/H5N8) segment 7 (MP) 1792.4 0.000000e+00 978/982 (99%)
EPI542997 A/duck/Beijing/FS01/2013 (A/H5N8) segment 7 (MP) 1792.4 0.000000e+00 976/979 (99%)
EPI543005 A/duck/Beijing/FS01/2014 (A/H5N8) segment 7 (MP) 1786.8 0.000000e+00 975/979 (99%)
EPI431451 A/duck/Hebei/2/2011 (A/H5N2) segment 7 (MP) 1764.7 0.000000e+00 973/982 (99%)
EPI414241 A/duck/Jiangsu/1-15/2011 (A/H4N2) segment 7 (MP) 1759.1 0.000000e+00 972/982 (98%)
EPI398977 A/duck/Eastern China/1111/2011 (A/H5N2) segment 7 (MP) 1759.1 0.000000e+00 972/982 (98%)
EPI552763 A/eurasian wigeon/Netherlands/emc-1/2014 (A/H5N8) segment 7 (MP) 1716.7 0.000000e+00 947/955 (99%)
EPI475582 A/wild duck/Shandong/628/2011 (A/H5N1) segment 7 (MP) 1714.8 0.000000e+00 964/982 (98%)
EPI399963 A/duck/Jiangsu/m234/2012 (A/H5N2) segment 7 (MP) 1709.3 0.000000e+00 963/982 (98%)
EPI328891 A/duck/Eastern China/909/2009 (A/H5N1) segment 7 (MP) 1709.3 0.000000e+00 963/982 (98%)
EPI328875 A/duck/Eastern China/031/2009 (A/H5N5) segment 7 (MP) 1709.3 0.000000e+00 963/982 (98%)
EPI328867 A/duck/Eastern China/008/2008 (A/H5N5) segment 7 (MP) 1709.3 0.000000e+00 963/982 (98%)
EPI328883 A/duck/Eastern China/108/2008 (A/H5N1) segment 7 (MP) 1703.7 0.000000e+00 962/982 (97%)
EPI442028 A/quail/Jiangsu/k0104/2010 (A/H5N5) segment 7 (MP) 1698.2 0.000000e+00 961/982 (97%)
EPI398978 A/goose/Eastern China/1112/2011 (A/H5N2) segment 7 (MP) 1698.2 0.000000e+00 961/982 (97%)
EPI442004 A/goose/Shandong/k1204/2009 (A/H5N5) segment 7 (MP) 1687.1 0.000000e+00 960/983 (97%)
EPI431459 A/duck/Hebei/3/2011 (A/H5N2) segment 7 (MP) 1681.6 0.000000e+00 958/982 (97%)
EPI552779 A/chicken/Netherlands/emc-3/2014 (A/H5N8) segment 7 (MP) 1677.9 0.000000e+00 912/914 (99%)
EPI442020 A/duck/Jiangsu/k1203/2010 (A/H5N8) segment 7 (MP) 1676.0 0.000000e+00 957/982 (97%)
EPI493836 A/duck/Guangdong/wy24/2008 (A/H5N5) segment 7 (MP) 1670.5 0.000000e+00 956/982 (97%)
EPI493820 A/duck/Guangdong/wy11/2008 (A/H5N5) segment 7 (MP) 1670.5 0.000000e+00 956/982 (97%)
EPI442012 A/goose/Guangdong/k0103/2010 (A/H5N5) segment 7 (MP) 1670.5 0.000000e+00 958/984 (97%)
EPI280107 A/Shanghai/1/2006 (A/H5N1) segment 7 (MP) 1670.5 0.000000e+00 956/982 (97%)
EPI280099 A/Guangdong/1/2006 (A/H5N1) segment 7 (MP) 1670.5 0.000000e+00 956/982 (97%)
EPI227312 A/Mallard/Huadong/lk/2005 (A/H5N1) segment 7 (MP) 1670.5 0.000000e+00 956/982 (97%)
EPI164233 A/Sichuan/2/2006 (A/H5N1) segment 7 (MP) 1670.5 0.000000e+00 956/982 (97%)
EPI164225 A/Sichuan/1/2006 (A/H5N1) segment 7 (MP) 1670.5 0.000000e+00 956/982 (97%)
EPI111857 A/chicken/Guiyang/3923/2005 (A/H5N1) segment 7 (MP) 1670.5 0.000000e+00 956/982 (97%)
EPI106032 A/China/GD01/2006 (A/H5N1) segment 7 (MP) 1670.5 0.000000e+00 956/982 (97%)
EPI552771 A/eurasian wigeon/Netherlands/emc-2/2014 (A/H5N8) segment 7 (MP) 1666.8 0.000000e+00 908/911 (99%)
EPI493828 A/duck/Guangdong/wy19/2008 (A/H5N5) segment 7 (MP) 1665.0 0.000000e+00 956/983 (97%)

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Fri May 01, 2015 1:50 pm 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
EPI573296 A/turkey/BC/FAV10/2014 (A/H5N2) segment 1 (PB2) 4194.9 0.000000e+00 2277/2280 (99%)
EPI573279 A/turkey/Washington/61-22/2014 (A/H5N2) segment 1 (PB2) 4194.9 0.000000e+00 2277/2280 (99%)
EPI573274 A/domestic duck/Washington/61-16/2014 (A/H5N2) segment 1 (PB2) 4194.9 0.000000e+00 2277/2280 (99%)
EPI584076 A/turkey/BC/FAV14/2014 (A/H5N2) segment 1 (PB2) 4189.3 0.000000e+00 2276/2280 (99%)
EPI576475 A/chicken/BC/FAV9/2014 (A/H5N2) segment 1 (PB2) 4189.3 0.000000e+00 2276/2280 (99%)
EPI576468 A/chicken/BC/FAV8/2014 (A/H5N2) segment 1 (PB2) 4189.3 0.000000e+00 2276/2280 (99%)
EPI573269 A/chicken/Washington/61-9/2014 (A/H5N2) segment 1 (PB2) 4189.3 0.000000e+00 2276/2280 (99%)
EPI569380 A/gyrfalcon/Washington/41088-6/2014 (A/H5N8) segment 1 (PB2) 4189.3 0.000000e+00 2276/2280 (99%)
EPI569379 A/Northern pintail/Washington/40964/2014 (A/H5N2) segment 1 (PB2) 4189.3 0.000000e+00 2276/2280 (99%)
EPI569369 A/guinea fowl/Oregon/41613-1/2014 (A/H5N8) segment 1 (PB2) 4183.8 0.000000e+00 2275/2280 (99%)
EPI569367 A/chicken/Oregon/41613-2/2014 (A/H5N8) segment 1 (PB2) 4183.8 0.000000e+00 2275/2280 (99%)
EPI573283 A/American green-winged teal/Washington/195750/2014 (A/H5N1) segment 1 (PB2) 4172.7 0.000000e+00 2273/2280 (99%)
EPI553205 A/crane/Kagoshima/KU1/2014 (A/H5N8) segment 1 (PB2) 4145.0 0.000000e+00 2268/2280 (99%)
EPI561702 A/bean goose/Korea/H40/2014 (A/H5N8) segment 1 (PB2) 4139.5 0.000000e+00 2267/2280 (99%)
EPI561672 A/bean goose/Korea/H328/2014 (A/H5N8) segment 1 (PB2) 4139.5 0.000000e+00 2267/2280 (99%)
EPI561631 A/white-fronted goose/Korea/H231/2014 (A/H5N8) segment 1 (PB2) 4139.5 0.000000e+00 2267/2280 (99%)
EPI561624 A/mallard/Korea/H207/2014 (A/H5N8) segment 1 (PB2) 4139.5 0.000000e+00 2267/2280 (99%)
EPI561568 A/Baikal teal/Korea/H96/2014 (A/H5N8) segment 1 (PB2) 4139.5 0.000000e+00 2267/2280 (99%)
EPI561540 A/Baikal teal/Korea/H68/2014 (A/H5N8) segment 1 (PB2) 4139.5 0.000000e+00 2267/2280 (99%)
EPI561527 A/Baikal teal/Korea/H66/2014 (A/H5N8) segment 1 (PB2) 4139.5 0.000000e+00 2267/2280 (99%)
EPI561506 A/bean goose/Korea/H53/2014 (A/H5N8) segment 1 (PB2) 4139.5 0.000000e+00 2267/2280 (99%)
EPI561358 A/broiler duck/Korea/H49/2014 (A/H5N8) segment 1 (PB2) 4139.5 0.000000e+00 2267/2280 (99%)
EPI561610 A/breeder duck/Korea/H158/2014 (A/H5N8) segment 1 (PB2) 4133.9 0.000000e+00 2266/2280 (99%)
EPI561603 A/broiler duck/Korea/H145/2014 (A/H5N8) segment 1 (PB2) 4133.9 0.000000e+00 2266/2280 (99%)
EPI561575 A/breeder chicken/Korea/H122/2014 (A/H5N8) segment 1 (PB2) 4133.9 0.000000e+00 2266/2280 (99%)
EPI561561 A/Baikal teal/Korea/H84/2014 (A/H5N8) segment 1 (PB2) 4133.9 0.000000e+00 2266/2280 (99%)
EPI561513 A/Baikal teal/Korea/H62/2014 (A/H5N8) segment 1 (PB2) 4133.9 0.000000e+00 2266/2280 (99%)
EPI561353 A/broiler duck/Korea/H48/2014 (A/H5N8) segment 1 (PB2) 4133.9 0.000000e+00 2266/2280 (99%)
EPI561339 A/Baikal teal/Korea/H41/2014 (A/H5N8) segment 1 (PB2) 4133.9 0.000000e+00 2266/2280 (99%)
EPI573635 A/crane/Kagoshima/KU13/2014(H5N8) (A/H5N8) segment 1 (PB2) 4128.4 0.000000e+00 2265/2280 (99%)
EPI561679 A/tundra swan/Korea/H411/2014 (A/H5N8) segment 1 (PB2) 4128.4 0.000000e+00 2265/2280 (99%)
EPI561665 A/mallard/Korea/H297/2014 (A/H5N8) segment 1 (PB2) 4128.4 0.000000e+00 2265/2280 (99%)
EPI561651 A/breeder chicken/Korea/H250/2014 (A/H5N8) segment 1 (PB2) 4128.4 0.000000e+00 2265/2280 (99%)
EPI561644 A/breeder duck/Korea/H249/2014 (A/H5N8) segment 1 (PB2) 4128.4 0.000000e+00 2265/2280 (99%)
EPI561596 A/broiler duck/Korea/H133/2014 (A/H5N8) segment 1 (PB2) 4128.4 0.000000e+00 2265/2280 (99%)
EPI561589 A/breeder duck/Korea/H128/2014 (A/H5N8) segment 1 (PB2) 4128.4 0.000000e+00 2265/2280 (99%)
EPI561554 A/Coot/Korea/H81/2014 (A/H5N8) segment 1 (PB2) 4128.4 0.000000e+00 2265/2280 (99%)
EPI561547 A/Baikal teal/Korea/H80/2014 (A/H5N8) segment 1 (PB2) 4128.4 0.000000e+00 2265/2280 (99%)
EPI561520 A/broiler duck/Korea/H65/2014 (A/H5N8) segment 1 (PB2) 4128.4 0.000000e+00 2265/2280 (99%)
EPI561346 A/broiler duck/Korea/H47/2014 (A/H5N8) segment 1 (PB2) 4128.4 0.000000e+00 2265/2280 (99%)
EPI561201 A/broiler duck/Korea/H31/2014 (A/H5N8) segment 1 (PB2) 4128.4 0.000000e+00 2265/2280 (99%)
EPI561194 A/broiler duck/Korea/H29/2014 (A/H5N8) segment 1 (PB2) 4128.4 0.000000e+00 2265/2280 (99%)
EPI561185 A/waterfowl/Korea/S005/2014 (A/H5N8) segment 1 (PB2) 4128.4 0.000000e+00 2265/2280 (99%)
EPI542630 A/mallard/Korea/W452/2014 (A/H5N8) segment 1 (PB2) 4128.4 0.000000e+00 2265/2280 (99%)
EPI509707 A/baikal teal/Korea/Donglim3/2014 (A/H5N8) segment 1 (PB2) 4128.4 0.000000e+00 2265/2280 (99%)
EPI509702 A/broiler duck/Korea/Buan2/2014 (A/H5N8) segment 1 (PB2) 4128.4 0.000000e+00 2265/2280 (99%)
EPI561695 A/spot-billed duck/Korea/H455-42/2014 (A/H5N8) segment 1 (PB2) 4122.8 0.000000e+00 2264/2280 (99%)
EPI561658 A/Korean native chicken/Korea/H257/2014 (A/H5N8) segment 1 (PB2) 4122.8 0.000000e+00 2264/2280 (99%)
EPI561617 A/breeder duck/Korea/H200/2014 (A/H5N8) segment 1 (PB2) 4122.8 0.000000e+00 2264/2280 (99%)
EPI517158 A/Chicken/Kumamoto/1-7/2014 (A/H5N8) segment 1 (PB2) 4122.8 0.000000e+00 2264/2280 (99%)
EPI561688 A/common teal/Korea/H455-30/2014 (A/H5N8) segment 1 (PB2) 4117.3 0.000000e+00 2263/2280 (99%)
EPI553340 A/chicken/Miyazaki/7/2014 (A/H5N8) segment 1 (PB2) 4089.6 0.000000e+00 2258/2280 (99%)
EPI547679 A/Chicken/Netherlands/14015526/2014 (A/H5N8) segment 1 (PB2) 4089.6 0.000000e+00 2258/2280 (99%)
EPI552743 A/turkey/Germany/R2474-L00899/2014 (A/H5N8) segment 1 (PB2) 4084.1 0.000000e+00 2257/2280 (98%)
EPI548620 A/chicken/Netherlands/14015531/2014 (A/H5N8) segment 1 (PB2) 4084.1 0.000000e+00 2257/2280 (98%)
EPI547670 A/duck/England/36254/14 (A/H5N8) segment 1 (PB2) 4084.1 0.000000e+00 2257/2280 (98%)
EPI573651 A/crane/Kagoshima/KU41/2014(H5N8) (A/H5N8) segment 1 (PB2) 4078.5 0.000000e+00 2256/2280 (98%)
EPI573643 A/crane/Kagoshima/KU21/2014(H5N8) (A/H5N8) segment 1 (PB2) 4078.5 0.000000e+00 2256/2280 (98%)
EPI558008 A/duck/England/36038/14 (A/H5N8) segment 1 (PB2) 4078.5 0.000000e+00 2256/2280 (98%)
EPI558001 A/duck/England/36226/14 (A/H5N8) segment 1 (PB2) 4078.5 0.000000e+00 2256/2280 (98%)
EPI548490 A/duck/Chiba/26-372-61/2014 (A/H5N8) segment 1 (PB2) 4078.5 0.000000e+00 2256/2280 (98%)
EPI548482 A/duck/Chiba/26-372-48/2014 (A/H5N8) segment 1 (PB2) 4078.5 0.000000e+00 2256/2280 (98%)
EPI543007 A/duck/Beijing/CT01/2014 (A/H5N8) segment 1 (PB2) 4074.8 0.000000e+00 2252/2277 (98%)
EPI573669 A/mallard duck/Kagoshima/KU70/2015(H5N8) (A/H5N8) segment 1 (PB2) 4073.0 0.000000e+00 2255/2280 (98%)
EPI573661 A/crane/Kagoshima/KU53/2015(H5N8) (A/H5N8) segment 1 (PB2) 4073.0 0.000000e+00 2255/2280 (98%)
EPI573677 A/mallard duck/Kagoshima/KU116/2015(H5N8) (A/H5N8) segment 1 (PB2) 4067.4 0.000000e+00 2253/2279 (98%)
EPI542999 A/duck/Beijing/FS01/2014 (A/H5N8) segment 1 (PB2) 4065.6 0.000000e+00 2249/2277 (98%)
EPI553359 A/environment/Kagoshima/KU-ngr-H/2014 (A/H5N8) segment 1 (PB2) 4061.9 0.000000e+00 2253/2280 (98%)
EPI553186 A/turkey/Italy/14VIR7898-10/2014 (A/H5N8) segment 1 (PB2) 4028.7 0.000000e+00 2232/2258 (98%)
EPI552773 A/chicken/Netherlands/emc-3/2014 (A/H5N8) segment 1 (PB2) 4028.7 0.000000e+00 2231/2256 (98%)
EPI552765 A/eurasian wigeon/Netherlands/emc-2/2014 (A/H5N8) segment 1 (PB2) 3991.7 0.000000e+00 2203/2224 (99%)
EPI475576 A/wild duck/Shandong/628/2011 (A/H5N1) segment 1 (PB2) 3984.3 0.000000e+00 2239/2280 (98%)
EPI552757 A/eurasian wigeon/Netherlands/emc-1/2014 (A/H5N8) segment 1 (PB2) 3982.5 0.000000e+00 2202/2225 (98%)
EPI442014 A/duck/Jiangsu/k1203/2010 (A/H5N8) segment 1 (PB2) 3967.7 0.000000e+00 2226/2265 (98%)
EPI399957 A/duck/Jiangsu/m234/2012 (A/H5N2) segment 1 (PB2) 3951.1 0.000000e+00 2233/2280 (97%)
EPI544889 A/duck/Shandong/Q1/2013 (A/H5N8) segment 1 (PB2) 3938.2 0.000000e+00 2230/2279 (97%)
EPI493814 A/duck/Guangdong/wy11/2008 (A/H5N5) segment 1 (PB2) 3868.0 0.000000e+00 2219/2281 (97%)
EPI493822 A/duck/Guangdong/wy19/2008 (A/H5N5) segment 1 (PB2) 3856.9 0.000000e+00 2216/2280 (97%)
EPI548431 A/turkey/Germany-MV/R2472/2014 (A/H5N8) segment 1 (PB2) 3784.9 0.000000e+00 2090/2111 (99%)
EPI493830 A/duck/Guangdong/wy24/2008 (A/H5N5) segment 1 (PB2) 3784.9 0.000000e+00 2203/2280 (96%)
EPI328897 A/duck/Eastern China/909/2009 (A/H5N1) segment 1 (PB2) 3729.5 0.000000e+00 2193/2280 (96%)
EPI328889 A/duck/Eastern China/108/2008 (A/H5N1) segment 1 (PB2) 3724.0 0.000000e+00 2192/2280 (96%)
EPI328881 A/duck/Eastern China/031/2009 (A/H5N5) segment 1 (PB2) 3724.0 0.000000e+00 2192/2280 (96%)
EPI328873 A/duck/Eastern China/008/2008 (A/H5N5) segment 1 (PB2) 3724.0 0.000000e+00 2192/2280 (96%)
EPI441998 A/goose/Shandong/k1204/2009 (A/H5N5) segment 1 (PB2) 3690.7 0.000000e+00 2188/2282 (95%)
EPI442006 A/goose/Guangdong/k0103/2010 (A/H5N5) segment 1 (PB2) 3685.2 0.000000e+00 2186/2281 (95%)
EPI398954 A/goose/Eastern China/1112/2011 (A/H5N2) segment 1 (PB2) 3646.4 0.000000e+00 2179/2281 (95%)
EPI431453 A/duck/Hebei/3/2011 (A/H5N2) segment 1 (PB2) 3629.8 0.000000e+00 2177/2282 (95%)
EPI431445 A/duck/Hebei/2/2011 (A/H5N2) segment 1 (PB2) 3629.8 0.000000e+00 2176/2281 (95%)
EPI414235 A/duck/Jiangsu/1-15/2011 (A/H4N2) segment 1 (PB2) 3629.8 0.000000e+00 2177/2282 (95%)
EPI398953 A/duck/Eastern China/1111/2011 (A/H5N2) segment 1 (PB2) 3596.5 0.000000e+00 2171/2282 (95%)
EPI326731 A/environment/Korea/CSM3/2002 (A/H3N6) segment 1 (PB2) 3596.5 0.000000e+00 2166/2275 (95%)
EPI387471 A/canvasback/Mongolia/2-69/2007 (A/H10) segment 1 (PB2) 3581.8 0.000000e+00 2167/2280 (95%)
EPI387371 A/whooper swan/Mongolia/1-14/2007 (A/H3N8) segment 1 (PB2) 3581.8 0.000000e+00 2167/2280 (95%)
EPI387468 A/ruddy shelduck/Mongolia/2-29/2007 (A/H3N2) segment 1 (PB2) 3576.2 0.000000e+00 2166/2280 (95%)
EPI387467 A/pintail/Mongolia/2-11/2007 (A/H4N2) segment 1 (PB2) 3568.8 0.000000e+00 2164/2279 (94%)
EPI387473 A/pintail/Mongolia/2-80/2007 (A/H4N6) segment 1 (PB2) 3567.0 0.000000e+00 2161/2275 (94%)
EPI272278 A/duck/Korea/A14/2008 (A/H5N2) segment 1 (PB2) 3557.8 0.000000e+00 2164/2282 (94%)
EPI387375 A/whooper swan/Mongolia/1-25/2007 (A/H3N8) segment 1 (PB2) 3552.2 0.000000e+00 2162/2280 (94%)
EPI469140 A/duck/Guangdong/4323/2007 (A/H11N9) segment 1 (PB2) 3550.4 0.000000e+00 2162/2282 (94%)

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Fri May 01, 2015 1:52 pm 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
EPI584077 A/turkey/BC/FAV14/2014 (A/H5N2) segment 2 (PB1) 4194.9 0.000000e+00 2273/2274 (99%)
EPI569364 A/turkey/Washington/61-22/2014 (A/H5N2) segment 2 (PB1) 4194.9 0.000000e+00 2273/2274 (99%)
EPI576469 A/chicken/BC/FAV8/2014 (A/H5N2) segment 2 (PB1) 4189.3 0.000000e+00 2272/2274 (99%)
EPI569381 A/Northern pintail/Washington/40964/2014 (A/H5N2) segment 2 (PB1) 4189.3 0.000000e+00 2272/2274 (99%)
EPI576476 A/chicken/BC/FAV9/2014 (A/H5N2) segment 2 (PB1) 4183.8 0.000000e+00 2271/2274 (99%)
EPI573297 A/turkey/BC/FAV10/2014 (A/H5N2) segment 2 (PB1) 4183.8 0.000000e+00 2271/2274 (99%)
EPI573275 A/domestic duck/Washington/61-16/2014 (A/H5N2) segment 2 (PB1) 4183.8 0.000000e+00 2271/2274 (99%)
EPI573270 A/chicken/Washington/61-9/2014 (A/H5N2) segment 2 (PB1) 4183.8 0.000000e+00 2271/2274 (99%)
EPI420193 A/bufflehead/California/3118/2011 (A/H4N8) segment 2 (PB1) 4078.5 0.000000e+00 2252/2274 (99%)
EPI418616 A/American green-winged teal/Mississippi/11OS98/2011 (A/H0) segment 2 (PB1) 4067.4 0.000000e+00 2250/2274 (98%)
EPI512660 A/wood duck/Wisconsin/11OS3443/2011 (A/H11N9) segment 2 (PB1) 4056.4 0.000000e+00 2248/2274 (98%)
EPI512230 A/mallard/Arkansas/12OS179/2012 (A/H1N1) segment 2 (PB1) 4056.4 0.000000e+00 2248/2274 (98%)
EPI436582 A/American green-winged teal/Interior Alaska/10BM05376R0/2010 (A/H3N8) segment 2 (PB1) 4056.4 0.000000e+00 2248/2274 (98%)
EPI418963 A/American green-winged teal/Wisconsin/10OS3127/2010 (A/H5N2) segment 2 (PB1) 4056.4 0.000000e+00 2248/2274 (98%)
EPI453910 A/northern pintail/Interior Alaska/10BM10298R0/2010 (A/H3N8) segment 2 (PB1) 4050.8 0.000000e+00 2247/2274 (98%)
EPI436612 A/northern shoveler/Interior Alaska/10BM05487R0/2010 (A/H3N8) segment 2 (PB1) 4050.8 0.000000e+00 2247/2274 (98%)
EPI436589 A/northern shoveler/Interior Alaska/10BM05382R0/2010 (A/H3N8) segment 2 (PB1) 4050.8 0.000000e+00 2247/2274 (98%)
EPI387181 A/mallard/California/2396/2010 (A/H5N2) segment 2 (PB1) 4050.8 0.000000e+00 2247/2274 (98%)
EPI512474 A/blue-winged teal/Missouri/11OS2563/2011 (A/H12N4) segment 2 (PB1) 4045.3 0.000000e+00 2246/2274 (98%)
EPI452523 A/northern pintail/Interior Alaska/10BM12413R0/2010 (A/H8N4) segment 2 (PB1) 4045.3 0.000000e+00 2246/2274 (98%)
EPI451651 A/mallard/Interior Alaska/10BM07575R0/2010 (A/H7N3) segment 2 (PB1) 4045.3 0.000000e+00 2246/2274 (98%)
EPI436619 A/northern shoveler/Interior Alaska/10BM05491R0/2010 (A/H3N8) segment 2 (PB1) 4045.3 0.000000e+00 2246/2274 (98%)
EPI433197 A/mallard/Interior Alaska/10BM04564R1/2010 (A/H7N3) segment 2 (PB1) 4045.3 0.000000e+00 2246/2274 (98%)
EPI420073 A/mallard/California/2578V/2011 (A/H0) segment 2 (PB1) 4039.7 0.000000e+00 2245/2274 (98%)
EPI419953 A/mallard/California/2559P/2011 (A/H5N8) segment 2 (PB1) 4039.7 0.000000e+00 2245/2274 (98%)
EPI419909 A/mallard/California/2552V/2011 (A/H4N8) segment 2 (PB1) 4039.7 0.000000e+00 2245/2274 (98%)
EPI419869 A/mallard/California/2542V/2011 (A/H5N1) segment 2 (PB1) 4039.7 0.000000e+00 2245/2274 (98%)
EPI419842 A/mallard/California/2536P/2011 (A/H5N1) segment 2 (PB1) 4039.7 0.000000e+00 2245/2274 (98%)
EPI419835 A/mallard/California/2535V/2011 (A/H5N1) segment 2 (PB1) 4039.7 0.000000e+00 2245/2274 (98%)
EPI419828 A/mallard/California/2535P/2011 (A/H5N1) segment 2 (PB1) 4039.7 0.000000e+00 2245/2274 (98%)
EPI398563 A/chicken/Jalisco/12283/2012 (A/H7N3) segment 2 (PB1) 4039.7 0.000000e+00 2245/2274 (98%)
EPI513088 A/mallard/Wisconsin/11OS4104/2011 (A/H1N2) segment 2 (PB1) 4034.2 0.000000e+00 2244/2274 (98%)
EPI512676 A/mallard/Wisconsin/11OS3468/2011 (A/H2N3) segment 2 (PB1) 4034.2 0.000000e+00 2244/2274 (98%)
EPI420142 A/mallard/California/2595V/2011 (A/H12N5) segment 2 (PB1) 4034.2 0.000000e+00 2244/2274 (98%)
EPI420135 A/mallard/California/2595P/2011 (A/H12N5) segment 2 (PB1) 4034.2 0.000000e+00 2244/2274 (98%)
EPI420114 A/mallard/California/2590V/2011 (A/H4N6) segment 2 (PB1) 4034.2 0.000000e+00 2244/2274 (98%)
EPI420087 A/mallard/California/2584V/2011 (A/H4N9) segment 2 (PB1) 4034.2 0.000000e+00 2244/2274 (98%)
EPI420080 A/mallard/California/2584P/2011 (A/H4N9) segment 2 (PB1) 4034.2 0.000000e+00 2244/2274 (98%)
EPI419939 A/mallard/California/2555V/2011 (A/H11N9) segment 2 (PB1) 4034.2 0.000000e+00 2244/2274 (98%)
EPI419916 A/mallard/California/2555P/2011 (A/H11N9) segment 2 (PB1) 4034.2 0.000000e+00 2244/2274 (98%)
EPI419807 A/mallard/California/2531V/2011 (A/H5N1) segment 2 (PB1) 4034.2 0.000000e+00 2244/2274 (98%)
EPI419794 A/mallard/California/2531P/2011 (A/H5N1) segment 2 (PB1) 4034.2 0.000000e+00 2244/2274 (98%)
EPI419786 A/mallard/California/2527V/2011 (A/H5N1) segment 2 (PB1) 4034.2 0.000000e+00 2244/2274 (98%)
EPI387271 A/northern shoveler/California/3628/2011 (A/H10) segment 2 (PB1) 4034.2 0.000000e+00 2244/2274 (98%)
EPI527489 A/blue-winged teal/TX/AI13-1028/2013 (A/H14N5) segment 2 (PB1) 4028.7 0.000000e+00 2243/2274 (98%)
EPI420128 A/mallard/California/2594V/2011 (A/H4N6) segment 2 (PB1) 4028.7 0.000000e+00 2243/2274 (98%)
EPI420121 A/mallard/California/2594P/2011 (A/H4N6) segment 2 (PB1) 4028.7 0.000000e+00 2243/2274 (98%)
EPI420101 A/mallard/California/2589V/2011 (A/H4N1) segment 2 (PB1) 4028.7 0.000000e+00 2243/2274 (98%)
EPI420094 A/mallard/California/2589P/2011 (A/H4N1) segment 2 (PB1) 4028.7 0.000000e+00 2243/2274 (98%)
EPI419855 A/mallard/California/2536V/2011 (A/H5N1) segment 2 (PB1) 4028.7 0.000000e+00 2243/2274 (98%)
EPI419821 A/mallard/California/2533V/2011 (A/H4N6) segment 2 (PB1) 4028.7 0.000000e+00 2243/2274 (98%)
EPI419779 A/mallard/California/2525P/2011 (A/H4N6) segment 2 (PB1) 4028.7 0.000000e+00 2243/2274 (98%)
EPI418440 A/mallard/California/2525V/2011 (A/H0) segment 2 (PB1) 4028.7 0.000000e+00 2243/2274 (98%)
EPI531395 A/blue-winged teal/Guatemala/CIP049H105-15/2011 (A/H14N3) segment 2 (PB1) 4023.1 0.000000e+00 2242/2274 (98%)
EPI531387 A/blue-winged teal/Guatemala/CIP049H106-62/2011 (A/H14N6) segment 2 (PB1) 4023.1 0.000000e+00 2242/2274 (98%)
EPI513151 A/northern shoveler/Wisconsin/11OS4631/2011 (A/H0) segment 2 (PB1) 4023.1 0.000000e+00 2242/2274 (98%)
EPI512252 A/northern shoveler/Mississippi/12OS231/2012 (A/H0) segment 2 (PB1) 4023.1 0.000000e+00 2242/2274 (98%)
EPI449635 A/mallard/Minnesota/Sg-01034/2008 (A/H11N2) segment 2 (PB1) 4023.1 0.000000e+00 2242/2274 (98%)
EPI420214 A/green-winged teal/California/123/2012 (A/H1N1) segment 2 (PB1) 4023.1 0.000000e+00 2242/2274 (98%)
EPI419981 A/mallard/California/2566P/2011 (A/H4N8) segment 2 (PB1) 4023.1 0.000000e+00 2242/2274 (98%)
EPI419974 A/mallard/California/2563V/2011 (A/H4N6) segment 2 (PB1) 4023.1 0.000000e+00 2242/2274 (98%)
EPI419967 A/mallard/California/2563P/2011 (A/H4N6) segment 2 (PB1) 4023.1 0.000000e+00 2242/2274 (98%)
EPI512871 A/northern pintail/Wisconsin/11OS3299/2011 (A/H4N6) segment 2 (PB1) 4017.6 0.000000e+00 2241/2274 (98%)
EPI512587 A/American green-winged teal/Mississippi/11OS5869/2011 (A/H4N6) segment 2 (PB1) 4017.6 0.000000e+00 2241/2274 (98%)
EPI512355 A/mallard/Illinois/11OS4420/2011 (A/H2N3) segment 2 (PB1) 4012.0 0.000000e+00 2240/2274 (98%)
EPI512726 A/American green-winged teal/Wisconsin/11OS3425/2011 (A/H12N5) segment 2 (PB1) 4006.5 0.000000e+00 2239/2274 (98%)
EPI512185 A/northern shoveler/Mississippi/12OS347/2012 (A/H7N7) segment 2 (PB1) 4006.5 0.000000e+00 2239/2274 (98%)
EPI512139 A/northern pintail/Mississippi/12OS420/2012 (A/H0) segment 2 (PB1) 4006.5 0.000000e+00 2239/2274 (98%)
EPI333682 A/mallard/Ohio/1695/2009 (A/H4N6) segment 2 (PB1) 4006.5 0.000000e+00 2239/2274 (98%)
EPI419590 A/blue-winged teal/Missouri/10MO0011/2010 (A/H3N6) segment 2 (PB1) 4001.0 0.000000e+00 2238/2274 (98%)
EPI393386 A/Mexico/InDRE7218/2012 (A/H7N3) segment 2 (PB1) 3995.4 0.000000e+00 2237/2274 (98%)
EPI299489 A/mallard/Illinois/08OS2315/2008 (A/H4N6) segment 2 (PB1) 3995.4 0.000000e+00 2237/2274 (98%)
EPI449684 A/ring-necked duck/Minnesota/Sg-01066/2008 (A/H12N8) segment 2 (PB1) 3984.3 0.000000e+00 2235/2274 (98%)
EPI448650 A/blue-winged teal/North Dakota/Sg-00706/2008 (A/H4N6) segment 2 (PB1) 3984.3 0.000000e+00 2235/2274 (98%)
EPI448643 A/mallard/North Dakota/Sg-00703/2008 (A/H12N4) segment 2 (PB1) 3984.3 0.000000e+00 2235/2274 (98%)
EPI188754 A/mallard/North Dakota/Sg-00703/2008 (A/H12N4) segment 2 (PB1) 3984.3 0.000000e+00 2235/2274 (98%)
EPI227361 A/mallard/Quebec/16566/2005 (A/H11N2) segment 2 (PB1) 3978.8 0.000000e+00 2234/2274 (98%)
EPI512401 A/blue-winged teal/Missouri/11OS2585/2011 (A/H4N8) segment 2 (PB1) 3973.3 0.000000e+00 2233/2274 (98%)
EPI419081 A/mallard/Wisconsin/10OS3066/2010 (A/H6N2) segment 2 (PB1) 3973.3 0.000000e+00 2233/2274 (98%)
EPI418706 A/American green-winged teal/Illinois/10OS1598/2010 (A/H4N8) segment 2 (PB1) 3973.3 0.000000e+00 2233/2274 (98%)
EPI333882 A/blue-winged teal/Wisconsin/2649/2009 (A/H6N1) segment 2 (PB1) 3973.3 0.000000e+00 2233/2274 (98%)
EPI69001 A/environment/Maryland/763/2006 (A/H11N9) segment 2 (PB1) 3973.3 0.000000e+00 2233/2274 (98%)
EPI542115 A/mallard/Alaska/ND0006301/2013 (A/H3N8) segment 2 (PB1) 3967.7 0.000000e+00 2232/2274 (98%)
EPI512534 A/gadwall/Mississippi/11OS6084/2011 (A/H11N2) segment 2 (PB1) 3967.7 0.000000e+00 2232/2274 (98%)
EPI512527 A/northern shoveler/Mississippi/11OS6077/2011 (A/H11N2) segment 2 (PB1) 3967.7 0.000000e+00 2232/2274 (98%)
EPI512297 A/mallard/Arkansas/12OS140/2012 (A/H11N3) segment 2 (PB1) 3967.7 0.000000e+00 2233/2275 (98%)
EPI512244 A/American green-winged teal/Mississippi/12OS191/2012 (A/H5N3) segment 2 (PB1) 3967.7 0.000000e+00 2233/2275 (98%)
EPI435694 A/mallard/Alberta/65/2004 (A/H10N7) segment 2 (PB1) 3967.7 0.000000e+00 2232/2274 (98%)
EPI438118 A/mallard/Alberta/56/2004 (A/H10N7) segment 2 (PB1) 3962.2 0.000000e+00 2231/2274 (98%)
EPI435708 A/mallard/Alberta/67/2004 (A/H10N7) segment 2 (PB1) 3962.2 0.000000e+00 2231/2274 (98%)
EPI435687 A/mallard/Alberta/62/2004 (A/H10N7) segment 2 (PB1) 3962.2 0.000000e+00 2231/2274 (98%)
EPI188436 A/mallard/Minnesota/Sg-00579/2008 (A/H1N1) segment 2 (PB1) 3962.2 0.000000e+00 2232/2275 (98%)
EPI438125 A/mallard/Alberta/57/2004 (A/H10N7) segment 2 (PB1) 3956.6 0.000000e+00 2230/2274 (98%)
EPI435717 A/mallard/Alberta/68/2004 (A/H10N7) segment 2 (PB1) 3956.6 0.000000e+00 2230/2274 (98%)
EPI435701 A/mallard/Alberta/66/2004 (A/H10N7) segment 2 (PB1) 3956.6 0.000000e+00 2230/2274 (98%)
EPI573284 A/American green-winged teal/Washington/195750/2014 (A/H5N1) segment 2 (PB1) 3951.1 0.000000e+00 2229/2274 (98%)
EPI225176 A/mallard/Quebec/10969/2006 (A/H2N3) segment 2 (PB1) 3951.1 0.000000e+00 2229/2274 (98%)
EPI512779 A/mallard/Wisconsin/11OS3407/2011 (A/H4N9) segment 2 (PB1) 3945.6 0.000000e+00 2228/2274 (97%)
EPI225280 A/mallard/Quebec/11247/2006 (A/H3N2) segment 2 (PB1) 3945.6 0.000000e+00 2228/2274 (97%)
EPI225272 A/mallard/Quebec/11194/2006 (A/H3N2) segment 2 (PB1) 3945.6 0.000000e+00 2228/2274 (97%)

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Fri May 01, 2015 1:54 pm 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
EPI569362 A/domestic duck/Washington/61-16/2014 (A/H5N2) segment 3 (PA) 3962.2 0.000000e+00 2149/2151 (99%)
EPI569360 A/chicken/Washington/61-9/2014 (A/H5N2) segment 3 (PA) 3962.2 0.000000e+00 2149/2151 (99%)
EPI573280 A/turkey/Washington/61-22/2014 (A/H5N2) segment 3 (PA) 3956.6 0.000000e+00 2148/2151 (99%)
EPI569382 A/Northern pintail/Washington/40964/2014 (A/H5N2) segment 3 (PA) 3951.1 0.000000e+00 2147/2151 (99%)
EPI584078 A/turkey/BC/FAV14/2014 (A/H5N2) segment 3 (PA) 3945.6 0.000000e+00 2146/2151 (99%)
EPI576173 A/chicken/BC/FAV8/2014 (A/H5N2) segment 3 (PA) 3945.6 0.000000e+00 2146/2151 (99%)
EPI573292 A/turkey/BC/FAV10/2014 (A/H5N2) segment 3 (PA) 3940.0 0.000000e+00 2145/2151 (99%)
EPI576174 A/chicken/BC/FAV9/2014 (A/H5N2) segment 3 (PA) 3934.5 0.000000e+00 2144/2151 (99%)
EPI569389 A/gyrfalcon/Washington/41088-6/2014 (A/H5N8) segment 3 (PA) 3917.9 0.000000e+00 2141/2151 (99%)
EPI569370 A/guinea fowl/Oregon/41613-1/2014 (A/H5N8) segment 3 (PA) 3917.9 0.000000e+00 2141/2151 (99%)
EPI569368 A/chicken/Oregon/41613-2/2014 (A/H5N8) segment 3 (PA) 3917.9 0.000000e+00 2141/2151 (99%)
EPI553207 A/crane/Kagoshima/KU1/2014 (A/H5N8) segment 3 (PA) 3895.7 0.000000e+00 2137/2151 (99%)
EPI561686 A/common teal/Korea/H455-30/2014 (A/H5N8) segment 3 (PA) 3890.2 0.000000e+00 2136/2151 (99%)
EPI573637 A/crane/Kagoshima/KU13/2014(H5N8) (A/H5N8) segment 3 (PA) 3884.6 0.000000e+00 2135/2151 (99%)
EPI561712 A/bean goose/Korea/H40/2014 (A/H5N8) segment 3 (PA) 3884.6 0.000000e+00 2135/2151 (99%)
EPI561643 A/tundra swan/Korea/H411/2014 (A/H5N8) segment 3 (PA) 3884.6 0.000000e+00 2135/2151 (99%)
EPI561583 A/broiler duck/Korea/H133/2014 (A/H5N8) segment 3 (PA) 3884.6 0.000000e+00 2135/2151 (99%)
EPI561537 A/Baikal teal/Korea/H84/2014 (A/H5N8) segment 3 (PA) 3884.6 0.000000e+00 2135/2151 (99%)
EPI561534 A/Baikal teal/Korea/H68/2014 (A/H5N8) segment 3 (PA) 3884.6 0.000000e+00 2135/2151 (99%)
EPI561502 A/Baikal teal/Korea/H66/2014 (A/H5N8) segment 3 (PA) 3884.6 0.000000e+00 2135/2151 (99%)
EPI561500 A/Baikal teal/Korea/H62/2014 (A/H5N8) segment 3 (PA) 3884.6 0.000000e+00 2135/2151 (99%)
EPI561338 A/broiler duck/Korea/H49/2014 (A/H5N8) segment 3 (PA) 3884.6 0.000000e+00 2135/2151 (99%)
EPI561334 A/broiler duck/Korea/H47/2014 (A/H5N8) segment 3 (PA) 3884.6 0.000000e+00 2135/2151 (99%)
EPI509694 A/baikal teal/Korea/Donglim3/2014 (A/H5N8) segment 3 (PA) 3884.6 0.000000e+00 2135/2151 (99%)
EPI509693 A/broiler duck/Korea/Buan2/2014 (A/H5N8) segment 3 (PA) 3884.6 0.000000e+00 2135/2151 (99%)
EPI561687 A/spot-billed duck/Korea/H455-42/2014 (A/H5N8) segment 3 (PA) 3879.1 0.000000e+00 2134/2151 (99%)
EPI561642 A/bean goose/Korea/H328/2014 (A/H5N8) segment 3 (PA) 3879.1 0.000000e+00 2134/2151 (99%)
EPI561640 A/Korean native chicken/Korea/H257/2014 (A/H5N8) segment 3 (PA) 3879.1 0.000000e+00 2134/2151 (99%)
EPI561588 A/white-fronted goose/Korea/H231/2014 (A/H5N8) segment 3 (PA) 3879.1 0.000000e+00 2134/2151 (99%)
EPI561587 A/mallard/Korea/H207/2014 (A/H5N8) segment 3 (PA) 3879.1 0.000000e+00 2134/2151 (99%)
EPI561586 A/breeder duck/Korea/H200/2014 (A/H5N8) segment 3 (PA) 3879.1 0.000000e+00 2134/2151 (99%)
EPI561584 A/broiler duck/Korea/H145/2014 (A/H5N8) segment 3 (PA) 3879.1 0.000000e+00 2134/2151 (99%)
EPI561582 A/breeder duck/Korea/H128/2014 (A/H5N8) segment 3 (PA) 3879.1 0.000000e+00 2134/2151 (99%)
EPI561501 A/broiler duck/Korea/H65/2014 (A/H5N8) segment 3 (PA) 3879.1 0.000000e+00 2134/2151 (99%)
EPI561335 A/broiler duck/Korea/H48/2014 (A/H5N8) segment 3 (PA) 3879.1 0.000000e+00 2134/2151 (99%)
EPI561333 A/Baikal teal/Korea/H41/2014 (A/H5N8) segment 3 (PA) 3879.1 0.000000e+00 2134/2151 (99%)
EPI561193 A/broiler duck/Korea/H31/2014 (A/H5N8) segment 3 (PA) 3879.1 0.000000e+00 2134/2151 (99%)
EPI561192 A/broiler duck/Korea/H29/2014 (A/H5N8) segment 3 (PA) 3879.1 0.000000e+00 2134/2151 (99%)
EPI561641 A/mallard/Korea/H297/2014 (A/H5N8) segment 3 (PA) 3873.5 0.000000e+00 2133/2151 (99%)
EPI561639 A/breeder chicken/Korea/H250/2014 (A/H5N8) segment 3 (PA) 3873.5 0.000000e+00 2133/2151 (99%)
EPI561585 A/breeder duck/Korea/H158/2014 (A/H5N8) segment 3 (PA) 3873.5 0.000000e+00 2133/2151 (99%)
EPI561539 A/breeder chicken/Korea/H122/2014 (A/H5N8) segment 3 (PA) 3873.5 0.000000e+00 2133/2151 (99%)
EPI561538 A/Baikal teal/Korea/H96/2014 (A/H5N8) segment 3 (PA) 3873.5 0.000000e+00 2133/2151 (99%)
EPI561536 A/Coot/Korea/H81/2014 (A/H5N8) segment 3 (PA) 3873.5 0.000000e+00 2133/2151 (99%)
EPI561535 A/Baikal teal/Korea/H80/2014 (A/H5N8) segment 3 (PA) 3873.5 0.000000e+00 2133/2151 (99%)
EPI561499 A/bean goose/Korea/H53/2014 (A/H5N8) segment 3 (PA) 3873.5 0.000000e+00 2133/2151 (99%)
EPI561184 A/waterfowl/Korea/S005/2014 (A/H5N8) segment 3 (PA) 3873.5 0.000000e+00 2133/2151 (99%)
EPI573645 A/crane/Kagoshima/KU21/2014(H5N8) (A/H5N8) segment 3 (PA) 3868.0 0.000000e+00 2132/2151 (99%)
EPI561638 A/breeder duck/Korea/H249/2014 (A/H5N8) segment 3 (PA) 3868.0 0.000000e+00 2132/2151 (99%)
EPI542618 A/mallard/Korea/W452/2014 (A/H5N8) segment 3 (PA) 3868.0 0.000000e+00 2132/2151 (99%)
EPI573663 A/crane/Kagoshima/KU53/2015(H5N8) (A/H5N8) segment 3 (PA) 3862.5 0.000000e+00 2131/2151 (99%)
EPI573653 A/crane/Kagoshima/KU41/2014(H5N8) (A/H5N8) segment 3 (PA) 3862.5 0.000000e+00 2131/2151 (99%)
EPI542602 A/duck/Beijing/FS01/2013 (A/H5N8) segment 3 (PA) 3856.9 0.000000e+00 2129/2149 (99%)
EPI517160 A/Chicken/Kumamoto/1-7/2014 (A/H5N8) segment 3 (PA) 3851.4 0.000000e+00 2129/2151 (98%)
EPI558010 A/duck/England/36038/14 (A/H5N8) segment 3 (PA) 3845.8 0.000000e+00 2128/2151 (98%)
EPI553342 A/chicken/Miyazaki/7/2014 (A/H5N8) segment 3 (PA) 3845.8 0.000000e+00 2128/2151 (98%)
EPI547672 A/duck/England/36254/14 (A/H5N8) segment 3 (PA) 3845.8 0.000000e+00 2128/2151 (98%)
EPI558003 A/duck/England/36226/14 (A/H5N8) segment 3 (PA) 3840.3 0.000000e+00 2127/2151 (98%)
EPI553184 A/turkey/Italy/14VIR7898-10/2014 (A/H5N8) segment 3 (PA) 3840.3 0.000000e+00 2127/2151 (98%)
EPI548492 A/duck/Chiba/26-372-61/2014 (A/H5N8) segment 3 (PA) 3840.3 0.000000e+00 2127/2151 (98%)
EPI548484 A/duck/Chiba/26-372-48/2014 (A/H5N8) segment 3 (PA) 3840.3 0.000000e+00 2127/2151 (98%)
EPI547681 A/Chicken/Netherlands/14015526/2014 (A/H5N8) segment 3 (PA) 3840.3 0.000000e+00 2127/2151 (98%)
EPI543001 A/duck/Beijing/FS01/2014 (A/H5N8) segment 3 (PA) 3832.9 0.000000e+00 2123/2148 (98%)
EPI573671 A/mallard duck/Kagoshima/KU70/2015(H5N8) (A/H5N8) segment 3 (PA) 3829.2 0.000000e+00 2125/2151 (98%)
EPI553361 A/environment/Kagoshima/KU-ngr-H/2014 (A/H5N8) segment 3 (PA) 3829.2 0.000000e+00 2125/2151 (98%)
EPI552745 A/turkey/Germany/R2474-L00899/2014 (A/H5N8) segment 3 (PA) 3829.2 0.000000e+00 2125/2151 (98%)
EPI548622 A/chicken/Netherlands/14015531/2014 (A/H5N8) segment 3 (PA) 3829.2 0.000000e+00 2125/2151 (98%)
EPI548429 A/turkey/Germany-MV/R2472/2014 (A/H5N8) segment 3 (PA) 3825.5 0.000000e+00 2124/2151 (98%)
EPI554601 A/turkey/Germany-NI/R3372/2014 (A/H5N8) segment 3 (PA) 3823.7 0.000000e+00 2124/2151 (98%)
EPI543009 A/duck/Beijing/CT01/2014 (A/H5N8) segment 3 (PA) 3823.7 0.000000e+00 2121/2148 (98%)
EPI555125 A/domestic duck/Germany-NI/R3468/2014 (A/H5N8) segment 3 (PA) 3818.1 0.000000e+00 2123/2151 (98%)
EPI573679 A/mallard duck/Kagoshima/KU116/2015(H5N8) (A/H5N8) segment 3 (PA) 3812.6 0.000000e+00 2123/2152 (98%)
EPI552759 A/eurasian wigeon/Netherlands/emc-1/2014 (A/H5N8) segment 3 (PA) 3773.8 0.000000e+00 2096/2122 (98%)
EPI431447 A/duck/Hebei/2/2011 (A/H5N2) segment 3 (PA) 3751.7 0.000000e+00 2111/2151 (98%)
EPI552775 A/chicken/Netherlands/emc-3/2014 (A/H5N8) segment 3 (PA) 3746.1 0.000000e+00 2088/2118 (98%)
EPI552767 A/eurasian wigeon/Netherlands/emc-2/2014 (A/H5N8) segment 3 (PA) 3738.7 0.000000e+00 2082/2111 (98%)
EPI414237 A/duck/Jiangsu/1-15/2011 (A/H4N2) segment 3 (PA) 3701.8 0.000000e+00 2102/2151 (97%)
EPI398961 A/duck/Eastern China/1111/2011 (A/H5N2) segment 3 (PA) 3685.2 0.000000e+00 2100/2152 (97%)
EPI398962 A/goose/Eastern China/1112/2011 (A/H5N2) segment 3 (PA) 3613.2 0.000000e+00 2086/2151 (96%)
EPI328887 A/duck/Eastern China/108/2008 (A/H5N1) segment 3 (PA) 3613.2 0.000000e+00 2086/2151 (96%)
EPI328879 A/duck/Eastern China/031/2009 (A/H5N5) segment 3 (PA) 3591.0 0.000000e+00 2082/2151 (96%)
EPI493832 A/duck/Guangdong/wy24/2008 (A/H5N5) segment 3 (PA) 3574.4 0.000000e+00 2079/2151 (96%)
EPI442024 A/quail/Jiangsu/k0104/2010 (A/H5N5) segment 3 (PA) 3568.8 0.000000e+00 2078/2151 (96%)
EPI431455 A/duck/Hebei/3/2011 (A/H5N2) segment 3 (PA) 3557.8 0.000000e+00 2076/2151 (96%)
EPI493816 A/duck/Guangdong/wy11/2008 (A/H5N5) segment 3 (PA) 3546.7 0.000000e+00 2074/2151 (96%)
EPI493824 A/duck/Guangdong/wy19/2008 (A/H5N5) segment 3 (PA) 3541.1 0.000000e+00 2073/2151 (96%)
EPI442008 A/goose/Guangdong/k0103/2010 (A/H5N5) segment 3 (PA) 3524.5 0.000000e+00 2070/2151 (96%)
EPI544891 A/duck/Shandong/Q1/2013 (A/H5N8) segment 3 (PA) 3502.4 0.000000e+00 2066/2151 (96%)
EPI399959 A/duck/Jiangsu/m234/2012 (A/H5N2) segment 3 (PA) 3502.4 0.000000e+00 2067/2152 (96%)
EPI442000 A/goose/Shandong/k1204/2009 (A/H5N5) segment 3 (PA) 3491.3 0.000000e+00 2065/2152 (95%)
EPI442016 A/duck/Jiangsu/k1203/2010 (A/H5N8) segment 3 (PA) 3485.7 0.000000e+00 2043/2121 (96%)
EPI475578 A/wild duck/Shandong/628/2011 (A/H5N1) segment 3 (PA) 3474.7 0.000000e+00 2063/2153 (95%)
EPI127382 A/wild duck/Hunan/021/2005 (A/H5N1) segment 3 (PA) 3458.0 0.000000e+00 2058/2151 (95%)
EPI530983 A/duck/Zhejiang/W24/2013 (A/H5N8) segment 3 (PA) 3452.5 0.000000e+00 2059/2153 (95%)
EPI113022 A/crested myna/Hong Kong/540/2006 (A/H5N1) segment 3 (PA) 3441.4 0.000000e+00 2055/2151 (95%)
EPI507672 A/mallard duck/Shanghai/SH-9/2013 (A/H5N8) segment 3 (PA) 3435.9 0.000000e+00 2055/2152 (95%)
EPI399885 A/duck/HuBei/03/2010 (A/H5N5) segment 3 (PA) 3430.3 0.000000e+00 2053/2151 (95%)
EPI337063 A/Anhui/2/2005 (A/H5N1) segment 3 (PA) 3430.3 0.000000e+00 2054/2152 (95%)
EPI337058 A/Anhui/1/2005 (A/H5N1) segment 3 (PA) 3430.3 0.000000e+00 2054/2152 (95%)
EPI275385 A/Anhui/2/2005 (A/H5N1) segment 3 (PA) 3430.3 0.000000e+00 2054/2152 (95%)

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Fri May 01, 2015 1:56 pm 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
EPI576471 A/chicken/BC/FAV8/2014 (A/H5N2) segment 5 (NP) 2748.9 0.000000e+00 1494/1497 (99%)
EPI569384 A/Northern pintail/Washington/40964/2014 (A/H5N2) segment 5 (NP) 2748.9 0.000000e+00 1494/1497 (99%)
EPI569365 A/turkey/Washington/61-22/2014 (A/H5N2) segment 5 (NP) 2748.9 0.000000e+00 1494/1497 (99%)
EPI584080 A/turkey/BC/FAV14/2014 (A/H5N2) segment 5 (NP) 2743.4 0.000000e+00 1493/1497 (99%)
EPI576478 A/chicken/BC/FAV9/2014 (A/H5N2) segment 5 (NP) 2743.4 0.000000e+00 1493/1497 (99%)
EPI573299 A/turkey/BC/FAV10/2014 (A/H5N2) segment 5 (NP) 2743.4 0.000000e+00 1493/1497 (99%)
EPI573277 A/domestic duck/Washington/61-16/2014 (A/H5N2) segment 5 (NP) 2737.9 0.000000e+00 1492/1497 (99%)
EPI573272 A/chicken/Washington/61-9/2014 (A/H5N2) segment 5 (NP) 2737.9 0.000000e+00 1492/1497 (99%)
EPI526421 A/American green-winged teal/Ohio/13OS2086/2013 (A/H6N8) segment 5 (NP) 2676.9 0.000000e+00 1481/1497 (98%)
EPI526348 A/American green-winged teal/Ohio/13OS2084/2013 (A/H6N8) segment 5 (NP) 2676.9 0.000000e+00 1481/1497 (98%)
EPI513134 A/mallard/Wisconsin/11OS4085/2011 (A/H0) segment 5 (NP) 2665.8 0.000000e+00 1479/1497 (98%)
EPI512973 A/blue-winged teal/Wisconsin/11OS3052/2011 (A/H3N2) segment 5 (NP) 2665.8 0.000000e+00 1479/1497 (98%)
EPI512391 A/northern pintail/Illinois/11OS4796/2011 (A/H5N3) segment 5 (NP) 2665.8 0.000000e+00 1479/1497 (98%)
EPI512368 A/northern shoveler/Illinois/11OS4707/2011 (A/H4N6) segment 5 (NP) 2665.8 0.000000e+00 1479/1497 (98%)
EPI513005 A/northern shoveler/Wisconsin/11OS4110/2011 (A/H4N6) segment 5 (NP) 2660.3 0.000000e+00 1478/1497 (98%)
EPI512353 A/mallard/Illinois/11OS4420/2011 (A/H2N3) segment 5 (NP) 2660.3 0.000000e+00 1478/1497 (98%)
EPI526332 A/American green-winged teal/Ohio/13OS2060/2013 (A/H6N8) segment 5 (NP) 2654.8 0.000000e+00 1477/1497 (98%)
EPI512695 A/mallard/Wisconsin/11OS4309/2011 (A/H4N6) segment 5 (NP) 2654.8 0.000000e+00 1477/1497 (98%)
EPI512616 A/mallard/Wisconsin/11OS4310/2011 (A/H4N6) segment 5 (NP) 2649.2 0.000000e+00 1476/1497 (98%)
EPI418744 A/wood duck/Wisconsin/10OS2778/2010 (A/H3N8) segment 5 (NP) 2649.2 0.000000e+00 1476/1497 (98%)
EPI418737 A/mallard/Wisconsin/10OS2773/2010 (A/H3N8) segment 5 (NP) 2649.2 0.000000e+00 1476/1497 (98%)
EPI512928 A/mallard/Illinois/11OS4121/2011 (A/H6N2) segment 5 (NP) 2643.7 0.000000e+00 1475/1497 (98%)
EPI419491 A/northern shoverl/Mississippi/11OS145/2011 (A/H7N9) segment 5 (NP) 2643.7 0.000000e+00 1475/1497 (98%)
EPI512749 A/northern shoveler/Wisconsin/11OS3013/2011 (A/H4N8) segment 5 (NP) 2638.1 0.000000e+00 1474/1497 (98%)
EPI449581 A/green-winged teal/Minnesota/Sg-01000/2008 (A/H3N6) segment 5 (NP) 2638.1 0.000000e+00 1474/1497 (98%)
EPI449553 A/mallard/Minnesota/Sg-00930/2008 (A/H11N9) segment 5 (NP) 2638.1 0.000000e+00 1474/1497 (98%)
EPI419628 A/mallard/Missouri/10MO084/2010 (A/H5N9) segment 5 (NP) 2638.1 0.000000e+00 1474/1497 (98%)
EPI475450 A/northern shoveler/Minnesota/Sg-00655/2008 (A/H1N1) segment 5 (NP) 2632.6 0.000000e+00 1473/1497 (98%)
EPI468600 A/northern shoveler/Minnesota/Sg-00651/2008 (A/H1N1) segment 5 (NP) 2632.6 0.000000e+00 1473/1497 (98%)
EPI450064 A/red-necked grebe/Minnesota/AI10-2528/2010 (A/H4N8) segment 5 (NP) 2632.6 0.000000e+00 1473/1497 (98%)
EPI449397 A/northern shoveler/Minnesota/Sg-00665/2008 (A/H0) segment 5 (NP) 2632.6 0.000000e+00 1473/1497 (98%)
EPI448589 A/mallard/Minnesota/Sg-00620/2008 (A/H1N1) segment 5 (NP) 2632.6 0.000000e+00 1473/1497 (98%)
EPI418903 A/blue-winged teal/Wisconsin/10OS2862/2010 (A/H3N2) segment 5 (NP) 2632.6 0.000000e+00 1473/1497 (98%)
EPI334171 A/mallard/Illinois/3974/2009 (A/H5N2) segment 5 (NP) 2632.6 0.000000e+00 1473/1497 (98%)
EPI468579 A/mallard/Minnesota/Sg-00627/2008 (A/H1N1) segment 5 (NP) 2627.1 0.000000e+00 1472/1497 (98%)
EPI468414 A/mallard/Minnesota/Sg-00628/2008 (A/H1N1) segment 5 (NP) 2627.1 0.000000e+00 1472/1497 (98%)
EPI433780 A/blue-winged teal/Nova Scotia/00067/2010 (A/H0) segment 5 (NP) 2627.1 0.000000e+00 1472/1497 (98%)
EPI334289 A/blue-winged teal/Wisconsin/2753/2009 (A/H4N6) segment 5 (NP) 2627.1 0.000000e+00 1472/1497 (98%)
EPI328603 A/northern shoveler/California/9079/2008 (A/H4N4) segment 5 (NP) 2627.1 0.000000e+00 1472/1497 (98%)
EPI328067 A/northern shoveler/California/10024/2008 (A/H4N4) segment 5 (NP) 2627.1 0.000000e+00 1472/1497 (98%)
EPI449387 A/mallard/Minnesota/Sg-0617/2008 (A/H1N1) segment 5 (NP) 2621.5 0.000000e+00 1471/1497 (98%)
EPI486895 A/mallard/California/3471/2012 (A/H4N6) segment 5 (NP) 2616.0 0.000000e+00 1470/1497 (98%)
EPI419506 A/American green-winged teal/Mississippi/11OS247/2011 (A/H0) segment 5 (NP) 2616.0 0.000000e+00 1470/1497 (98%)
EPI328083 A/northern shoveler/California/9267/2008 (A/H4N6) segment 5 (NP) 2616.0 0.000000e+00 1470/1497 (98%)
EPI419169 A/mallard/Wisconsin/10OS3866/2010 (A/H3N6) segment 5 (NP) 2610.4 0.000000e+00 1469/1497 (98%)
EPI328091 A/northern shoveler/California/9228/2008 (A/H4N6) segment 5 (NP) 2610.4 0.000000e+00 1469/1497 (98%)
EPI526489 A/blue-winged teal/Iowa/13OS2338/2013 (A/H4N6) segment 5 (NP) 2604.9 0.000000e+00 1468/1497 (98%)
EPI513149 A/northern shoveler/Wisconsin/11OS4631/2011 (A/H0) segment 5 (NP) 2604.9 0.000000e+00 1468/1497 (98%)
EPI387206 A/mallard/California/3134/2010 (A/H1N1) segment 5 (NP) 2599.4 0.000000e+00 1467/1497 (97%)
EPI342993 A/mallard/Alberta/507/2008 (A/H3N8) segment 5 (NP) 2599.4 0.000000e+00 1467/1497 (97%)
EPI327399 A/ring-necked duck/Ontario/15530/2005 (A/H3N2) segment 5 (NP) 2599.4 0.000000e+00 1467/1497 (97%)
EPI542020 A/Northern shoveler/Alaska/ND0006934/2013 (A/H10N7) segment 5 (NP) 2593.8 0.000000e+00 1466/1497 (97%)
EPI60013 A/american black duck/Ohio/1823/2005 (A/H11N9) segment 5 (NP) 2593.8 0.000000e+00 1466/1497 (97%)
EPI419789 A/northern shoveler/California/2815/2011 (A/H5N2) segment 5 (NP) 2582.7 0.000000e+00 1464/1497 (97%)
EPI327691 A/mallard/California/5386/2009 (A/H5N2) segment 5 (NP) 2582.7 0.000000e+00 1464/1497 (97%)
EPI289855 A/mallard/Alaska/44430-088/2008 (A/H1N1) segment 5 (NP) 2582.7 0.000000e+00 1456/1485 (98%)
EPI420190 A/bufflehead/California/3118/2011 (A/H4N8) segment 5 (NP) 2577.2 0.000000e+00 1464/1498 (97%)
EPI418611 A/American green-winged teal/Mississippi/11OS98/2011 (A/H0) segment 5 (NP) 2577.2 0.000000e+00 1463/1497 (97%)
EPI328395 A/mallard/California/5219/2009 (A/H5N2) segment 5 (NP) 2577.2 0.000000e+00 1463/1497 (97%)
EPI327827 A/mallard/California/5212/2009 (A/H5N2) segment 5 (NP) 2577.2 0.000000e+00 1463/1497 (97%)
EPI327819 A/mallard/California/5222/2009 (A/H5N2) segment 5 (NP) 2577.2 0.000000e+00 1463/1497 (97%)
EPI327811 A/mallard/California/5250/2009 (A/H5N2) segment 5 (NP) 2577.2 0.000000e+00 1463/1497 (97%)
EPI327795 A/mallard/California/5276/2009 (A/H5N2) segment 5 (NP) 2577.2 0.000000e+00 1463/1497 (97%)
EPI327779 A/mallard/California/5296/2009 (A/H5N2) segment 5 (NP) 2577.2 0.000000e+00 1463/1497 (97%)
EPI327763 A/mallard/California/5502/2009 (A/H5N2) segment 5 (NP) 2577.2 0.000000e+00 1463/1497 (97%)
EPI327747 A/mallard/California/5174/2009 (A/H5N2) segment 5 (NP) 2577.2 0.000000e+00 1463/1497 (97%)
EPI327715 A/mallard/California/5319/2009 (A/H5N2) segment 5 (NP) 2577.2 0.000000e+00 1463/1497 (97%)
EPI327699 A/mallard/California/5359/2009 (A/H5N2) segment 5 (NP) 2577.2 0.000000e+00 1463/1497 (97%)
EPI327683 A/mallard/California/5491/2009 (A/H5N2) segment 5 (NP) 2577.2 0.000000e+00 1463/1497 (97%)
EPI420033 A/mallard/California/2571V/2011 (A/H0) segment 5 (NP) 2571.7 0.000000e+00 1462/1497 (97%)
EPI420025 A/mallard/California/2571P/2011 (A/H11N2) segment 5 (NP) 2571.7 0.000000e+00 1462/1497 (97%)
EPI387353 A/mallard/California/5197/2009 (A/H5N2) segment 5 (NP) 2571.7 0.000000e+00 1462/1497 (97%)
EPI327675 A/mallard/California/5191/2009 (A/H5N2) segment 5 (NP) 2571.7 0.000000e+00 1462/1497 (97%)
EPI343406 A/mallard/Alberta/221/2006 (A/H12) segment 5 (NP) 2566.1 0.000000e+00 1461/1497 (97%)
EPI343398 A/mallard/Alberta/224/2006 (A/H12N5) segment 5 (NP) 2566.1 0.000000e+00 1461/1497 (97%)
EPI327755 A/mallard/California/5149/2009 (A/H5N2) segment 5 (NP) 2566.1 0.000000e+00 1461/1497 (97%)
EPI296781 A/mallard/Alberta/224/2006 (A/H12N5) segment 5 (NP) 2566.1 0.000000e+00 1461/1497 (97%)
EPI296773 A/mallard/Alberta/221/2006 (A/H12) segment 5 (NP) 2566.1 0.000000e+00 1461/1497 (97%)
EPI542118 A/mallard/Alaska/ND0006301/2013 (A/H3N8) segment 5 (NP) 2560.6 0.000000e+00 1460/1497 (97%)
EPI343306 A/mallard/Alberta/297/2006 (A/H4N6) segment 5 (NP) 2560.6 0.000000e+00 1460/1497 (97%)
EPI456387 A/ruddy turnstone/New Jersey/AI09-1211/2009 (A/H1N9) segment 5 (NP) 2555.0 0.000000e+00 1459/1497 (97%)
EPI456359 A/ruddy turnstone/New Jersey/AI09-1082/2009 (A/H1N9) segment 5 (NP) 2549.5 0.000000e+00 1458/1497 (97%)
EPI486683 A/mallard/California/3070/2012 (A/H11N2) segment 5 (NP) 2544.0 0.000000e+00 1458/1498 (97%)
EPI456486 A/ruddy turnstone/New Jersey/AI09-1381/2009 (A/H1N9) segment 5 (NP) 2544.0 0.000000e+00 1457/1497 (97%)
EPI436056 A/shorebird/Delaware Bay/351/2009 (A/H1N9) segment 5 (NP) 2544.0 0.000000e+00 1457/1497 (97%)
EPI456189 A/ruddy turnstone/New Jersey/AI09-618/2009 (A/H1N9) segment 5 (NP) 2538.4 0.000000e+00 1456/1497 (97%)
EPI450089 A/red-necked grebe/Minnesota/AI10-2531/2010 (A/H0) segment 5 (NP) 2538.4 0.000000e+00 1456/1497 (97%)
EPI178791 A/northern shoveler/California/HKWF2031/2008 (A/H7N3) segment 5 (NP) 2538.4 0.000000e+00 1456/1497 (97%)
EPI433751 A/ring-billed gull/Quebec/G192/2010 (A/H1N3) segment 5 (NP) 2505.2 0.000000e+00 1450/1497 (96%)
EPI433744 A/ring-billed gull/Quebec/G139/2010 (A/H1N3) segment 5 (NP) 2505.2 0.000000e+00 1450/1497 (96%)
EPI433737 A/ring-billed gull/Quebec/G068/2010 (A/H1N3) segment 5 (NP) 2505.2 0.000000e+00 1450/1497 (96%)
EPI433730 A/ring-billed gull/Quebec/G066/2010 (A/H1N3) segment 5 (NP) 2505.2 0.000000e+00 1450/1497 (96%)
EPI433696 A/ring-billed gull/Quebec/G018/2010 (A/H1N3) segment 5 (NP) 2505.2 0.000000e+00 1450/1497 (96%)
EPI454918 A/ruddy turnstone/New Jersey/1321394/2005 (A/H3N6) segment 5 (NP) 2466.4 0.000000e+00 1443/1497 (96%)
EPI227473 A/ruddy turnstone/New Jersey/327/2005 (A/H3N6) segment 5 (NP) 2466.4 0.000000e+00 1443/1497 (96%)
EPI59975 A/environment/Delaware/251/2005 (A/H3N6) segment 5 (NP) 2466.4 0.000000e+00 1443/1497 (96%)
EPI343659 A/shorebird/Delaware Bay/117/2005 (A/H0) segment 5 (NP) 2460.9 0.000000e+00 1442/1497 (96%)
EPI343651 A/shorebird/Delaware Bay/140/2005 (A/H3N6) segment 5 (NP) 2460.9 0.000000e+00 1442/1497 (96%)
EPI343627 A/shorebird/Delaware Bay/161/2005 (A/H3N6) segment 5 (NP) 2460.9 0.000000e+00 1442/1497 (96%)
EPI59823 A/environment/Delaware/245/2005 (A/H3N6) segment 5 (NP) 2460.9 0.000000e+00 1442/1497 (96%)

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Fri May 01, 2015 1:58 pm 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
EPI576474 A/chicken/BC/FAV8/2014 (A/H5N2) segment 8 (NS) 1548.6 0.000000e+00 838/838 (100%)
EPI569394 A/gyrfalcon/Washington/41088-6/2014 (A/H5N8) segment 8 (NS) 1548.6 0.000000e+00 838/838 (100%)
EPI569387 A/Northern pintail/Washington/40964/2014 (A/H5N2) segment 8 (NS) 1548.6 0.000000e+00 838/838 (100%)
EPI568703 A/guinea fowl/Oregon/41613-1/2014 (A/H5N8) segment 8 (NS) 1548.6 0.000000e+00 838/838 (100%)
EPI568700 A/chicken/Oregon/41613-2/2014 (A/H5N8) segment 8 (NS) 1548.6 0.000000e+00 838/838 (100%)
EPI561713 A/broiler duck/Korea/H31/2014 (A/H5N8) segment 8 (NS) 1548.6 0.000000e+00 838/838 (100%)
EPI561701 A/spot-billed duck/Korea/H455-42/2014 (A/H5N8) segment 8 (NS) 1548.6 0.000000e+00 838/838 (100%)
EPI561694 A/common teal/Korea/H455-30/2014 (A/H5N8) segment 8 (NS) 1548.6 0.000000e+00 838/838 (100%)
EPI561685 A/tundra swan/Korea/H411/2014 (A/H5N8) segment 8 (NS) 1548.6 0.000000e+00 838/838 (100%)
EPI561678 A/bean goose/Korea/H328/2014 (A/H5N8) segment 8 (NS) 1548.6 0.000000e+00 838/838 (100%)
EPI561671 A/mallard/Korea/H297/2014 (A/H5N8) segment 8 (NS) 1548.6 0.000000e+00 838/838 (100%)
EPI561664 A/Korean native chicken/Korea/H257/2014 (A/H5N8) segment 8 (NS) 1548.6 0.000000e+00 838/838 (100%)
EPI561657 A/breeder chicken/Korea/H250/2014 (A/H5N8) segment 8 (NS) 1548.6 0.000000e+00 838/838 (100%)
EPI561630 A/mallard/Korea/H207/2014 (A/H5N8) segment 8 (NS) 1548.6 0.000000e+00 838/838 (100%)
EPI561623 A/breeder duck/Korea/H200/2014 (A/H5N8) segment 8 (NS) 1548.6 0.000000e+00 838/838 (100%)
EPI561574 A/Baikal teal/Korea/H96/2014 (A/H5N8) segment 8 (NS) 1548.6 0.000000e+00 838/838 (100%)
EPI561560 A/Coot/Korea/H81/2014 (A/H5N8) segment 8 (NS) 1548.6 0.000000e+00 838/838 (100%)
EPI561553 A/Baikal teal/Korea/H80/2014 (A/H5N8) segment 8 (NS) 1548.6 0.000000e+00 838/838 (100%)
EPI561533 A/Baikal teal/Korea/H66/2014 (A/H5N8) segment 8 (NS) 1548.6 0.000000e+00 838/838 (100%)
EPI561519 A/Baikal teal/Korea/H62/2014 (A/H5N8) segment 8 (NS) 1548.6 0.000000e+00 838/838 (100%)
EPI561345 A/Baikal teal/Korea/H41/2014 (A/H5N8) segment 8 (NS) 1548.6 0.000000e+00 838/838 (100%)
EPI561200 A/broiler duck/Korea/H29/2014 (A/H5N8) segment 8 (NS) 1548.6 0.000000e+00 838/838 (100%)
EPI542634 A/mallard/Korea/W452/2014 (A/H5N8) segment 8 (NS) 1548.6 0.000000e+00 838/838 (100%)
EPI509757 A/baikal teal/Korea/Donglim3/2014 (A/H5N8) segment 8 (NS) 1548.6 0.000000e+00 838/838 (100%)
EPI509712 A/broiler duck/Korea/Buan2/2014 (A/H5N8) segment 8 (NS) 1548.6 0.000000e+00 838/838 (100%)
EPI584083 A/turkey/BC/FAV14/2014 (A/H5N2) segment 8 (NS) 1543.1 0.000000e+00 837/838 (99%)
EPI569366 A/turkey/Washington/61-22/2014 (A/H5N2) segment 8 (NS) 1543.1 0.000000e+00 837/838 (99%)
EPI561650 A/breeder duck/Korea/H249/2014 (A/H5N8) segment 8 (NS) 1543.1 0.000000e+00 837/838 (99%)
EPI561609 A/broiler duck/Korea/H145/2014 (A/H5N8) segment 8 (NS) 1543.1 0.000000e+00 837/838 (99%)
EPI561602 A/broiler duck/Korea/H133/2014 (A/H5N8) segment 8 (NS) 1543.1 0.000000e+00 837/838 (99%)
EPI561595 A/breeder duck/Korea/H128/2014 (A/H5N8) segment 8 (NS) 1543.1 0.000000e+00 837/838 (99%)
EPI561581 A/breeder chicken/Korea/H122/2014 (A/H5N8) segment 8 (NS) 1543.1 0.000000e+00 837/838 (99%)
EPI561546 A/Baikal teal/Korea/H68/2014 (A/H5N8) segment 8 (NS) 1543.1 0.000000e+00 837/838 (99%)
EPI561364 A/bean goose/Korea/H40/2014 (A/H5N8) segment 8 (NS) 1543.1 0.000000e+00 837/838 (99%)
EPI561357 A/broiler duck/Korea/H48/2014 (A/H5N8) segment 8 (NS) 1543.1 0.000000e+00 837/838 (99%)
EPI561352 A/broiler duck/Korea/H47/2014 (A/H5N8) segment 8 (NS) 1543.1 0.000000e+00 837/838 (99%)
EPI561191 A/waterfowl/Korea/S005/2014 (A/H5N8) segment 8 (NS) 1543.1 0.000000e+00 837/838 (99%)
EPI554604 A/turkey/Germany-NI/R3372/2014 (A/H5N8) segment 8 (NS) 1543.1 0.000000e+00 837/838 (99%)
EPI553471 A/wigeon/Sakha/1/2014 (A/H5N8) segment 8 (NS) 1543.1 0.000000e+00 837/838 (99%)
EPI552750 A/turkey/Germany/R2474-L00899/2014 (A/H5N8) segment 8 (NS) 1543.1 0.000000e+00 837/838 (99%)
EPI548628 A/chicken/Netherlands/14015531/2014 (A/H5N8) segment 8 (NS) 1543.1 0.000000e+00 837/838 (99%)
EPI548428 A/turkey/Germany-MV/R2472/2014 (A/H5N8) segment 8 (NS) 1543.1 0.000000e+00 837/838 (99%)
EPI576481 A/chicken/BC/FAV9/2014 (A/H5N2) segment 8 (NS) 1537.5 0.000000e+00 836/838 (99%)
EPI573642 A/crane/Kagoshima/KU13/2014(H5N8) (A/H5N8) segment 8 (NS) 1537.5 0.000000e+00 836/838 (99%)
EPI573302 A/turkey/BC/FAV10/2014 (A/H5N2) segment 8 (NS) 1537.5 0.000000e+00 836/838 (99%)
EPI569363 A/domestic duck/Washington/61-16/2014 (A/H5N2) segment 8 (NS) 1537.5 0.000000e+00 836/838 (99%)
EPI569361 A/chicken/Washington/61-9/2014 (A/H5N2) segment 8 (NS) 1537.5 0.000000e+00 836/838 (99%)
EPI561637 A/white-fronted goose/Korea/H231/2014 (A/H5N8) segment 8 (NS) 1537.5 0.000000e+00 836/838 (99%)
EPI561616 A/breeder duck/Korea/H158/2014 (A/H5N8) segment 8 (NS) 1537.5 0.000000e+00 836/838 (99%)
EPI561567 A/Baikal teal/Korea/H84/2014 (A/H5N8) segment 8 (NS) 1537.5 0.000000e+00 836/838 (99%)
EPI561512 A/bean goose/Korea/H53/2014 (A/H5N8) segment 8 (NS) 1537.5 0.000000e+00 836/838 (99%)
EPI558013 A/duck/England/36038/14 (A/H5N8) segment 8 (NS) 1537.5 0.000000e+00 836/838 (99%)
EPI553212 A/crane/Kagoshima/KU1/2014 (A/H5N8) segment 8 (NS) 1537.5 0.000000e+00 836/838 (99%)
EPI547685 A/Chicken/Netherlands/14015526/2014 (A/H5N8) segment 8 (NS) 1537.5 0.000000e+00 836/838 (99%)
EPI547677 A/duck/England/36254/14 (A/H5N8) segment 8 (NS) 1537.5 0.000000e+00 836/838 (99%)
EPI517165 A/Chicken/Kumamoto/1-7/2014 (A/H5N8) segment 8 (NS) 1537.5 0.000000e+00 836/838 (99%)
EPI558006 A/duck/England/36226/14 (A/H5N8) segment 8 (NS) 1533.8 0.000000e+00 835/838 (99%)
EPI561526 A/broiler duck/Korea/H65/2014 (A/H5N8) segment 8 (NS) 1532.0 0.000000e+00 835/838 (99%)
EPI561369 A/broiler duck/Korea/H49/2014 (A/H5N8) segment 8 (NS) 1532.0 0.000000e+00 835/838 (99%)
EPI553366 A/environment/Kagoshima/KU-ngr-H/2014 (A/H5N8) segment 8 (NS) 1532.0 0.000000e+00 835/838 (99%)
EPI548497 A/duck/Chiba/26-372-61/2014 (A/H5N8) segment 8 (NS) 1532.0 0.000000e+00 835/838 (99%)
EPI548489 A/duck/Chiba/26-372-48/2014 (A/H5N8) segment 8 (NS) 1532.0 0.000000e+00 835/838 (99%)
EPI573684 A/mallard duck/Kagoshima/KU116/2015(H5N8) (A/H5N8) segment 8 (NS) 1526.5 0.000000e+00 834/838 (99%)
EPI573668 A/crane/Kagoshima/KU53/2015(H5N8) (A/H5N8) segment 8 (NS) 1526.5 0.000000e+00 834/838 (99%)
EPI573658 A/crane/Kagoshima/KU41/2014(H5N8) (A/H5N8) segment 8 (NS) 1526.5 0.000000e+00 834/838 (99%)
EPI573650 A/crane/Kagoshima/KU21/2014(H5N8) (A/H5N8) segment 8 (NS) 1526.5 0.000000e+00 834/838 (99%)
EPI553347 A/chicken/Miyazaki/7/2014 (A/H5N8) segment 8 (NS) 1520.9 0.000000e+00 833/838 (99%)
EPI542998 A/duck/Beijing/FS01/2013 (A/H5N8) segment 8 (NS) 1520.9 0.000000e+00 831/835 (99%)
EPI573676 A/mallard duck/Kagoshima/KU70/2015(H5N8) (A/H5N8) segment 8 (NS) 1519.1 0.000000e+00 832/837 (99%)
EPI543014 A/duck/Beijing/CT01/2014 (A/H5N8) segment 8 (NS) 1515.4 0.000000e+00 830/835 (99%)
EPI543006 A/duck/Beijing/FS01/2014 (A/H5N8) segment 8 (NS) 1509.8 0.000000e+00 829/835 (99%)
EPI553183 A/turkey/Italy/14VIR7898-10/2014 (A/H5N8) segment 8 (NS) 1493.2 0.000000e+00 813/816 (99%)
EPI552780 A/chicken/Netherlands/emc-3/2014 (A/H5N8) segment 8 (NS) 1493.2 0.000000e+00 812/814 (99%)
EPI431452 A/duck/Hebei/2/2011 (A/H5N2) segment 8 (NS) 1493.2 0.000000e+00 823/830 (99%)
EPI403396 A/duck/Eastern China/1111/2011 (A/H5N2) segment 8 (NS) 1493.2 0.000000e+00 828/838 (98%)
EPI414242 A/duck/Jiangsu/1-15/2011 (A/H4N2) segment 8 (NS) 1487.7 0.000000e+00 827/838 (98%)
EPI403397 A/goose/Eastern China/1112/2011 (A/H5N2) segment 8 (NS) 1482.1 0.000000e+00 827/839 (98%)
EPI552764 A/eurasian wigeon/Netherlands/emc-1/2014 (A/H5N8) segment 8 (NS) 1472.9 0.000000e+00 799/800 (99%)
EPI475583 A/wild duck/Shandong/628/2011 (A/H5N1) segment 8 (NS) 1448.9 0.000000e+00 820/838 (97%)
EPI431460 A/duck/Hebei/3/2011 (A/H5N2) segment 8 (NS) 1439.7 0.000000e+00 815/832 (97%)
EPI399964 A/duck/Jiangsu/m234/2012 (A/H5N2) segment 8 (NS) 1428.6 0.000000e+00 815/836 (97%)
EPI552772 A/eurasian wigeon/Netherlands/emc-2/2014 (A/H5N8) segment 8 (NS) 1404.6 0.000000e+00 768/772 (99%)
EPI296628 A/mallard/Sweden/95/2005 (A/H7N7) segment 8 (NS) 1371.3 0.000000e+00 806/838 (96%)
EPI130868 A/duck/Nanchang/1944/1993 (A/H7N4) segment 8 (NS) 1371.3 0.000000e+00 806/838 (96%)
EPI89129 A/duck/Nanchang/1904/1992 (A/H7N1) segment 8 (NS) 1371.3 0.000000e+00 806/838 (96%)
EPI485927 A/mallard/Sweden/17/2002 (A/H10N4) segment 8 (NS) 1365.8 0.000000e+00 805/838 (96%)
EPI485684 A/mallard/Sweden/64/2003 (A/H7N7) segment 8 (NS) 1365.8 0.000000e+00 805/838 (96%)
EPI377644 A/mallard/Netherlands/14/2001 (A/H2N3) segment 8 (NS) 1365.8 0.000000e+00 805/838 (96%)
EPI251862 A/whitefronted goose/Netherlands/2/1999 (A/H6N2) segment 8 (NS) 1365.8 0.000000e+00 805/838 (96%)
EPI251854 A/whitefronted goose/Netherlands/1/1999 (A/H6N1) segment 8 (NS) 1365.8 0.000000e+00 805/838 (96%)
EPI251704 A/mallard/Sweden/4/2002 (A/H10N2) segment 8 (NS) 1365.8 0.000000e+00 806/839 (96%)
EPI251621 A/greylag goose/Netherlands/4/1999 (A/H6N1) segment 8 (NS) 1365.8 0.000000e+00 805/838 (96%)
EPI182085 A/black-headed gull/Netherlands/1/2005 (A/H6N8) segment 8 (NS) 1365.8 0.000000e+00 805/838 (96%)
EPI105878 A/duck/Primorie/3691/02 (A/H12N2) segment 8 (NS) 1365.8 0.000000e+00 799/829 (96%)
EPI514909 A/mallard/Sweden/146/2002 (A/H4N6) segment 8 (NS) 1360.3 0.000000e+00 805/839 (95%)
EPI514749 A/mallard/Sweden/4514/2004 (A/H4N6) segment 8 (NS) 1360.3 0.000000e+00 804/838 (95%)
EPI514157 A/mallard/Sweden/58359/2006 (A/H0) segment 8 (NS) 1360.3 0.000000e+00 804/838 (95%)
EPI447398 A/mallard/Italy/3401/2005 (A/H5N1) segment 8 (NS) 1360.3 0.000000e+00 804/838 (95%)
EPI447396 A/mallard/Italy/3401/2005 (A/H5N1) segment 8 (NS) 1360.3 0.000000e+00 804/838 (95%)
EPI327321 A/mallard/Italy/3401/2005 (A/H5N1) segment 8 (NS) 1360.3 0.000000e+00 804/838 (95%)

_________________
www.twitter.com/hniman


Top
 Profile  
 
Display posts from previous:  Sort by  
Post new topic Reply to topic  [ 19 posts ]  Go to page 1, 2  Next

All times are UTC - 5 hours [ DST ]


Who is online

Users browsing this forum: Google [Bot], Yahoo [Bot] and 45 guests


You cannot post new topics in this forum
You cannot reply to topics in this forum
You cannot edit your posts in this forum
You cannot delete your posts in this forum
You cannot post attachments in this forum

Search for:
Jump to:  
cron
Powered by phpBB® Forum Software © phpBB Group