Rhiza Labs FluTracker Forum

The place to discuss the flu
It is currently Thu Oct 19, 2017 2:01 pm

All times are UTC - 5 hours [ DST ]




Post new topic Reply to topic  [ 4 posts ] 
Author Message
PostPosted: Tue May 12, 2015 8:34 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
2015 Fujain H5N2 Osceola Co Iowa Chicken H5 (A/chicken/Iowa/04-20/2015 collected April 20) is identical in all 1704 coding positions with 2014 turkey sequence, A/turkey/Washington/61-22/2014.

South Dakota State University is to be commended for the rapid release of these sequences, which were from the first large outbreak (3,800,000) in Iowa chickens. The company, head-quatered in South Dakota, used a SDSU contract to confirm the H5N2 prior to confirmation by the USDA in Ames, Iowa.

In contrast to sequences generated by the USDA in the US and CFIA in Canada, a full set of sequences was promptly released at Genbank.

The identity in the H5's discount new genetic changes in the spread in the Midwest, although changes in the coding regions of the other 7 gene gene segments were noted and can be used to address clone expansion in spread

A Hong Kong report noted that the farm in Osceoloa county had infections in 3 barns, suggesting barn to barn spread, but the H5 had no new chnages in the coding region.

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Tue May 12, 2015 8:40 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
LOCUS KR492974 1744 bp cRNA linear VRL 08-MAY-2015
DEFINITION Influenza A virus (A/chicken/Iowa/04-20/2015(H5N2)) segment 4
hemagglutinin (HA) gene, complete cds.
ACCESSION KR492974
VERSION KR492974.1 GI:819565652
KEYWORDS .
SOURCE Influenza A virus (A/chicken/Iowa/04-20/2015(H5N2))
ORGANISM Influenza A virus (A/chicken/Iowa/04-20/2015(H5N2))
Viruses; ssRNA viruses; ssRNA negative-strand viruses;
Orthomyxoviridae; Influenzavirus A.
REFERENCE 1 (bases 1 to 1744)
AUTHORS Clement,T., Kutish,G.F., Scaria,J., Hennings,J., Nelson,E. and
Diel,D.G.
TITLE Complete genome sequence of a highly pathogenic avian influenza
virus (H5N2) associated with high mortality in commercial chickens
in the U.S., 2015
JOURNAL Unpublished
REFERENCE 2 (bases 1 to 1744)
AUTHORS Clement,T., Kutish,G.F., Scaria,J., Hennings,J., Nelson,E. and
Diel,D.G.
TITLE Direct Submission
JOURNAL Submitted (05-MAY-2015) Veterinary and Biomedical Sciences, SDSU,
North Campus Dr, Brookings, SD 57007, USA
COMMENT GenBank Accession Numbers KR492971-KR492978 represent sequences
from the 8 segments of Influenza A virus
(A/chicken/Iowa/04-20/2015(H5N2)).

##Assembly-Data-START##
Assembly Method :: CAP3 v. 3
Sequencing Technology :: Illumina
##Assembly-Data-END##
FEATURES Location/Qualifiers
source 1..1744
/organism="Influenza A virus
(A/chicken/Iowa/04-20/2015(H5N2))"
/mol_type="viral cRNA"
/strain="A/chicken/Iowa/04-20/2015"
/serotype="H5N2"
/isolation_source="oropharyngeal swab"
/host="Gallus gallus"
/db_xref="taxon:1650957"
/segment="4"
/country="USA"
/collection_date="20-Apr-2015"
gene 17..1720
/gene="HA"
CDS 17..1720
/gene="HA"
/codon_start=1
/product="hemagglutinin"
/protein_id="AKG52687.1"
/db_xref="GI:819565653"
/translation="MEKIVLLFAVISLVKSDQICIGYHANNSTKQVDTIMEKNVTVTH
AQDILERTHNGKLCDLNGVKPLILKDCSVAGWLLGNPMCDEFIRVPEWSYIVERANPA
NDLCYPGTLNDYEELKHLLSRINHFEKTLIIPRSSWPNHETSLGVSAACPYQGASSFF
RNVVWLIKKNDAYPTIKISYNNTNREDLLILWGIHHSNNAAEQTNLYKNPDTYVSVGT
STLNQRLVPKIATRSQVNGQSGRMDFFWTILKPNDAIHFESNGNFIAPEYAYKIVKKG
DSTIMKSEMEYGHCNTKCQTPIGAINSSMPFHNIHPLTIGECPKYVKSNKLVLATGLR
NSPLRERRRKRGLFGAIAGFIEGGWQGMVDGWYGYHHSNEQGSGYAADKESTQKAIDG
VTNKVNSIIDKMNTQFEAVGREFNNLERRIENLNKKMEDGFLDVWTYNAELLVLMENE
RTLDFHDSNVKNLYDKVRLQLRDNAKELGNGCFEFYHKCDNECMESVRNGTYDYPKYS
EEAILKREEISGVKLESIGTYQILSIYSTVASSLALAIIVAGLSLWMCSNGSLQCRIC
I"
ORIGIN
1 ggttcaatct gtcaaaatgg agaaaatagt gcttcttttt gcagtgatta gccttgttaa
61 aagtgatcag atttgcattg gttaccatgc aaacaactca acaaagcagg ttgacacgat
121 aatggagaaa aacgtcactg ttacacatgc ccaagacata ctggaaagga cacacaacgg
181 gaagctctgc gatcttaatg gagtgaagcc cctgattcta aaggattgta gcgtagctgg
241 gtggctcctt ggaaatccaa tgtgcgacga gttcatcagg gtaccggaat ggtcttacat
301 cgtggagagg gctaacccag ccaacgacct ctgttaccca gggaccctca atgactatga
361 ggaactgaaa cacctattga gcagaataaa tcattttgag aaaactctga tcatccccag
421 gagttcttgg cccaatcatg aaacatcatt aggggtgagc gcagcatgtc cataccaggg
481 agcatcctca tttttcagaa atgtggtatg gctcatcaaa aagaacgatg catacccgac
541 aataaagata agctacaata ataccaatcg ggaagatctt ttgatactgt gggggattca
601 tcattccaac aatgcagcag agcagacaaa tctctataaa aacccagaca cttatgtttc
661 cgttgggaca tcaacattaa accagagatt ggtgccaaaa atagctacta gatcccaagt
721 aaacgggcag agtggaagaa tggatttctt ctggacaatt ttaaaaccga atgatgcaat
781 ccactttgag agtaatggaa atttcattgc tccagaatat gcatacaaaa ttgtcaagaa
841 aggggactca acaattatga aaagtgaaat ggagtatggc cactgcaaca ccaaatgtca
901 aactccaata ggggcgataa actctagcat gccattccac aatatacacc ctctcaccat
961 cggggaatgc cccaaatacg tgaagtcaaa caaattagtc cttgcgactg ggctcagaaa
1021 tagtcctcta agagaaagaa gaagaaaaag aggactattt ggagctatag cagggtttat
1081 agagggagga tggcagggaa tggtagacgg ttggtatggg tatcatcata gcaatgagca
1141 ggggagtggg tacgctgcag acaaagaatc aacccaaaag gcaatagatg gagttaccaa
1201 taaggtcaac tcaatcattg acaaaatgaa cactcaattt gaggccgttg gaagggaatt
1261 taataactta gaaaggagaa tagagaattt aaacaagaaa atggaagacg gattcctaga
1321 tgtctggact tataatgctg aacttttagt tctcatggaa aatgagagaa ctctagattt
1381 ccatgactca aatgtcaaga acctttacga caaagtccga ctacagctta gggataatgc
1441 aaaggagctg ggtaatggtt gtttcgagtt ctatcataaa tgtgataacg aatgtatgga
1501 gagcgtaaga aatgggacgt atgactaccc taagtattca gaagaagcaa tattaaaaag
1561 agaagaaata agcggagtga aattagaatc aataggaact taccagatac tgtcaattta
1621 ttcaacagtg gcgagttccc tagcactggc aatcatagtg gctggtctat ctttatggat
1681 gtgctctaat gggtcgttac aatgcagaat ttgcatctaa atttgtgagc tcagattgta
1741 atta

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Tue May 12, 2015 8:40 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
LOCUS KP739397 1744 bp cRNA linear VRL 18-FEB-2015
DEFINITION Influenza A virus (A/turkey/Washington/61-22/2014(H5N2)) segment 4
hemagglutinin (HA) gene, complete cds.
ACCESSION KP739397
VERSION KP739397.1 GI:756762567
KEYWORDS .
SOURCE Influenza A virus (A/turkey/Washington/61-22/2014(H5N2))
ORGANISM Influenza A virus (A/turkey/Washington/61-22/2014(H5N2))
Viruses; ssRNA negative-strand viruses; Orthomyxoviridae;
Influenzavirus A.
REFERENCE 1 (bases 1 to 1744)
AUTHORS Killian,M.L.
TITLE Direct Submission
JOURNAL Submitted (26-JAN-2015) Diagnostic Virology Laboratory, National
Veterinary Services Laboratories (NVSL), USDA, 1920 Dayton Avenue,
Ames, IA 50010, USA
COMMENT GenBank Accession Numbers KP739394-KP739401 represent sequences
from the 8 segments of Influenza A virus
(A/turkey/Washington/61-22/2014(H5N2)).

##Assembly-Data-START##
Assembly Method :: SeqMan NGen v. 4
Sequencing Technology :: IonTorrent
##Assembly-Data-END##
FEATURES Location/Qualifiers
source 1..1744
/organism="Influenza A virus
(A/turkey/Washington/61-22/2014(H5N2))"
/mol_type="viral cRNA"
/strain="A/turkey/Washington/61-22/2014"
/serotype="H5N2"
/isolation_source="oropharyngeal swab"
/host="turkey; backyard poultry"
/db_xref="taxon:1609058"
/segment="4"
/country="USA: Benton County, Washington"
/collection_date="30-Dec-2014"
/note="NVSL 15-000061; EP1; Eurasian origin (EA-H5N8 clade
2.3.4.4)-North American reassortant"
gene 17..1720
/gene="HA"
CDS 17..1720
/gene="HA"
/codon_start=1
/product="hemagglutinin"
/protein_id="AJM70587.1"
/db_xref="GI:756762568"
/translation="MEKIVLLFAVISLVKSDQICIGYHANNSTKQVDTIMEKNVTVTH
AQDILERTHNGKLCDLNGVKPLILKDCSVAGWLLGNPMCDEFIRVPEWSYIVERANPA
NDLCYPGTLNDYEELKHLLSRINHFEKTLIIPRSSWPNHETSLGVSAACPYQGASSFF
RNVVWLIKKNDAYPTIKISYNNTNREDLLILWGIHHSNNAAEQTNLYKNPDTYVSVGT
STLNQRLVPKIATRSQVNGQSGRMDFFWTILKPNDAIHFESNGNFIAPEYAYKIVKKG
DSTIMKSEMEYGHCNTKCQTPIGAINSSMPFHNIHPLTIGECPKYVKSNKLVLATGLR
NSPLRERRRKRGLFGAIAGFIEGGWQGMVDGWYGYHHSNEQGSGYAADKESTQKAIDG
VTNKVNSIIDKMNTQFEAVGREFNNLERRIENLNKKMEDGFLDVWTYNAELLVLMENE
RTLDFHDSNVKNLYDKVRLQLRDNAKELGNGCFEFYHKCDNECMESVRNGTYDYPKYS
EEAILKREEISGVKLESIGTYQILSIYSTVASSLALAIIVAGLSLWMCSNGSLQCRIC
I"
ORIGIN
1 ggttcaatct gtcaaaatgg agaaaatagt gcttcttttt gcagtgatta gccttgttaa
61 aagtgatcag atttgcattg gttaccatgc aaacaactca acaaagcagg ttgacacgat
121 aatggagaaa aacgtcactg ttacacatgc ccaagacata ctggaaagga cacacaacgg
181 gaagctctgc gatcttaatg gagtgaagcc cctgattcta aaggattgta gcgtagctgg
241 gtggctcctt ggaaatccaa tgtgcgacga gttcatcagg gtaccggaat ggtcttacat
301 cgtggagagg gctaacccag ccaacgacct ctgttaccca gggaccctca atgactatga
361 ggaactgaaa cacctattga gcagaataaa tcattttgag aaaactctga tcatccccag
421 gagttcttgg cccaatcatg aaacatcatt aggggtgagc gcagcatgtc cataccaggg
481 agcatcctca tttttcagaa atgtggtatg gctcatcaaa aagaacgatg catacccgac
541 aataaagata agctacaata ataccaatcg ggaagatctt ttgatactgt gggggattca
601 tcattccaac aatgcagcag agcagacaaa tctctataaa aacccagaca cttatgtttc
661 cgttgggaca tcaacattaa accagagatt ggtgccaaaa atagctacta gatcccaagt
721 aaacgggcag agtggaagaa tggatttctt ctggacaatt ttaaaaccga atgatgcaat
781 ccactttgag agtaatggaa atttcattgc tccagaatat gcatacaaaa ttgtcaagaa
841 aggggactca acaattatga aaagtgaaat ggagtatggc cactgcaaca ccaaatgtca
901 aactccaata ggggcgataa actctagcat gccattccac aatatacacc ctctcaccat
961 cggggaatgc cccaaatacg tgaagtcaaa caaattagtc cttgcgactg ggctcagaaa
1021 tagtcctcta agagaaagaa gaagaaaaag aggactattt ggagctatag cagggtttat
1081 agagggagga tggcagggaa tggtagacgg ttggtatggg tatcatcata gcaatgagca
1141 ggggagtggg tacgctgcag acaaagaatc aacccaaaag gcaatagatg gagttaccaa
1201 taaggtcaac tcaatcattg acaaaatgaa cactcaattt gaggccgttg gaagggaatt
1261 taataactta gaaaggagaa tagagaattt aaacaagaaa atggaagacg gattcctaga
1321 tgtctggact tataatgctg aacttttagt tctcatggaa aatgagagaa ctctagattt
1381 ccatgactca aatgtcaaga acctttacga caaagtccga ctacagctta gggataatgc
1441 aaaggagctg ggtaatggtt gtttcgagtt ctatcataaa tgtgataacg aatgtatgga
1501 gagcgtaaga aatgggacgt atgactaccc taagtattca gaagaagcaa tattaaaaag
1561 agaagaaata agcggagtga aattagaatc aataggaact taccagatac tgtcaattta
1621 ttcaacagtg gcgagttccc tagcactggc aatcatagtg gctggtctat ctttatggat
1681 gtgctctaat gggtcgttac aatgcagaat ttgcatctaa atttgtgagc tcagattgta
1741 atta

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Tue May 12, 2015 8:42 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
EPI573281 A/turkey/Washington/61-22/2014 (A/H5N2) segment 4 (HA) 3147.8 0.000000e+00 1704/1704 (100%)
EPI573271 A/chicken/Washington/61-9/2014 (A/H5N2) segment 4 (HA) 3142.3 0.000000e+00 1703/1704 (99%)
EPI586550 A/chicken/BC/FAV24/2014 (A/H5N2) segment 4 (HA) 3136.7 0.000000e+00 1702/1704 (99%)
EPI586518 A/chicken/BC/FAV20/2014 (A/H5N2) segment 4 (HA) 3136.7 0.000000e+00 1702/1704 (99%)
EPI586509 A/poultry/BC/FAV19/2014 (A/H5N2) segment 4 (HA) 3136.7 0.000000e+00 1702/1704 (99%)
EPI584079 A/turkey/BC/FAV14/2014 (A/H5N2) segment 4 (HA) 3136.7 0.000000e+00 1702/1704 (99%)
EPI573298 A/turkey/BC/FAV10/2014 (A/H5N2) segment 4 (HA) 3136.7 0.000000e+00 1702/1704 (99%)
EPI573276 A/domestic duck/Washington/61-16/2014 (A/H5N2) segment 4 (HA) 3136.7 0.000000e+00 1702/1704 (99%)
EPI586534 A/chicken/BC/FAV22/2014 (A/H5N2) segment 4 (HA) 3133.0 0.000000e+00 1701/1704 (99%)
EPI586542 A/chicken/BC/FAV23/2014 (A/H5N2) segment 4 (HA) 3131.2 0.000000e+00 1701/1704 (99%)
EPI586526 A/chicken/BC/FAV21/2014 (A/H5N2) segment 4 (HA) 3131.2 0.000000e+00 1701/1704 (99%)
EPI586493 A/poultry/BC/FAV15/2014 (A/H5N2) segment 4 (HA) 3131.2 0.000000e+00 1701/1704 (99%)
EPI585092 A/pheasant/Washington/3147-2/2015 (A/H5N2) segment 4 (HA) 3131.2 0.000000e+00 1701/1704 (99%)
EPI576470 A/chicken/BC/FAV8/2014 (A/H5N2) segment 4 (HA) 3131.2 0.000000e+00 1701/1704 (99%)
EPI586501 A/poultry/BC/FAV17/2014 (A/H5N2) segment 4 (HA) 3125.7 0.000000e+00 1700/1704 (99%)
EPI576477 A/chicken/BC/FAV9/2014 (A/H5N2) segment 4 (HA) 3125.7 0.000000e+00 1700/1704 (99%)
EPI569383 A/Northern pintail/Washington/40964/2014 (A/H5N2) segment 4 (HA) 3125.7 0.000000e+00 1700/1704 (99%)
EPI586558 A/chicken/BC/FAV25/2014 (A/H5N2) segment 4 (HA) 3120.1 0.000000e+00 1699/1704 (99%)
EPI569390 A/gyrfalcon/Washington/41088-6/2014 (A/H5N8) segment 4 (HA) 3109.0 0.000000e+00 1697/1704 (99%)
EPI569376 A/guinea fowl/Oregon/41613-1/2014 (A/H5N8) segment 4 (HA) 3109.0 0.000000e+00 1697/1704 (99%)
EPI569372 A/chicken/Oregon/41613-2/2014 (A/H5N8) segment 4 (HA) 3109.0 0.000000e+00 1697/1704 (99%)
EPI585084 A/turkey/California/K1500169-1.2/2015 (A/H5N8) segment 4 (HA) 3103.5 0.000000e+00 1696/1704 (99%)
EPI573638 A/crane/Kagoshima/KU13/2014(H5N8) (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1694/1704 (99%)
EPI573286 A/American green-winged teal/Washington/195750/2014 (A/H5N1) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%)
EPI553208 A/crane/Kagoshima/KU1/2014 (A/H5N8) segment 4 (HA) 3066.6 0.000000e+00 1688/1702 (99%)
EPI561570 A/Baikal teal/Korea/H96/2014 (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1689/1704 (99%)
EPI585595 A/baikal teal/Korea/2417/2014 (A/H5N8) segment 4 (HA) 3059.2 0.000000e+00 1689/1705 (99%)
EPI585589 A/baikal teal/Korea/2399/2014 (A/H5N8) segment 4 (HA) 3059.2 0.000000e+00 1689/1705 (99%)
EPI585586 A/baikal teal/Korea/1456/2014 (A/H5N8) segment 4 (HA) 3059.2 0.000000e+00 1689/1705 (99%)
EPI561646 A/breeder duck/Korea/H249/2014 (A/H5N8) segment 4 (HA) 3059.2 0.000000e+00 1689/1705 (99%)
EPI561626 A/mallard/Korea/H207/2014 (A/H5N8) segment 4 (HA) 3059.2 0.000000e+00 1689/1705 (99%)
EPI561605 A/broiler duck/Korea/H145/2014 (A/H5N8) segment 4 (HA) 3059.2 0.000000e+00 1689/1705 (99%)
EPI561591 A/breeder duck/Korea/H128/2014 (A/H5N8) segment 4 (HA) 3059.2 0.000000e+00 1689/1705 (99%)
EPI561529 A/Baikal teal/Korea/H66/2014 (A/H5N8) segment 4 (HA) 3059.2 0.000000e+00 1689/1705 (99%)
EPI561508 A/bean goose/Korea/H53/2014 (A/H5N8) segment 4 (HA) 3059.2 0.000000e+00 1689/1705 (99%)
EPI561341 A/Baikal teal/Korea/H41/2014 (A/H5N8) segment 4 (HA) 3059.2 0.000000e+00 1689/1705 (99%)
EPI585594 A/baikal teal/Korea/2416/2014 (A/H5N8) segment 4 (HA) 3053.6 0.000000e+00 1688/1705 (99%)
EPI585592 A/baikal teal/Korea/2406/2014 (A/H5N8) segment 4 (HA) 3053.6 0.000000e+00 1688/1705 (99%)
EPI585591 A/baikal teal/Korea/2403/2014 (A/H5N8) segment 4 (HA) 3053.6 0.000000e+00 1688/1705 (99%)
EPI585590 A/baikal teal/Korea/2402/2014 (A/H5N8) segment 4 (HA) 3053.6 0.000000e+00 1688/1705 (99%)
EPI585582 A/baikal teal/Korea/1448/2014 (A/H5N8) segment 4 (HA) 3053.6 0.000000e+00 1688/1705 (99%)
EPI585581 A/baikal teal/Korea/1447/2014 (A/H5N8) segment 4 (HA) 3053.6 0.000000e+00 1688/1705 (99%)
EPI585579 A/baikal teal/Korea/1445/2014 (A/H5N8) segment 4 (HA) 3053.6 0.000000e+00 1688/1705 (99%)
EPI585577 A/baikal teal/Korea/1437/2014 (A/H5N8) segment 4 (HA) 3053.6 0.000000e+00 1688/1705 (99%)
EPI561674 A/bean goose/Korea/H328/2014 (A/H5N8) segment 4 (HA) 3053.6 0.000000e+00 1688/1705 (99%)
EPI561612 A/breeder duck/Korea/H158/2014 (A/H5N8) segment 4 (HA) 3053.6 0.000000e+00 1688/1705 (99%)
EPI561577 A/breeder chicken/Korea/H122/2014 (A/H5N8) segment 4 (HA) 3053.6 0.000000e+00 1688/1705 (99%)
EPI561563 A/Baikal teal/Korea/H84/2014 (A/H5N8) segment 4 (HA) 3053.6 0.000000e+00 1688/1705 (99%)
EPI561542 A/Baikal teal/Korea/H68/2014 (A/H5N8) segment 4 (HA) 3053.6 0.000000e+00 1688/1705 (99%)
EPI561522 A/broiler duck/Korea/H65/2014 (A/H5N8) segment 4 (HA) 3053.6 0.000000e+00 1688/1705 (99%)
EPI585593 A/baikal teal/Korea/2414/2014 (A/H5N8) segment 4 (HA) 3048.1 0.000000e+00 1687/1705 (98%)
EPI585587 A/baikal teal/Korea/1457/2014 (A/H5N8) segment 4 (HA) 3048.1 0.000000e+00 1687/1705 (98%)
EPI585584 A/baikal teal/Korea/1452/2014 (A/H5N8) segment 4 (HA) 3048.1 0.000000e+00 1687/1705 (98%)
EPI585583 A/baikal teal/Korea/1449/2014 (A/H5N8) segment 4 (HA) 3048.1 0.000000e+00 1687/1705 (98%)
EPI561705 A/bean goose/Korea/H40/2014 (A/H5N8) segment 4 (HA) 3048.1 0.000000e+00 1687/1705 (98%)
EPI561667 A/mallard/Korea/H297/2014 (A/H5N8) segment 4 (HA) 3048.1 0.000000e+00 1688/1706 (98%)
EPI561653 A/breeder chicken/Korea/H250/2014 (A/H5N8) segment 4 (HA) 3048.1 0.000000e+00 1687/1705 (98%)
EPI561633 A/white-fronted goose/Korea/H231/2014 (A/H5N8) segment 4 (HA) 3048.1 0.000000e+00 1687/1705 (98%)
EPI509704 A/broiler duck/Korea/Buan2/2014 (A/H5N8) segment 4 (HA) 3048.1 0.000000e+00 1687/1705 (98%)
EPI585580 A/baikal teal/Korea/1446/2014 (A/H5N8) segment 4 (HA) 3042.6 0.000000e+00 1686/1705 (98%)
EPI573196 A/broiler duck/Korea/H651/2014 (A/H5N8) segment 4 (HA) 3042.6 0.000000e+00 1686/1705 (98%)
EPI573194 A/breeder chicken/Korea/H818/2014 (A/H5N8) segment 4 (HA) 3042.6 0.000000e+00 1686/1705 (98%)
EPI561697 A/spot-billed duck/Korea/H455-42/2014 (A/H5N8) segment 4 (HA) 3042.6 0.000000e+00 1686/1705 (98%)
EPI561681 A/tundra swan/Korea/H411/2014 (A/H5N8) segment 4 (HA) 3042.6 0.000000e+00 1686/1705 (98%)
EPI561660 A/Korean native chicken/Korea/H257/2014 (A/H5N8) segment 4 (HA) 3042.6 0.000000e+00 1686/1705 (98%)
EPI561598 A/broiler duck/Korea/H133/2014 (A/H5N8) segment 4 (HA) 3042.6 0.000000e+00 1686/1705 (98%)
EPI561360 A/broiler duck/Korea/H49/2014 (A/H5N8) segment 4 (HA) 3042.6 0.000000e+00 1686/1705 (98%)
EPI561348 A/broiler duck/Korea/H47/2014 (A/H5N8) segment 4 (HA) 3042.6 0.000000e+00 1686/1705 (98%)
EPI561336 A/broiler duck/Korea/H48/2014 (A/H5N8) segment 4 (HA) 3042.6 0.000000e+00 1686/1705 (98%)
EPI561204 A/broiler duck/Korea/H31/2014 (A/H5N8) segment 4 (HA) 3042.6 0.000000e+00 1686/1705 (98%)
EPI561196 A/broiler duck/Korea/H29/2014 (A/H5N8) segment 4 (HA) 3042.6 0.000000e+00 1686/1705 (98%)
EPI561187 A/waterfowl/Korea/S005/2014 (A/H5N8) segment 4 (HA) 3042.6 0.000000e+00 1686/1705 (98%)
EPI517161 A/Chicken/Kumamoto/1-7/2014 (A/H5N8) segment 4 (HA) 3042.6 0.000000e+00 1686/1705 (98%)
EPI585588 A/baikal teal/Korea/1458/2014 (A/H5N8) segment 4 (HA) 3037.0 0.000000e+00 1685/1705 (98%)
EPI585585 A/baikal teal/Korea/1454/2014 (A/H5N8) segment 4 (HA) 3037.0 0.000000e+00 1685/1705 (98%)
EPI573192 A/breeder chicken/Korea/H503/2014 (A/H5N8) segment 4 (HA) 3037.0 0.000000e+00 1685/1705 (98%)
EPI561690 A/common teal/Korea/H455-30/2014 (A/H5N8) segment 4 (HA) 3037.0 0.000000e+00 1685/1705 (98%)
EPI561556 A/Coot/Korea/H81/2014 (A/H5N8) segment 4 (HA) 3037.0 0.000000e+00 1685/1705 (98%)
EPI561549 A/Baikal teal/Korea/H80/2014 (A/H5N8) segment 4 (HA) 3037.0 0.000000e+00 1685/1705 (98%)
EPI561515 A/Baikal teal/Korea/H62/2014 (A/H5N8) segment 4 (HA) 3037.0 0.000000e+00 1685/1705 (98%)
EPI509709 A/baikal teal/Korea/Donglim3/2014 (A/H5N8) segment 4 (HA) 3037.0 0.000000e+00 1685/1705 (98%)
EPI585578 A/baikal teal/Korea/1441/2014 (A/H5N8) segment 4 (HA) 3031.5 0.000000e+00 1685/1706 (98%)
EPI573195 A/breeder chicken/Korea/H818/2014 (A/H5N8) segment 4 (HA) 3031.5 0.000000e+00 1684/1705 (98%)
EPI561619 A/breeder duck/Korea/H200/2014 (A/H5N8) segment 4 (HA) 3025.9 0.000000e+00 1684/1706 (98%)
EPI542628 A/mallard/Korea/W452/2014 (A/H5N8) segment 4 (HA) 3020.4 0.000000e+00 1682/1705 (98%)
EPI550849 A/duck/England/36226/14 (A/H5N8) segment 4 (HA) 3009.3 0.000000e+00 1680/1705 (98%)
EPI550848 A/duck/England/36038/14 (A/H5N8) segment 4 (HA) 3009.3 0.000000e+00 1680/1705 (98%)
EPI553349 A/wigeon/Sakha/1/2014 (A/H5N8) segment 4 (HA) 3003.8 0.000000e+00 1679/1705 (98%)
EPI547673 A/duck/England/36254/14 (A/H5N8) segment 4 (HA) 2998.2 0.000000e+00 1678/1705 (98%)
EPI552746 A/turkey/Germany/R2474-L00899/2014 (A/H5N8) segment 4 (HA) 2987.2 0.000000e+00 1676/1705 (98%)
EPI548493 A/duck/Chiba/26-372-61/2014 (A/H5N8) segment 4 (HA) 2987.2 0.000000e+00 1676/1705 (98%)
EPI548485 A/duck/Chiba/26-372-48/2014 (A/H5N8) segment 4 (HA) 2987.2 0.000000e+00 1676/1705 (98%)
EPI547678 A/Chicken/Netherlands/14015526/2014 (A/H5N8) segment 4 (HA) 2987.2 0.000000e+00 1676/1705 (98%)
EPI548623 A/chicken/Netherlands/14015531/2014 (A/H5N8) segment 4 (HA) 2981.6 0.000000e+00 1675/1705 (98%)
EPI553362 A/environment/Kagoshima/KU-ngr-H/2014 (A/H5N8) segment 4 (HA) 2976.1 0.000000e+00 1674/1705 (98%)
EPI553343 A/chicken/Miyazaki/7/2014 (A/H5N8) segment 4 (HA) 2976.1 0.000000e+00 1675/1706 (98%)
EPI573654 A/crane/Kagoshima/KU41/2014(H5N8) (A/H5N8) segment 4 (HA) 2970.5 0.000000e+00 1674/1706 (98%)
EPI573646 A/crane/Kagoshima/KU21/2014(H5N8) (A/H5N8) segment 4 (HA) 2970.5 0.000000e+00 1674/1706 (98%)
EPI573664 A/crane/Kagoshima/KU53/2015(H5N8) (A/H5N8) segment 4 (HA) 2965.0 0.000000e+00 1673/1706 (98%)
EPI544756 A/turkey/Germany-MV/R2472/2014 (A/H5N8) segment 4 (HA) 2965.0 0.000000e+00 1664/1693 (98%)

_________________
www.twitter.com/hniman


Top
 Profile  
 
Display posts from previous:  Sort by  
Post new topic Reply to topic  [ 4 posts ] 

All times are UTC - 5 hours [ DST ]


Who is online

Users browsing this forum: Yahoo [Bot] and 64 guests


You cannot post new topics in this forum
You cannot reply to topics in this forum
You cannot edit your posts in this forum
You cannot delete your posts in this forum
You cannot post attachments in this forum

Search for:
Jump to:  
cron
Powered by phpBB® Forum Software © phpBB Group