Rhiza Labs FluTracker Forum

The place to discuss the flu
It is currently Wed Oct 18, 2017 4:09 pm

All times are UTC - 5 hours [ DST ]




Post new topic Reply to topic  [ 26 posts ]  Go to page Previous  1, 2, 3  Next
Author Message
PostPosted: Wed Feb 11, 2015 1:25 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
EPI299288 A/avian/Japan/8KI0135/2008 (A/H6N5) segment 2 (PB1) 4045.3 0.000000e+00 2246/2274 (98%)
EPI469410 A/northern shoveler/Hong Kong/MPK276/2009 (A/H11N9) segment 2 (PB1) 3978.8 0.000000e+00 2234/2274 (98%)
EPI401336 A/wild duck/Korea/PSC6-1/2009 (A/H4N6) segment 2 (PB1) 3951.1 0.000000e+00 2229/2274 (98%)
EPI500932 A/Duck/Fujian/S4081/2008 (A/H6N2) segment 2 (PB1) 3945.6 0.000000e+00 2228/2274 (97%)
EPI315129 A/duck/Vietnam/G30/2008 (A/H11N9) segment 2 (PB1) 3945.6 0.000000e+00 2228/2274 (97%)
EPI231151 A/spot-billed duck/Korea/528/2008 (A/H6N8) segment 2 (PB1) 3945.6 0.000000e+00 2228/2274 (97%)
EPI501076 A/Duck/Hubei/S4170/2008 (A/H6N2) segment 2 (PB1) 3940.0 0.000000e+00 2227/2274 (97%)
EPI500884 A/Chicken/Guangdong/S2346/2009 (A/H6N2) segment 2 (PB1) 3940.0 0.000000e+00 2227/2274 (97%)
EPI231183 A/spot-billed duck/Korea/540/2008 (A/H6N1) segment 2 (PB1) 3938.2 0.000000e+00 2218/2261 (98%)
EPI469414 A/duck/Yunnan/87/2007 (A/H7N6) segment 2 (PB1) 3934.5 0.000000e+00 2224/2271 (97%)
EPI469339 A/wild waterfowl/Hong Kong/MPM2121/2011 (A/H7N7) segment 2 (PB1) 3934.5 0.000000e+00 2226/2274 (97%)
EPI469336 A/common teal/Hong Kong/MPL634/2011 (A/H7N7) segment 2 (PB1) 3934.5 0.000000e+00 2226/2274 (97%)
EPI469334 A/common teal/Hong Kong/MPM1645/2011 (A/H7N1) segment 2 (PB1) 3934.5 0.000000e+00 2226/2274 (97%)
EPI387501 A/canvasback/Mongolia/2-69/2007 (A/H10) segment 2 (PB1) 3932.6 0.000000e+00 2226/2274 (97%)
EPI469338 A/wild waterfowl/Hong Kong/MPL705/2011 (A/H7N7) segment 2 (PB1) 3928.9 0.000000e+00 2225/2274 (97%)
EPI398955 A/duck/Hebei/0908/2009 (A/H5N2) segment 2 (PB1) 3928.9 0.000000e+00 2225/2274 (97%)
EPI469337 A/common teal/Hong Kong/MPM1740/2011 (A/H7N7) segment 2 (PB1) 3923.4 0.000000e+00 2224/2274 (97%)
EPI469335 A/common teal/Hong Kong/MPM1670/2011 (A/H7N7) segment 2 (PB1) 3923.4 0.000000e+00 2224/2274 (97%)
EPI331901 A/duck/Jiangxi/k0701/2009 (A/H11N2) segment 2 (PB1) 3923.4 0.000000e+00 2224/2274 (97%)
EPI401350 A/wild duck/Korea/SH5-60/2008 (A/H4N6) segment 2 (PB1) 3917.9 0.000000e+00 2223/2274 (97%)
EPI469340 A/wild waterfowl/Hong Kong/MPL1006/2011 (A/H7N7) segment 2 (PB1) 3912.3 0.000000e+00 2222/2274 (97%)
EPI372479 A/teal/Egypt/12908-NAMRU3/2005 (A/H10N1) segment 2 (PB1) 3912.3 0.000000e+00 2222/2274 (97%)
EPI392671 A/duck/Korea/A122/10 (A/H3N6) segment 2 (PB1) 3901.2 0.000000e+00 2220/2274 (97%)
EPI508061 A/wild duck/Korea/MHC40-28/2010 (A/H7N7) segment 2 (PB1) 3895.7 0.000000e+00 2219/2274 (97%)
EPI503967 A/wild duck/SH17-34/2008 (A/H2N3) segment 2 (PB1) 3895.7 0.000000e+00 2219/2274 (97%)
EPI469430 A/wild waterfowl/Hong Kong/MPL696/2011 (A/H2N9) segment 2 (PB1) 3895.7 0.000000e+00 2219/2274 (97%)
EPI335394 A/aquatic bird/Korea/CN9/2009 (A/H6N8) segment 2 (PB1) 3895.7 0.000000e+00 2219/2274 (97%)
EPI401795 A/canvasback/Xianghai/428/2011 (A/H5N2) segment 2 (PB1) 3890.2 0.000000e+00 2218/2274 (97%)
EPI401343 A/wild duck/Korea/SH5-26/2008 (A/H4N6) segment 2 (PB1) 3890.2 0.000000e+00 2218/2274 (97%)
EPI392675 A/duck/Korea/A117/10 (A/H7N6) segment 2 (PB1) 3890.2 0.000000e+00 2218/2274 (97%)
EPI372369 A/shoveler/Egypt/13251-NAMRU3/2006 (A/H6N2) segment 2 (PB1) 3890.2 0.000000e+00 2218/2274 (97%)
EPI401811 A/green-winged teal/Xianghai/430/2011 (A/H5N2) segment 2 (PB1) 3884.6 0.000000e+00 2217/2274 (97%)
EPI387899 A/wild bird/Korea/A01/2009 (A/H10N6) segment 2 (PB1) 3884.6 0.000000e+00 2217/2274 (97%)
EPI299296 A/avian/Japan/8KI0129/2008 (A/H3N8) segment 2 (PB1) 3884.6 0.000000e+00 2217/2274 (97%)
EPI372487 A/garganey/Ukraine/05834-NAMRU3/2006 (A/H10N9) segment 2 (PB1) 3879.1 0.000000e+00 2216/2274 (97%)
EPI471138 A/duck/Vietnam/LBM83c-1/2012 (A/H3N6) segment 2 (PB1) 3873.5 0.000000e+00 2215/2274 (97%)
EPI469475 A/duck/Jiangxi/19521/2009 (A/H7N3) segment 2 (PB1) 3873.5 0.000000e+00 2215/2274 (97%)
EPI469460 A/duck/Jiangxi/3286/2009 (A/H7N9) segment 2 (PB1) 3873.5 0.000000e+00 2215/2274 (97%)
EPI469456 A/duck/Jiangxi/3169/2009 (A/H7N9) segment 2 (PB1) 3873.5 0.000000e+00 2215/2274 (97%)
EPI469417 A/duck/Jiangxi/3292/2009 (A/H7N9) segment 2 (PB1) 3873.5 0.000000e+00 2215/2274 (97%)
EPI469408 A/duck/Jiangxi/3257/2009 (A/H7N9) segment 2 (PB1) 3873.5 0.000000e+00 2215/2274 (97%)
EPI469392 A/duck/Jiangxi/3283/2009 (A/H7N9) segment 2 (PB1) 3873.5 0.000000e+00 2215/2274 (97%)
EPI401781 A/baikal teal/Xianghai/426/2011 (A/H5N2) segment 2 (PB1) 3873.5 0.000000e+00 2215/2274 (97%)
EPI387897 A/mallard/Korea/1041/2010 (A/H10N8) segment 2 (PB1) 3873.5 0.000000e+00 2215/2274 (97%)
EPI270060 A/aquatic bird/India/NIV-17095/2007 (A/H11N1) segment 2 (PB1) 3873.5 0.000000e+00 2215/2274 (97%)
EPI469459 A/duck/Jiangxi/3230/2009 (A/H7N9) segment 2 (PB1) 3868.0 0.000000e+00 2214/2274 (97%)
EPI469458 A/duck/Jiangxi/3214/2009 (A/H7N9) segment 2 (PB1) 3868.0 0.000000e+00 2214/2274 (97%)
EPI469457 A/duck/Jiangxi/3190/2009 (A/H7N9) segment 2 (PB1) 3868.0 0.000000e+00 2214/2274 (97%)
EPI469455 A/duck/Jiangxi/3141/2009 (A/H7N9) segment 2 (PB1) 3868.0 0.000000e+00 2214/2274 (97%)
EPI469454 A/duck/Jiangxi/3096/2009 (A/H7N9) segment 2 (PB1) 3868.0 0.000000e+00 2214/2274 (97%)
EPI469407 A/duck/Jiangxi/3152/2009 (A/H7N9) segment 2 (PB1) 3868.0 0.000000e+00 2214/2274 (97%)
EPI438440 A/duck/Vietnam/LBM81/2012 (A/H11N9) segment 2 (PB1) 3868.0 0.000000e+00 2214/2274 (97%)
EPI416359 A/wild duck/Korea/SNU50-5/2009 (A/H5N1) segment 2 (PB1) 3868.0 0.000000e+00 2214/2274 (97%)
EPI416358 A/wild duck/Korea/SNU50-5/2009 (A/H5N1) segment 2 (PB1) 3868.0 0.000000e+00 2214/2274 (97%)
EPI401293 A/wild duck/Korea/CSM4-28/2010 (A/H4N6) segment 2 (PB1) 3868.0 0.000000e+00 2214/2274 (97%)
EPI314537 A/avian/Japan/8KI0184/2008 (A/H4N6) segment 2 (PB1) 3868.0 0.000000e+00 2214/2274 (97%)
EPI299264 A/avian/Japan/8KI0185/2008 (A/H4N6) segment 2 (PB1) 3868.0 0.000000e+00 2214/2274 (97%)
EPI262637 A/aquatic bird/Korea/w351/2008 (A/H5N2) segment 2 (PB1) 3868.0 0.000000e+00 2214/2274 (97%)
EPI506482 A/duck/Thailand/CU-12326T/2012 (A/H11N2) segment 2 (PB1) 3866.2 0.000000e+00 2213/2273 (97%)
EPI469481 A/duck/Jiangxi/25134/2009 (A/H7N6) segment 2 (PB1) 3862.5 0.000000e+00 2213/2274 (97%)
EPI446498 A/wild goose/Dongting/PC0360/2012 (A/H7N7) segment 2 (PB1) 3862.5 0.000000e+00 2213/2274 (97%)
EPI372353 A/teal/Egypt/09888-NAMRU3/2005 (A/H4N6) segment 2 (PB1) 3862.5 0.000000e+00 2213/2274 (97%)
EPI356357 A/wild duck/Korea/CSM4-12/2009 (A/H5N1) segment 2 (PB1) 3862.5 0.000000e+00 2213/2274 (97%)
EPI272272 A/duck/Korea/A93/2008 (A/H5N2) segment 2 (PB1) 3862.5 0.000000e+00 2213/2274 (97%)
EPI219338 A/mallard/Hokkaido/24/2009 (A/H5N1) segment 2 (PB1) 3862.5 0.000000e+00 2213/2274 (97%)
EPI469482 A/duck/Jiangxi/25186/2009 (A/H7N6) segment 2 (PB1) 3856.9 0.000000e+00 2212/2274 (97%)
EPI469480 A/duck/Jiangxi/23008/2009 (A/H7N7) segment 2 (PB1) 3856.9 0.000000e+00 2212/2274 (97%)
EPI469477 A/wild duck/Jiangxi/19831/2009 (A/H7N7) segment 2 (PB1) 3856.9 0.000000e+00 2212/2274 (97%)
EPI469476 A/wild duck/Jiangxi/19615/2009 (A/H7N8) segment 2 (PB1) 3856.9 0.000000e+00 2212/2274 (97%)
EPI462879 A/environment/Guangdong/2/2009 (A/H2N3) segment 2 (PB1) 3856.9 0.000000e+00 2212/2274 (97%)
EPI441011 A/duck/Vietnam/LBM185/2012 (A/H6N6) segment 2 (PB1) 3856.9 0.000000e+00 2212/2274 (97%)
EPI417480 A/duck/Guangxi/GXd-2/2010 (A/H6N2) segment 2 (PB1) 3856.9 0.000000e+00 2212/2274 (97%)
EPI401788 A/spot-billed duck/Xianghai/427/2011 (A/H5N2) segment 2 (PB1) 3856.9 0.000000e+00 2212/2274 (97%)
EPI256744 A/muscovy duck/Thailand/CU-LM1973/2009 (A/H4N6) segment 2 (PB1) 3856.9 0.000000e+00 2212/2274 (97%)
EPI372456 A/shoveler/Egypt/01574-NAMRU3/2007 (A/H10N4) segment 2 (PB1) 3851.4 0.000000e+00 2211/2274 (97%)
EPI372273 A/teal/Egypt/20431-NAMRU3/2003 (A/H1N2) segment 2 (PB1) 3851.4 0.000000e+00 2211/2274 (97%)
EPI272274 A/wild bird/Korea/A81/2009 (A/H5N2) segment 2 (PB1) 3851.4 0.000000e+00 2207/2268 (97%)
EPI184014 A/mute swan/Hungary/5973/2007 (A/H7N7) segment 2 (PB1) 3851.4 0.000000e+00 2211/2274 (97%)
EPI292711 A/duck/Thailand/CU5408/2009 (A/H11N3) segment 2 (PB1) 3847.7 0.000000e+00 2209/2272 (97%)
EPI544793 A/duck/Shanghai/SH3/2013 (A/H3N2) segment 2 (PB1) 3845.8 0.000000e+00 2210/2274 (97%)
EPI513699 A/mallard/Sweden/80014/2008 (A/H4N6) segment 2 (PB1) 3845.8 0.000000e+00 2210/2274 (97%)
EPI513630 A/mallard/Sweden/80195/2008 (A/H4N6) segment 2 (PB1) 3845.8 0.000000e+00 2210/2274 (97%)
EPI442023 A/quail/Jiangsu/k0104/2010 (A/H5N5) segment 2 (PB1) 3845.8 0.000000e+00 2210/2274 (97%)
EPI441006 A/muscovy duck/Vietnam/LBM198/2012 (A/H6N2) segment 2 (PB1) 3845.8 0.000000e+00 2210/2274 (97%)
EPI418269 A/muscovy duck/Vietnam/LBM189/2012 (A/H3N2) segment 2 (PB1) 3845.8 0.000000e+00 2210/2274 (97%)
EPI285821 A/avian/Egypt/920431/2006 (A/H9N2) segment 2 (PB1) 3845.8 0.000000e+00 2210/2274 (97%)
EPI269009 A/duck/Hunan/491/2005 (A/H6N2) segment 2 (PB1) 3845.8 0.000000e+00 2210/2274 (97%)
EPI256760 A/muscovy duck/Thailand/CU-LM1984/2009 (A/H4N9) segment 2 (PB1) 3845.8 0.000000e+00 2204/2265 (97%)
EPI256752 A/muscovy duck/Thailand/CU-LM1983/2009 (A/H4N6) segment 2 (PB1) 3845.8 0.000000e+00 2204/2265 (97%)
EPI229995 A/mallard/France/061054/2006 (A/H5N3) segment 2 (PB1) 3845.8 0.000000e+00 2210/2274 (97%)
EPI169281 A/duck/France/061054/2006 (A/H5N3) segment 2 (PB1) 3845.8 0.000000e+00 2210/2274 (97%)
EPI326735 A/environment/Korea/PSC2-21/2009 (A/H3N8) segment 2 (PB1) 3844.0 0.000000e+00 2203/2264 (97%)
EPI387365 A/environment/Mongolia/1-51/2007 (A/H7N7) segment 2 (PB1) 3842.2 0.000000e+00 2208/2272 (97%)
EPI469478 A/duck/Jiangxi/21669/2009 (A/H7N7) segment 2 (PB1) 3840.3 0.000000e+00 2210/2275 (97%)
EPI469394 A/duck/Jiangxi/22537/2012 (A/H11N9) segment 2 (PB1) 3840.3 0.000000e+00 2209/2274 (97%)
EPI292703 A/duck/Thailand/CU5388/2009 (A/H11N3) segment 2 (PB1) 3836.6 0.000000e+00 2207/2272 (97%)
EPI469402 A/northern shoveler/Hong Kong/MPC657/2006 (A/H10N9) segment 2 (PB1) 3834.8 0.000000e+00 2209/2275 (97%)
EPI438279 A/duck/Vietnam/LBM300/2012 (A/H10N2) segment 2 (PB1) 3834.8 0.000000e+00 2208/2274 (97%)
EPI336024 A/duck/Zhejiang/0224-6/2011 (A/H1N2) segment 2 (PB1) 3834.8 0.000000e+00 2208/2274 (97%)
EPI515036 A/muscovy duck/Vietnam/LBM455/2013 (A/H6N2) segment 2 (PB1) 3829.2 0.000000e+00 2207/2274 (97%)

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Wed Feb 11, 2015 1:26 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
3 2233 bp mRNA linear 10-FEB-2015
DEFINITION Influenza A virus (AIGooselTaiwanl01042l2015(HSN3)) polymerase PA (PA) gene , complete eds .

ACCESSION VERSION KEYWORDS SOURCE

ORGANISM


REFERENCE AUTHOR S

TITLE JOURNAL
REFERENCE AUTHORS




Viruses ; ssRNA negative-strand v iruses; Orthomyxovir idae ; Influenzavirus A .
V iruses; ssRNA negative-strand viruses ; Orthomyxoviridae ; Influenzavirus A.
Unclassified.
1 (bases 1 to 2233)
Lee,M.S. , Chen,L .H. , Liu,Y.P. , Chen,Y .P. , Li,W .C. , Lee , F. ,
Ting,L.J . and Lin,Y .L .
Av ian influenza subtype HS in geese in Taiwan, 2015 Unpublished
2 (bases 1 to 2233 )
Lee,M .S. , Chen, L .H. , Liu,Y.P. , Chen,Y.P. , Li,W.C. , Lee, F. ,
Ting, L .J . and Lin,Y. L.

TITLE Direct Submission
JOURNAL Submitted (10-FEB-2015) Epidemiology Research Department, National Institute for Animal Health, Chung-Cheng Rd, Tansui, Taiwan 251 , Taiwan
COMMENT ##Assembly-Data-START##
Sequencing Technology : : Sanger dideoxy sequencing
##Assembly-Data - END##
FEATURES Location/Qualifie rs source 1 ..2233
/organism= "V iruses; ssRNA negative -strand viruses; Orthomyxoviridae ; Influenzavirus A. "
/mol type= "mRNA"
/strain= "A/Goose/Taiwan/01042/2015(H5N3) "
/host= "Goose "
/segment= " 3 "
/country="Taiwan"
/collection_ date= " 2015- 01-12 "
/identified by= "RT-PCR"
/subtype= "HSN3 "

gene CDS















gene CDS

1. . 2233
/gene= "PA " 25 . .2175
/gene= " PA "
/codon start=l
/product= "polymerase PA "
/translation= "MEDFVRQCFNPMIVELAEKTMKEYGENPKIETNKFAAICTHLEV CFMYSDFHFIDERGKSIIVESGDPNALLKHRFEIIEGRDRTMAWTVVNSICNTTGVDK PKFLPDLYDYKENRFIEIGVTRREVHTYYLEKANKIKSEKTHIHIFSFTGEEMATKAD YTLDEESRAR IKTRLFTIRQEMANRG LWDSFRQSERGEET IEERFEITGTMRRLADQS LPPNFSSLENFRAYVDGFKPNGCLEGKLSQMSKEVNARIEPFMKTTPRPLRLPDGPPC SQRSKFLLMDSLKLSIEDPSHEGEGIPLYDAIKCMKTFFGWKEPNIVKPHVKGINPNY LLAWKQVLAELQDIENEETIPKTKNMKKTSQLKWALGENMAPEKVDFEDCRDVIDLRQ YDSDEPEPRSLSSWIQSEFNKACELTDSSWIELDEIGEDVAPIEHIASMRRNYFTAEV SHCRATEYIMKGVYINTALLNSSCAAMDDFQLIPMISKCRTKEGRRKTNLYGFIIKGR SHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKYCVLEIGDMLLRTAIGQVSRSMFLYVR TNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAESSVKEKDMTKEFFENKSETWPIGES PKGVEESSIGKVCRTLLAKSVFNSLYASPQLEGFSAESRKLLLIVQAFRDNLEPGTFD LGGLYEAIEECLINDPWVLLNASWFNSFLTHALK"
25 ..784
/gene= "PA-X"
join (25. .594, 596 ..784)
/gene= "PA-X "
/codon_start=l
/product= "PA-X protein "
/translation= "MEDFVRQCFNPMIVELAEKTMKEYGENPKIETNKFAAICTHLEV CFMYSDFHFIDERGKSIIVESGDPNALLKHRFEIIEGRDRTMAWTVVNSICNTTGVDK PKFLPDLYDYKENRFIEIGVTRREVHTYYLEKANKIKSEKTHIHIFSFTGEEMATKAD YTLDEESRARIKTRLFTIRQEMANRGLWDSFVNLREAKRQLKKGLKSQEPCAGLPTKA SHRISPALKILEPMWMDSNRTAALRASFLKCQKK "

BASE COUNT 745 a 434 c 519 g 535 t ORIGIN
1 agcgaaagca ggtactgatc caaaatggaa gactttgtgc ggcaatgctt caatccaatg
61 atcgtcgagc ttgcggaaaa gacaatgaaa gaatatgggg aaaatccaaa aatcgaaacg
121 aacaaattcg ctgcaatatg cactcactta gaggtctgtt tcatgtattc ggatttccac
181 tttattgatg aacgaggcaa atcaataatt gtagaatctg gcgatccgaa tgcattattg
241 aaacaccgat ttgagataat tgaagggaga gaccgaacga tggcttggac agtggtaaat
301 agtatctgca acaccacagg agtcgataag cctaaattcc tcccagattt gtatgattac
361 aaggagaacc gattcattga aattggagtg acaaggaggg aagttcacac atactaccta
421 gaaaaggcaa ataagataaa atcagagaag acacacattc acatattctc attcactggg
481 gaggagatgg ccaccaaagc tgactatacc cttgatgaag agagcagagc aaggatcaaa
541 accaggttgt tcactatcag gcaagaaatg gccaataggg gtctgtggga ttcctttcgt 601 caatctgaga gaggcgaaga gacaattgaa gaaaggtttg aaatcacagg aaccatgcgc 661 aggcttgccg accaaagcct cccaccgaat ttctccagcc ttgaaaattt tagagcctat 721 gtggatggat tcaaaccgaa cggctgcctt gagggcaagc tttctcaaat gtcaaaagaa 781 gtgaacgcca gaattgagcc attcatgaag acaacaccac gccctctcag attacctgat 841 ggtcctcctt gctctcagcg gtcgaaattc ttactgatgg attcccttaa attgagcatc 901 gaagacccaa gccatgaggg agaaggtata ccgctatatg atgcaatcaa atgcatgaag 961 acgttttttg gttggaaaga acccaacatt gtaaaaccac atgtaaaagg cataaatccc 1021 aactatctct tggcttggaa gcaggtgctg gcagaactcc aagacattga gaatgaagag 1081 acaatcccaa aaacaaaaaa catgaagaaa acaagccaac taaagtgggc actcggtgag 1141 aatatggcac ctgaaaaagt ggactttgag gactgcagag atgttatcga tctaagacag 1201 tatgacagtg atgaaccaga gcccagatca ttatcaagct ggatccagag cgaattcaac 1261 aaagcatgcg aattgacaga ttcgagttgg attgaacttg atgaaatagg agaagatgtt 1321 gctccaattg agcacattgc gagtatgaga agaaactact tcacagcgga agtgtctcat 1381 tgcagggcaa ctgaatatat aatgaaagga gtttatataa atacagccct gttgaattca 1441 tcctgtgcag ccatggatga cttccaattg attccaatga taagcaagtg cagaaccaaa

1501 gaaggaagac ggaagacaaa tttatatggg ttcattataa aaggaagatc ccatttgagg 1561 aatgataccg atgtggtaaa ttttgtgagc atggagttct ccctcactga cccgaggctg 1621 gaaccacaca agtgggaaaa gtactgtgtt ctcgaaatag gagacatgct cctacgaact 1681 gcaataggcc aagtatcaag atccatgttt ctttatgtaa gaaccaatgg gacttccaag 1741 atcaagatga aatggggcat ggagatgagg cgatgccttc ttcaatccct ccaacaaatt 1801 gagagcatga ttgaggcaga gtcttctgtc aaagagaaag acatgaccaa ggaattcttt 1861 gaaaataaat cagaaacgtg gccaattggg gaatcaccta agggggtgga ggaaagctct 1921 attgggaagg tgtgtagaac attattagca aaatctgtat tcaacagcct atatgcatct 1981 ccacaacttg aggggttttc agctgagtcg agaaagttac ttctcattgt tcaggcattt 2041 agggacaacc tggaacctgg gaccttcgat cttggggggc tatatgaagc aattgaggag 2101 tgcctgatta atgatccctg ggttttgctt aatgcatctt ggttcaactc cttccttaca 2161 catgcactga aatagttgtg gcaatgctac tatttgctat ccatactgtc caaaaaagta 2221 ccttgtttct act

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Wed Feb 11, 2015 1:28 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
EPI553207 A/crane/Kagoshima/KU1/2014 (A/H5N8) segment 3 (PA) 3940.0 0.000000e+00 2145/2151 (99%)
EPI561712 A/bean goose/Korea/H40/2014 (A/H5N8) segment 3 (PA) 3895.7 0.000000e+00 2137/2151 (99%)
EPI561643 A/tundra swan/Korea/H411/2014 (A/H5N8) segment 3 (PA) 3895.7 0.000000e+00 2137/2151 (99%)
EPI561583 A/broiler duck/Korea/H133/2014 (A/H5N8) segment 3 (PA) 3895.7 0.000000e+00 2137/2151 (99%)
EPI561537 A/Baikal teal/Korea/H84/2014 (A/H5N8) segment 3 (PA) 3895.7 0.000000e+00 2137/2151 (99%)
EPI561534 A/Baikal teal/Korea/H68/2014 (A/H5N8) segment 3 (PA) 3895.7 0.000000e+00 2137/2151 (99%)
EPI561502 A/Baikal teal/Korea/H66/2014 (A/H5N8) segment 3 (PA) 3895.7 0.000000e+00 2137/2151 (99%)
EPI561500 A/Baikal teal/Korea/H62/2014 (A/H5N8) segment 3 (PA) 3895.7 0.000000e+00 2137/2151 (99%)
EPI561338 A/broiler duck/Korea/H49/2014 (A/H5N8) segment 3 (PA) 3895.7 0.000000e+00 2137/2151 (99%)
EPI561334 A/broiler duck/Korea/H47/2014 (A/H5N8) segment 3 (PA) 3895.7 0.000000e+00 2137/2151 (99%)
EPI509694 A/baikal teal/Korea/Donglim3/2014 (A/H5N8) segment 3 (PA) 3895.7 0.000000e+00 2137/2151 (99%)
EPI561687 A/spot-billed duck/Korea/H455-42/2014 (A/H5N8) segment 3 (PA) 3890.2 0.000000e+00 2136/2151 (99%)
EPI561686 A/common teal/Korea/H455-30/2014 (A/H5N8) segment 3 (PA) 3890.2 0.000000e+00 2136/2151 (99%)
EPI561642 A/bean goose/Korea/H328/2014 (A/H5N8) segment 3 (PA) 3890.2 0.000000e+00 2136/2151 (99%)
EPI561640 A/Korean native chicken/Korea/H257/2014 (A/H5N8) segment 3 (PA) 3890.2 0.000000e+00 2136/2151 (99%)
EPI561588 A/white-fronted goose/Korea/H231/2014 (A/H5N8) segment 3 (PA) 3890.2 0.000000e+00 2136/2151 (99%)
EPI561587 A/mallard/Korea/H207/2014 (A/H5N8) segment 3 (PA) 3890.2 0.000000e+00 2136/2151 (99%)
EPI561586 A/breeder duck/Korea/H200/2014 (A/H5N8) segment 3 (PA) 3890.2 0.000000e+00 2136/2151 (99%)
EPI561584 A/broiler duck/Korea/H145/2014 (A/H5N8) segment 3 (PA) 3890.2 0.000000e+00 2136/2151 (99%)
EPI561582 A/breeder duck/Korea/H128/2014 (A/H5N8) segment 3 (PA) 3890.2 0.000000e+00 2136/2151 (99%)
EPI561501 A/broiler duck/Korea/H65/2014 (A/H5N8) segment 3 (PA) 3890.2 0.000000e+00 2136/2151 (99%)
EPI561335 A/broiler duck/Korea/H48/2014 (A/H5N8) segment 3 (PA) 3890.2 0.000000e+00 2136/2151 (99%)
EPI561333 A/Baikal teal/Korea/H41/2014 (A/H5N8) segment 3 (PA) 3890.2 0.000000e+00 2136/2151 (99%)
EPI561193 A/broiler duck/Korea/H31/2014 (A/H5N8) segment 3 (PA) 3890.2 0.000000e+00 2136/2151 (99%)
EPI561192 A/broiler duck/Korea/H29/2014 (A/H5N8) segment 3 (PA) 3890.2 0.000000e+00 2136/2151 (99%)
EPI561641 A/mallard/Korea/H297/2014 (A/H5N8) segment 3 (PA) 3884.6 0.000000e+00 2135/2151 (99%)
EPI561639 A/breeder chicken/Korea/H250/2014 (A/H5N8) segment 3 (PA) 3884.6 0.000000e+00 2135/2151 (99%)
EPI561585 A/breeder duck/Korea/H158/2014 (A/H5N8) segment 3 (PA) 3884.6 0.000000e+00 2135/2151 (99%)
EPI561539 A/breeder chicken/Korea/H122/2014 (A/H5N8) segment 3 (PA) 3884.6 0.000000e+00 2135/2151 (99%)
EPI561538 A/Baikal teal/Korea/H96/2014 (A/H5N8) segment 3 (PA) 3884.6 0.000000e+00 2135/2151 (99%)
EPI561536 A/Coot/Korea/H81/2014 (A/H5N8) segment 3 (PA) 3884.6 0.000000e+00 2135/2151 (99%)
EPI561535 A/Baikal teal/Korea/H80/2014 (A/H5N8) segment 3 (PA) 3884.6 0.000000e+00 2135/2151 (99%)
EPI561499 A/bean goose/Korea/H53/2014 (A/H5N8) segment 3 (PA) 3884.6 0.000000e+00 2135/2151 (99%)
EPI561184 A/waterfowl/Korea/S005/2014 (A/H5N8) segment 3 (PA) 3884.6 0.000000e+00 2135/2151 (99%)
EPI509693 A/broiler duck/Korea/Buan2/2014 (A/H5N8) segment 3 (PA) 3884.6 0.000000e+00 2135/2151 (99%)
EPI561638 A/breeder duck/Korea/H249/2014 (A/H5N8) segment 3 (PA) 3879.1 0.000000e+00 2134/2151 (99%)
EPI542618 A/mallard/Korea/W452/2014 (A/H5N8) segment 3 (PA) 3879.1 0.000000e+00 2134/2151 (99%)
EPI542602 A/duck/Beijing/FS01/2013 (A/H5N8) segment 3 (PA) 3868.0 0.000000e+00 2130/2148 (99%)
EPI558010 A/duck/England/36038/14 (A/H5N8) segment 3 (PA) 3856.9 0.000000e+00 2130/2151 (99%)
EPI553342 A/chicken/Miyazaki/7/2014 (A/H5N8) segment 3 (PA) 3856.9 0.000000e+00 2130/2151 (99%)
EPI547672 A/duck/England/36254/14 (A/H5N8) segment 3 (PA) 3856.9 0.000000e+00 2130/2151 (99%)
EPI558003 A/duck/England/36226/14 (A/H5N8) segment 3 (PA) 3851.4 0.000000e+00 2129/2151 (98%)
EPI553184 A/turkey/Italy/14VIR7898-10/2014 (A/H5N8) segment 3 (PA) 3851.4 0.000000e+00 2129/2151 (98%)
EPI548492 A/duck/Chiba/26-372-61/2014 (A/H5N8) segment 3 (PA) 3851.4 0.000000e+00 2129/2151 (98%)
EPI548484 A/duck/Chiba/26-372-48/2014 (A/H5N8) segment 3 (PA) 3851.4 0.000000e+00 2129/2151 (98%)
EPI547681 A/Chicken/Netherlands/14015526/2014 (A/H5N8) segment 3 (PA) 3851.4 0.000000e+00 2129/2151 (98%)
EPI517160 A/Chicken/Kumamoto/1-7/2014 (A/H5N8) segment 3 (PA) 3851.4 0.000000e+00 2129/2151 (98%)
EPI543001 A/duck/Beijing/FS01/2014 (A/H5N8) segment 3 (PA) 3844.0 0.000000e+00 2125/2148 (98%)
EPI552745 A/turkey/Germany/R2474-L00899/2014 (A/H5N8) segment 3 (PA) 3840.3 0.000000e+00 2127/2151 (98%)
EPI548622 A/chicken/Netherlands/14015531/2014 (A/H5N8) segment 3 (PA) 3840.3 0.000000e+00 2127/2151 (98%)
EPI548429 A/turkey/Germany-MV/R2472/2014 (A/H5N8) segment 3 (PA) 3836.6 0.000000e+00 2126/2151 (98%)
EPI554601 A/turkey/Germany-NI/R3372/2014 (A/H5N8) segment 3 (PA) 3834.8 0.000000e+00 2126/2151 (98%)
EPI543009 A/duck/Beijing/CT01/2014 (A/H5N8) segment 3 (PA) 3834.8 0.000000e+00 2123/2148 (98%)
EPI555125 A/domestic duck/Germany-NI/R3468/2014 (A/H5N8) segment 3 (PA) 3829.2 0.000000e+00 2125/2151 (98%)
EPI553361 A/environment/Kagoshima/KU-ngr-H/2014 (A/H5N8) segment 3 (PA) 3829.2 0.000000e+00 2125/2151 (98%)
EPI552759 A/eurasian wigeon/Netherlands/emc-1/2014 (A/H5N8) segment 3 (PA) 3790.4 0.000000e+00 2099/2122 (98%)
EPI552775 A/chicken/Netherlands/emc-3/2014 (A/H5N8) segment 3 (PA) 3762.7 0.000000e+00 2091/2118 (98%)
EPI431447 A/duck/Hebei/2/2011 (A/H5N2) segment 3 (PA) 3762.7 0.000000e+00 2113/2151 (98%)
EPI552767 A/eurasian wigeon/Netherlands/emc-2/2014 (A/H5N8) segment 3 (PA) 3755.4 0.000000e+00 2085/2111 (98%)
EPI414237 A/duck/Jiangsu/1-15/2011 (A/H4N2) segment 3 (PA) 3712.9 0.000000e+00 2104/2151 (97%)
EPI398961 A/duck/Eastern China/1111/2011 (A/H5N2) segment 3 (PA) 3696.3 0.000000e+00 2102/2152 (97%)
EPI398962 A/goose/Eastern China/1112/2011 (A/H5N2) segment 3 (PA) 3624.2 0.000000e+00 2088/2151 (97%)
EPI328887 A/duck/Eastern China/108/2008 (A/H5N1) segment 3 (PA) 3624.2 0.000000e+00 2088/2151 (97%)
EPI328879 A/duck/Eastern China/031/2009 (A/H5N5) segment 3 (PA) 3602.1 0.000000e+00 2084/2151 (96%)
EPI493832 A/duck/Guangdong/wy24/2008 (A/H5N5) segment 3 (PA) 3585.5 0.000000e+00 2081/2151 (96%)
EPI442024 A/quail/Jiangsu/k0104/2010 (A/H5N5) segment 3 (PA) 3579.9 0.000000e+00 2081/2152 (96%)
EPI431455 A/duck/Hebei/3/2011 (A/H5N2) segment 3 (PA) 3568.8 0.000000e+00 2078/2151 (96%)
EPI493816 A/duck/Guangdong/wy11/2008 (A/H5N5) segment 3 (PA) 3557.8 0.000000e+00 2076/2151 (96%)
EPI493824 A/duck/Guangdong/wy19/2008 (A/H5N5) segment 3 (PA) 3546.7 0.000000e+00 2074/2151 (96%)
EPI442008 A/goose/Guangdong/k0103/2010 (A/H5N5) segment 3 (PA) 3535.6 0.000000e+00 2072/2151 (96%)
EPI399959 A/duck/Jiangsu/m234/2012 (A/H5N2) segment 3 (PA) 3507.9 0.000000e+00 2068/2152 (96%)
EPI442000 A/goose/Shandong/k1204/2009 (A/H5N5) segment 3 (PA) 3502.4 0.000000e+00 2066/2151 (96%)
EPI544891 A/duck/Shandong/Q1/2013 (A/H5N8) segment 3 (PA) 3496.8 0.000000e+00 2066/2152 (96%)
EPI442016 A/duck/Jiangsu/k1203/2010 (A/H5N8) segment 3 (PA) 3496.8 0.000000e+00 2045/2121 (96%)
EPI475578 A/wild duck/Shandong/628/2011 (A/H5N1) segment 3 (PA) 3480.2 0.000000e+00 2064/2153 (95%)
EPI127382 A/wild duck/Hunan/021/2005 (A/H5N1) segment 3 (PA) 3469.1 0.000000e+00 2060/2151 (95%)
EPI113022 A/crested myna/Hong Kong/540/2006 (A/H5N1) segment 3 (PA) 3452.5 0.000000e+00 2057/2151 (95%)
EPI530983 A/duck/Zhejiang/W24/2013 (A/H5N8) segment 3 (PA) 3447.0 0.000000e+00 2058/2153 (95%)
EPI227308 A/Mallard/Huadong/lk/2005 (A/H5N1) segment 3 (PA) 3441.4 0.000000e+00 2055/2151 (95%)
EPI399885 A/duck/HuBei/03/2010 (A/H5N5) segment 3 (PA) 3435.9 0.000000e+00 2055/2152 (95%)
EPI509692 A/breeder duck/Korea/Gochang1/2014 (A/H5N8) segment 3 (PA) 3430.3 0.000000e+00 2055/2153 (95%)
EPI507672 A/mallard duck/Shanghai/SH-9/2013 (A/H5N8) segment 3 (PA) 3430.3 0.000000e+00 2055/2153 (95%)
EPI337063 A/Anhui/2/2005 (A/H5N1) segment 3 (PA) 3430.3 0.000000e+00 2054/2152 (95%)
EPI337058 A/Anhui/1/2005 (A/H5N1) segment 3 (PA) 3430.3 0.000000e+00 2054/2152 (95%)
EPI275385 A/Anhui/2/2005 (A/H5N1) segment 3 (PA) 3430.3 0.000000e+00 2054/2152 (95%)
EPI225093 A/duck/Nam Dinh/218/2006 (A/H5) segment 3 (PA) 3430.3 0.000000e+00 2053/2151 (95%)
EPI170655 A/duck/Vietnam/210/2005 (A/H5N1) segment 3 (PA) 3430.3 0.000000e+00 2053/2151 (95%)
EPI170648 A/Muscovy duck/Vietnam/211/2005 (A/H5N1) segment 3 (PA) 3430.3 0.000000e+00 2053/2151 (95%)
EPI170634 A/Muscovy duck/Vietnam/213/2005 (A/H5N1) segment 3 (PA) 3430.3 0.000000e+00 2053/2151 (95%)
EPI170620 A/chicken/Vietnam/216/2005 (A/H5N1) segment 3 (PA) 3430.3 0.000000e+00 2053/2151 (95%)
EPI170612 A/Muscovy duck/Vietnam/217/2005 (A/H5N1) segment 3 (PA) 3430.3 0.000000e+00 2053/2151 (95%)
EPI170604 A/duck/Vietnam/218/2005 (A/H5N1) segment 3 (PA) 3430.3 0.000000e+00 2053/2151 (95%)
EPI170596 A/duck/Vietnam/219/2005 (A/H5N1) segment 3 (PA) 3430.3 0.000000e+00 2053/2151 (95%)
EPI164247 A/Anhui/2/2005 (A/H5N1) segment 3 (PA) 3430.3 0.000000e+00 2054/2152 (95%)
EPI164220 A/Anhui/1/2005 (A/H5N1) segment 3 (PA) 3430.3 0.000000e+00 2054/2152 (95%)
EPI139938 A/Duck/Fujian/1734/05 (A/H5N1) segment 3 (PA) 3430.3 0.000000e+00 2053/2151 (95%)
EPI113100 A/duck/Guiyang/497/2006 (A/H5N1) segment 3 (PA) 3430.3 0.000000e+00 2054/2152 (95%)
EPI113068 A/duck/Guangxi/5165/2005 (A/H5N1) segment 3 (PA) 3430.3 0.000000e+00 2053/2151 (95%)
EPI113064 A/chicken/Guangxi/4989/2005 (A/H5N1) segment 3 (PA) 3430.3 0.000000e+00 2053/2151 (95%)
EPI113060 A/goose/Guangxi/4513/2005 (A/H5N1) segment 3 (PA) 3430.3 0.000000e+00 2053/2151 (95%)

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Wed Feb 11, 2015 1:31 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
5 1565 bp mRNA linear 10-FEB- 2015
DEFINITION Influenza A virus (A/Goose/Taiwan/01042/2015(HSN3)) nucleocapsid protein (NP) gene, complete eds.

ACCESSION VERSION KEYWORDS SOURCE

ORGANISM


REFERENCE AUTHORS

TITLE JOURNAL
REFERENCE AUTHORS

TITLE JOURNAL
COMMENT FEATURES
source










gene CDS











BASE COUNT ORIGIN




Viruses; ssRNA negative-strand viruses ; Orthomyxoviridae ; Influenzavirus A.
Viruses ; ssRNA negative-strand viruses ; Orthomyxoviridae ; Influenzavirus A.
Unclassified .
1 (bases 1 to 1565)
Lee ,M .S. , Chen , L .H. , Liu ,Y. P. , Chen , Y. P. , Li , W.C. , Lee , F. ,
Ting , L.J. and Lin,Y.L.
Avian influenza subtype HS in geese in Taiwan , 2015 Unpublished
2 (bases 1 to 1565)
Lee,M. S. , Chen,L.H. , Liu , Y.P. , Chen,Y. P. , Li,W. C. , Lee, F. ,
Ting , L.J. and Lin , Y.L . Direct Submission
Submitted (10-FEB-2015 ) Epidemiology Research Department, National Institute for Animal Health, Chung-Cheng Rd, Tansui, Taiwan 251, Taiwan
##Assembly-Data-START##
Sequencing Technology :: Sanger dideoxy sequencing
##Assembly-Data -END##
Location/Qualifiers
1. .1565
/organism = "Viruses; ssRNA negative-strand viruses ; Orthomyxoviridae ; Influenzavirus A. "
/mol type= "mRNA "
/strain= "A/Goose/Taiwan/01042/2015(HSN3) "
/host= "Goose"
/segment="S"
/country="Taiwan"
/collection date= " 2015-01-12"
/identified=by= "RT- PCR "
/subtype= "H5N3 "
1. .1565
/gene="NP " 46 . .1542
/gene= "NP"
/codon_start=l
/product="nucleocapsid protein "
/translation="MASQGTKRSYEQMETGGERQNATEIRASVGRMVGGIGRFYIQMC TELKLSDYEGRLIQNSITIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRRDG KWMRELILYDKEEIRRIWRQANNGEDATAGLTHLMIWHSNLNDATYQRTRALVRTGMD PRMCSLMQGSTLPRRSGAAGAAVKGVGTMVMELIRMIKRGINDRNFWRGENGRRTRIA YERMCNILKGKFQTAAQRAMMDQVRESRNPGNAEIEDLIFLARSALILRGSVAHKSCL PACVYGLAVASGYDFEREGYSLVGIDPFRLLQNSQVFSLIRPNENPAHKSQLVWMACH SAAFEDLRVSSFIRG TRVVPRGQLSTRGVQIASNENMETMDSSTLELRSRYWAIRTRS GGNTNQQRASAGQISVQPTF SVQRSLPFERATIMAAFTGNTEGRTSDMRTEIIRMMES ARPEDVSFQGRGVFE LSDEKATNPIVPSFDMSNEGSYFFGDNAEEY DN"
498 a 314 c 420 g 333 t

1 agcaaaagca gggtagataa tcactcactg agtgacatca acatcatggc gtctcaaggc
61 accaaacgat cttatgaaca gatggaaact ggtggagaac gccagaatgc cactgaaatc

121
181
241
301
361

agagcatctg ttggaaggat ggttggtgga attgggaggt tttacataca gatgtgcact gaactcaaac tcagcgacta tgaagggagg ctgatccaga acagcataac aatagagaga atggttcttt ctgcatttga tgaaaggagg aacaaatacc tggaagagca tcccagtgct ggaaaggatc cgaagaaaac tggaggtcca atttatcgaa gaagggacgg gaaatggatg agagagctga ttctgtatga caaagaggag atcaggagaa tctggcgtca agcgaataat

421 ggagaagacg caactgctgg tctcactcac ctgatgatct ggcattccaa cctaaatgat
481 gccacatacc agagaaccag agctcttgtg cgcactggga tggaccccag aatgtgctct
541 ctgatgcaag ggtcaactct cccgaggaga tctggagctg ctggagcagc agtaaaggga 601 gtcgggacga tggtgatgga actaattcga atgataaaac gaggaattaa tgatcggaat 661 ttctggagag gcgaaaatgg acgaagaaca aggattgcat atgagaggat gtgcaacatc 721 ctcaaaggga aattccaaac agcagcacaa agagcaatga tggatcaagt gcgagaaagc 781 agaaatcctg ggaatgctga aattgaagat ctcatcttcc tggcacggtc tgcgctcatc 841 ctgagaggat cagtggccca taagtcctgc cttcctgctt gtgtgtacgg ccttgctgtg 901 gccagtgggt atgattttga gagagaaggg tactctctag ttggaataga tcctttccgt 961 ctgcttcaaa acagccaggt cttcagtctc attagaccaa atgagaaccc agcacacaag 1021 agtcaattgg tgtggatggc atgccattct gcagcatttg aggacctgag agtctcaagt 1081 ttcatcagag ggacaagagt ggtccc:::aaga gggcaactat ccactagagg agttcaaatt 1141 gcttcaaatg agaacatgga aacaatggac tccagcactc ttgaactaag gagcagatat 1201 tgggctataa ggaccaggag tggaggaaac accaaccaac agagagcatc tgcaggacag 1261 atcagtgtac agcc acttt ctcagtacag agaagtcttc ccttcgaaag ggcaaccatt 1321 atggcggcat tcacaggaaa tactgaaggc agaacatctg acatgaggac tgaaatcata 1381 agaatgatgg aaagtgccag accagaagat gtgtccttcc aggggcgggg agtcttcgag 1441 ctctcggacg aaaaggcaac gaacccgatc gtgccttcct ttgacatgag taatgaagga 1501 tcttatttct tcggagacaa tgcagaggag tatgacaatt aaagaaaaat acccttgttt
1561 ctact

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Wed Feb 11, 2015 1:32 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
EPI438282 A/duck/Vietnam/LBM300/2012 (A/H10N2) segment 5 (NP) 2619.7 0.000000e+00 1471/1497 (98%)
EPI493029 A/wild waterfowl/Dongting/C2383/2012 (A/H1N2) segment 5 (NP) 2608.6 0.000000e+00 1469/1497 (98%)
EPI470398 A/wild waterfowl/Hong Kong/MPP1311/2013 (A/H2N9) segment 5 (NP) 2603.0 0.000000e+00 1468/1497 (98%)
EPI446508 A/wild goose/Dongting/C1037/2011 (A/H12N8) segment 5 (NP) 2599.4 0.000000e+00 1467/1497 (97%)
EPI407865 A/Khaki Campbell duck/Karachi/NARC-23963/2010 (A/H4N6) segment 5 (NP) 2588.3 0.000000e+00 1465/1497 (97%)
EPI461630 A/duck/Hunan/S1256/2012 (A/H3N8) segment 5 (NP) 2586.4 0.000000e+00 1465/1497 (97%)
EPI510819 A/duck/Taiwan/11213/2013 (A/H5N2) segment 5 (NP) 2569.8 0.000000e+00 1462/1497 (97%)
EPI470377 A/wild duck/Jiangxi/19831/2009 (A/H7N7) segment 5 (NP) 2564.3 0.000000e+00 1461/1497 (97%)
EPI510826 A/duck/Taiwan/11254/2013 (A/H5N2) segment 5 (NP) 2558.7 0.000000e+00 1460/1497 (97%)
EPI392508 A/pintail/Korea/1173/09 (A/H7N7) segment 5 (NP) 2558.7 0.000000e+00 1460/1497 (97%)
EPI470441 A/wild waterfowl/Hong Kong/MPM2121/2011 (A/H7N7) segment 5 (NP) 2553.2 0.000000e+00 1459/1497 (97%)
EPI470440 A/wild waterfowl/Hong Kong/MPL705/2011 (A/H7N7) segment 5 (NP) 2553.2 0.000000e+00 1459/1497 (97%)
EPI470438 A/common teal/Hong Kong/MPL634/2011 (A/H7N7) segment 5 (NP) 2553.2 0.000000e+00 1459/1497 (97%)
EPI470436 A/common teal/Hong Kong/MPM1645/2011 (A/H7N1) segment 5 (NP) 2553.2 0.000000e+00 1459/1497 (97%)
EPI470411 A/northern shoveler/Hong Kong/MPK276/2009 (A/H11N9) segment 5 (NP) 2553.2 0.000000e+00 1459/1497 (97%)
EPI470439 A/common teal/Hong Kong/MPM1740/2011 (A/H7N7) segment 5 (NP) 2547.7 0.000000e+00 1458/1497 (97%)
EPI470437 A/common teal/Hong Kong/MPM1670/2011 (A/H7N7) segment 5 (NP) 2547.7 0.000000e+00 1458/1497 (97%)
EPI470415 A/duck/Yunnan/87/2007 (A/H7N6) segment 5 (NP) 2547.7 0.000000e+00 1458/1497 (97%)
EPI470443 A/wild waterfowl/Hong Kong/MPM3375/2011 (A/H7N6) segment 5 (NP) 2542.1 0.000000e+00 1457/1497 (97%)
EPI470442 A/wild waterfowl/Hong Kong/MPL1006/2011 (A/H7N7) segment 5 (NP) 2542.1 0.000000e+00 1457/1497 (97%)
EPI470431 A/wild waterfowl/Hong Kong/MPL696/2011 (A/H2N9) segment 5 (NP) 2542.1 0.000000e+00 1457/1497 (97%)
EPI470378 A/duck/Jiangxi/21669/2009 (A/H7N7) segment 5 (NP) 2542.1 0.000000e+00 1457/1497 (97%)
EPI387852 A/wild bird/Korea/A02/2011 (A/H10N4) segment 5 (NP) 2542.1 0.000000e+00 1458/1498 (97%)
EPI470380 A/duck/Jiangxi/23008/2009 (A/H7N7) segment 5 (NP) 2536.6 0.000000e+00 1456/1497 (97%)
EPI387853 A/wild bird/Korea/A01/2011 (A/H10N4) segment 5 (NP) 2536.6 0.000000e+00 1457/1498 (97%)
EPI363536 A/duck/Guizhou/2773/2006 (A/H6N2) segment 5 (NP) 2536.6 0.000000e+00 1456/1497 (97%)
EPI315101 A/mallard/PT/27972-B139/2007 (A/H9N2) segment 5 (NP) 2536.6 0.000000e+00 1456/1497 (97%)
EPI268706 A/mallard/Jiangxi/7376/2003 (A/H6N2) segment 5 (NP) 2520.0 0.000000e+00 1453/1497 (97%)
EPI506050 A/duck/Moscow/4182/2010 (A/H5N3) segment 5 (NP) 2514.4 0.000000e+00 1452/1497 (96%)
EPI441047 A/duck/Vietnam/LBM185/2012 (A/H6N6) segment 5 (NP) 2514.4 0.000000e+00 1452/1497 (96%)
EPI372497 A/mallard/Ukraine/05842-NAMRU3/2006 (A/H3N8) segment 5 (NP) 2514.4 0.000000e+00 1452/1497 (96%)
EPI270063 A/aquatic bird/India/NIV-17095/2007 (A/H11N1) segment 5 (NP) 2514.4 0.000000e+00 1452/1497 (96%)
EPI222088 A/garganey/Altai/1213/2007 (A/H5N2) segment 5 (NP) 2514.4 0.000000e+00 1452/1497 (96%)
EPI222048 A/gadwall/Altai/1202/2007 (A/H5N2) segment 5 (NP) 2514.4 0.000000e+00 1452/1497 (96%)
EPI140252 A/migratory duck/Jiang Xi/6568/2004 (A/H4N6) segment 5 (NP) 2514.4 0.000000e+00 1453/1498 (96%)
EPI316865 A/mallard/Czech Republic/14924-1/2007 (A/H6N5) segment 5 (NP) 2510.7 0.000000e+00 1451/1497 (96%)
EPI251701 A/mallard/Sweden/4/2002 (A/H10N2) segment 5 (NP) 2510.7 0.000000e+00 1451/1497 (96%)
EPI515143 A/duck/Vietnam/LBM533/2013 (A/H3N6) segment 5 (NP) 2508.9 0.000000e+00 1452/1498 (96%)
EPI451162 A/mallard/Netherlands/10-Cam/1999 (A/H1N1) segment 5 (NP) 2508.9 0.000000e+00 1451/1497 (96%)
EPI451128 A/mallard/Netherlands/10-Nmkt/1999 (A/H0) segment 5 (NP) 2508.9 0.000000e+00 1451/1497 (96%)
EPI372403 A/shoveler/Egypt/00215-NAMRU3/2007 (A/H7N9) segment 5 (NP) 2508.9 0.000000e+00 1451/1497 (96%)
EPI342610 A/swan/Czech Republic/5416/2011 (A/H7N7) segment 5 (NP) 2508.9 0.000000e+00 1451/1497 (96%)
EPI251641 A/mallard/Netherlands/10/1999 (A/H1N8) segment 5 (NP) 2508.9 0.000000e+00 1451/1497 (96%)
EPI1744 A/duck/Hokkaido/9/99 (A/H9N2) segment 5 (NP) 2508.9 0.000000e+00 1452/1498 (96%)
EPI316769 A/mallard/Czech Republic/13579-84K/2010 (A/H4N6) segment 5 (NP) 2505.2 0.000000e+00 1450/1497 (96%)
EPI314542 A/avian/Japan/8KI0148/2008 (A/H4N2) segment 5 (NP) 2503.3 0.000000e+00 1451/1498 (96%)
EPI284622 A/duck/Hunan/8-19/2009 (A/H4N2) segment 5 (NP) 2503.3 0.000000e+00 1451/1498 (96%)
EPI168528 A/mute swan/Aktau/1460/2006 (A/H5N1) segment 5 (NP) 2503.3 0.000000e+00 1426/1461 (97%)
EPI127027 A/aquatic bird/Korea/JN-1/2005 (A/H3N8) segment 5 (NP) 2492.3 0.000000e+00 1444/1491 (96%)
EPI463223 A/mallard/Sweden/100546/2009 (A/H8N4) segment 5 (NP) 2490.4 0.000000e+00 1433/1475 (97%)
EPI387854 A/mallard/Korea/1203/2010 (A/H10N8) segment 5 (NP) 2488.6 0.000000e+00 1422/1459 (97%)
EPI401315 A/wild bird/Korea/GD42/2005 (A/H4N6) segment 5 (NP) 2486.7 0.000000e+00 1448/1498 (96%)
EPI326909 A/environment/Korea/KCA16/2004 (A/H3N8) segment 5 (NP) 2486.7 0.000000e+00 1441/1488 (96%)
EPI463263 A/mallard/Sweden/107892/2009 (A/H2N3) segment 5 (NP) 2484.9 0.000000e+00 1432/1475 (97%)
EPI508109 A/bean goose/Korea/SH20-17/2008 (A/H7N3) segment 5 (NP) 2475.6 0.000000e+00 1442/1492 (96%)
EPI314248 A/wild duck/Taiwan/WB499/2004 (A/H4N6) segment 5 (NP) 2471.9 0.000000e+00 1427/1471 (97%)
EPI514048 A/mallard/Sweden/68504/2007 (A/H4N2) segment 5 (NP) 2470.1 0.000000e+00 1446/1499 (96%)
EPI526100 A/common teal/Mongolia/2273/2011 (A/H6N6) segment 5 (NP) 2466.4 0.000000e+00 1386/1411 (98%)
EPI526129 A/common shelduck/Mongolia/2076/2011 (A/H3N8) segment 5 (NP) 2464.6 0.000000e+00 1389/1416 (98%)
EPI118126 A/Chicken/Italy/9097/97 (A/H5N9) segment 5 (NP) 2464.6 0.000000e+00 1444/1498 (96%)
EPI63189 A/chicken/Italy/22A/1998 (A/H5N9) segment 5 (NP) 2464.6 0.000000e+00 1444/1498 (96%)
EPI251859 A/whitefronted goose/Netherlands/2/1999 (A/H6N2) segment 5 (NP) 2459.0 0.000000e+00 1444/1499 (96%)
EPI251714 A/mallard/Sweden/45/2002 (A/H11N8) segment 5 (NP) 2459.0 0.000000e+00 1443/1498 (96%)
EPI251618 A/greylag goose/Netherlands/4/1999 (A/H6N1) segment 5 (NP) 2459.0 0.000000e+00 1444/1499 (96%)
EPI514915 A/mallard/Sweden/274/2002 (A/H4N2) segment 5 (NP) 2453.5 0.000000e+00 1442/1498 (96%)
EPI7436 A/Duck/Hong Kong/T37/97 (A/H11N8) segment 5 (NP) 2453.5 0.000000e+00 1442/1498 (96%)
EPI533780 A/Caspian seal/Russia/T1/2012 (A/H4N6) segment 5 (NP) 2447.9 0.000000e+00 1441/1498 (96%)
EPI533774 A/Caspian seal/Russia/1884/2002 (A/H4N6) segment 5 (NP) 2447.9 0.000000e+00 1441/1498 (96%)
EPI513928 A/mallard/Sweden/69580/2007 (A/H0) segment 5 (NP) 2447.9 0.000000e+00 1442/1499 (96%)
EPI485637 A/mallard/Sweden/91/2002 (A/H7N9) segment 5 (NP) 2447.9 0.000000e+00 1441/1498 (96%)
EPI296508 A/mallard/Sweden/74/2003 (A/H5N2) segment 5 (NP) 2447.9 0.000000e+00 1442/1499 (96%)
EPI251750 A/mallard/Sweden/55/2002 (A/H11N2) segment 5 (NP) 2447.9 0.000000e+00 1441/1498 (96%)
EPI251689 A/mallard/Sweden/25/2002 (A/H11N3) segment 5 (NP) 2447.9 0.000000e+00 1441/1498 (96%)
EPI251648 A/mallard/Netherlands/12/2001 (A/H4N2) segment 5 (NP) 2447.9 0.000000e+00 1442/1499 (96%)
EPI174828 A/duck/Denmark/74-68425/2002 (A/H1N3) segment 5 (NP) 2447.9 0.000000e+00 1441/1498 (96%)
EPI7440 A/Duck/Hong Kong/P185/97 (A/H3N8) segment 5 (NP) 2447.9 0.000000e+00 1441/1498 (96%)
EPI7438 A/Aquatic Bird/Hong Kong/m603/98 (A/H11N1) segment 5 (NP) 2447.9 0.000000e+00 1441/1498 (96%)
EPI7434 A/Duck/Hong Kong/T25/97 (A/H11N8) segment 5 (NP) 2447.9 0.000000e+00 1441/1498 (96%)
EPI256872 A/mallard/Poland/446/09 (A/H7N7) segment 5 (NP) 2446.1 0.000000e+00 1413/1457 (96%)
EPI545218 A/Seal/Sweden/SVA0546/2014 (A/H10N7) segment 5 (NP) 2442.4 0.000000e+00 1440/1498 (96%)
EPI544352 A/harbour seal/Germany/1/2014 (A/H10N7) segment 5 (NP) 2442.4 0.000000e+00 1440/1498 (96%)
EPI514801 A/mallard/Sweden/3272/2003 (A/H4N6) segment 5 (NP) 2442.4 0.000000e+00 1440/1498 (96%)
EPI514024 A/mallard/Sweden/68571/2007 (A/H4N6) segment 5 (NP) 2442.4 0.000000e+00 1441/1499 (96%)
EPI514001 A/mallard/Sweden/68940/2007 (A/H4N2) segment 5 (NP) 2442.4 0.000000e+00 1441/1499 (96%)
EPI513966 A/mallard/Sweden/68677/2007 (A/H0) segment 5 (NP) 2442.4 0.000000e+00 1441/1499 (96%)
EPI377792 A/mallard/Sweden/57/2002 (A/H2N3) segment 5 (NP) 2442.4 0.000000e+00 1440/1498 (96%)
EPI377603 A/mallard/Sweden/68597/2007 (A/H2N2) segment 5 (NP) 2442.4 0.000000e+00 1441/1499 (96%)
EPI377595 A/mallard/Sweden/68735/2007 (A/H2N2) segment 5 (NP) 2442.4 0.000000e+00 1441/1499 (96%)
EPI251626 A/mallard/Netherlands/1/1999 (A/H4N6) segment 5 (NP) 2442.4 0.000000e+00 1440/1498 (96%)
EPI174841 A/duck/Denmark/75-65472-P31/2003 (A/H3N2) segment 5 (NP) 2442.4 0.000000e+00 1440/1498 (96%)
EPI89042 A/Pigeon/Nanchang/8-142/2000 (A/H3N6) segment 5 (NP) 2442.4 0.000000e+00 1440/1498 (96%)
EPI313964 A/duck/Taiwan/445/2006 (A/H4N8) segment 5 (NP) 2438.7 0.000000e+00 1421/1471 (96%)
EPI514010 A/mallard/Sweden/68551/2007 (A/H4N2) segment 5 (NP) 2436.9 0.000000e+00 1440/1499 (96%)
EPI513973 A/mallard/Sweden/68761/2007 (A/H4N6) segment 5 (NP) 2436.9 0.000000e+00 1440/1499 (96%)
EPI485576 A/mallard/Sweden/9/2003 (A/H2N5) segment 5 (NP) 2436.9 0.000000e+00 1439/1498 (96%)
EPI377844 A/mallard/Sweden/9/2003 (A/H2N7) segment 5 (NP) 2436.9 0.000000e+00 1439/1498 (96%)
EPI102231 A/duck/Taiwan/WB29/99 (A/H6N1) segment 5 (NP) 2436.9 0.000000e+00 1440/1499 (96%)
EPI513987 A/mallard/Sweden/68893/2007 (A/H4N6) segment 5 (NP) 2431.3 0.000000e+00 1439/1499 (95%)
EPI513980 A/mallard/Sweden/68836/2007 (A/H4N6) segment 5 (NP) 2431.3 0.000000e+00 1439/1499 (95%)
EPI470944 A/duck/Hong Kong/Y439/1997 (A/H9N2) segment 5 (NP) 2431.3 0.000000e+00 1438/1498 (95%)

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Wed Feb 11, 2015 1:34 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
8 890 bp mRNA linear 10-FEB-2015

DEFINITION

ACCESSION VERSION KEYWORDS SOURCE

Influenza A virus (A/Goose/Taiwan/01042/201S(HSN3)) nuclear export protein (NEP) and nonstructural protein 1 (NSl) gene, complete eds.



Viruses ; ssRNA negative-strand viruses ; Orthomyxoviridae ; Influenzavirus A.

ORGANISM Viruses ; ssRNA negative-strand viruses ; Orthomyxoviridae ; Influenzavirus A.
Unclassified.
REFERENCE 1 (bases 1 to 890)

AUTHORS

TITLE JOURNAL
REFERENCE AUTHORS

TITLE JOURNAL
COMMENT FEATURES
source










gene CDS





gene

Lee ,M .S. , Chen , L.H. , Liu,Y.P . , Chen,Y. P. , Li,W.C . , Lee , F . ,
Ting,L.J. and Lin,Y.L.
Avian influenza subtype HS in geese in Taiwan, 2015 Unpublished
2 (bases 1 to 890)
Lee,M. S. , Chen , L.H. , Liu,Y .P ., Chen, Y.P. , Li , W. C . , Lee ,F. ,
Ting,L.J. and Lin,Y.L. Direct Submission
Submitted (10-FEB- 2015) Epidemiology Research Department, National Institute for Animal Heal th, Chung-Cheng Rd , Tansui, Taiwan 251, Taiwan
##Assembly-Data-START##
Sequencing Technology : : Sanger dideoxy sequencing
##Assembly-Data- END##
Location/Qualifier s
1. . 890
/organism= "Viruses ; ssRNA negative-strand viruses; Orthomyxoviridae ; Influenzavirus A. "
/mol type= "mRNA"
I str-;:;-in= "A/Goose/Taiwan/ 01042/2015 (HSN3)"
/host= "Goose"
/segment="8 "
/country= "Taiwan"
/collection date= " 2015- 01-12 "
/identified::)y= "RT-PCR"
/subtype = "HSN3 " 27 ..864
/gene= "NEP"
join(27 . .56,529 . .864)
/gene= "NEP "
/codon_start=l
/product="nuclear export protein"
/translation= "MDSNTVSSFQDILMRMSKLQLGSSSEGLNGMITQFESLKLYRDS LGEAVMRMGDLHSLQNRNGKWREQLSQKFEEIRWLIEEMRHRLKTTENSFEQITFMQA LQLLLEVEQEIRTFSFQLI"
27 . .740


CDS









BASE COUNT ORIGIN

/gene= "NSl" 27 . .740
/gene= "NSl"
/codon start= l
/product= "nonstructural protein l"
/translation= "MDSNTVSSFQVDCFLWHVRKRFADQELGDAPFLDRLRRDQKSLR GRGSTLGLDIETATRAGKQIVERILGEKSDEALKMNIASVPTSRYLTDMTLEEMSRDW FMLMPKQKVAGSLCIKMDQAIMDKTIILKANFSVIFDRLETLILLRAFTEEGAIVGEI SPLPSLPGHTDEDVKIAIGVLIGGLEWNDNTVRVSETLQRFTWRSSNEDGRPSLPSKQ KRKMARTIESEVRGNKMAD"
291 a 180 c 206 g 213 t
1 agcaaaagca gggtgacaaa aacataatgg actccaacac tgtgtcaagc tttcaggtag
61 actgctttct ttggcatgtc cgcaaacgat ttgcagacca agaactgggt gatgccccat
121 tccttgaccg gcttcgccga gaccagaagt ccctaagagg aagaggcagc actcttggtc
181 tggacatcga gacagctact cgtgcgggaa agcaaatagt ggagcggatt ctgggggaaa
241 aatctgatga agcacttaaa atgaatattg cttctgtacc gacttcacgc tacctaactg
301 acatgactct tgaagaaatg tcaagagact ggttcatgct catgcccaag cagaaagtag
361 caggttctct ctgcatcaaa atggaccagg caataatgga taaaaccatc atactgaaag
421 caaatttcag tgtgattttt gatcggctgg aaaccctaat attacttaga gctttcacag
481 aagaaggagc aattgtggga gaaatctcac cattaccttc tcttccagga catactgatg
541 aggatgtcaa aattgcaatt ggggtcctca tcggagggct tgaatggaat gataacacag
601 ttcgagtctc tgaaactcta cagagattca cttggagaag cagtaatgag gatgggagac
661 cttcactccc ttcaaaacag aaacggaaaa tggcgagaac aattgagtca gaagttcgag
721 gaaataagat ggctgattga ggaaatgcga catagattga agaccacaga gaacagcttc
781 gaacaaataa cgtttatgca agctttacaa ctattgcttg aagtggagca agagataaga
841 accttctcgt ttcagcttat ttaatgataa aaaacaccct tgtttctact

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Wed Feb 11, 2015 1:51 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
EPI561713 A/broiler duck/Korea/H31/2014 (A/H5N8) segment 8 (NS) 1532.0 0.000000e+00 835/838 (99%)
EPI561701 A/spot-billed duck/Korea/H455-42/2014 (A/H5N8) segment 8 (NS) 1532.0 0.000000e+00 835/838 (99%)
EPI561694 A/common teal/Korea/H455-30/2014 (A/H5N8) segment 8 (NS) 1532.0 0.000000e+00 835/838 (99%)
EPI561685 A/tundra swan/Korea/H411/2014 (A/H5N8) segment 8 (NS) 1532.0 0.000000e+00 835/838 (99%)
EPI561678 A/bean goose/Korea/H328/2014 (A/H5N8) segment 8 (NS) 1532.0 0.000000e+00 835/838 (99%)
EPI561671 A/mallard/Korea/H297/2014 (A/H5N8) segment 8 (NS) 1532.0 0.000000e+00 835/838 (99%)
EPI561664 A/Korean native chicken/Korea/H257/2014 (A/H5N8) segment 8 (NS) 1532.0 0.000000e+00 835/838 (99%)
EPI561657 A/breeder chicken/Korea/H250/2014 (A/H5N8) segment 8 (NS) 1532.0 0.000000e+00 835/838 (99%)
EPI561630 A/mallard/Korea/H207/2014 (A/H5N8) segment 8 (NS) 1532.0 0.000000e+00 835/838 (99%)
EPI561623 A/breeder duck/Korea/H200/2014 (A/H5N8) segment 8 (NS) 1532.0 0.000000e+00 835/838 (99%)
EPI561574 A/Baikal teal/Korea/H96/2014 (A/H5N8) segment 8 (NS) 1532.0 0.000000e+00 835/838 (99%)
EPI561560 A/Coot/Korea/H81/2014 (A/H5N8) segment 8 (NS) 1532.0 0.000000e+00 835/838 (99%)
EPI561553 A/Baikal teal/Korea/H80/2014 (A/H5N8) segment 8 (NS) 1532.0 0.000000e+00 835/838 (99%)
EPI561533 A/Baikal teal/Korea/H66/2014 (A/H5N8) segment 8 (NS) 1532.0 0.000000e+00 835/838 (99%)
EPI561519 A/Baikal teal/Korea/H62/2014 (A/H5N8) segment 8 (NS) 1532.0 0.000000e+00 835/838 (99%)
EPI561345 A/Baikal teal/Korea/H41/2014 (A/H5N8) segment 8 (NS) 1532.0 0.000000e+00 835/838 (99%)
EPI561200 A/broiler duck/Korea/H29/2014 (A/H5N8) segment 8 (NS) 1532.0 0.000000e+00 835/838 (99%)
EPI542634 A/mallard/Korea/W452/2014 (A/H5N8) segment 8 (NS) 1532.0 0.000000e+00 835/838 (99%)
EPI509757 A/baikal teal/Korea/Donglim3/2014 (A/H5N8) segment 8 (NS) 1532.0 0.000000e+00 835/838 (99%)
EPI509712 A/broiler duck/Korea/Buan2/2014 (A/H5N8) segment 8 (NS) 1532.0 0.000000e+00 835/838 (99%)
EPI561650 A/breeder duck/Korea/H249/2014 (A/H5N8) segment 8 (NS) 1526.5 0.000000e+00 834/838 (99%)
EPI561609 A/broiler duck/Korea/H145/2014 (A/H5N8) segment 8 (NS) 1526.5 0.000000e+00 834/838 (99%)
EPI561602 A/broiler duck/Korea/H133/2014 (A/H5N8) segment 8 (NS) 1526.5 0.000000e+00 834/838 (99%)
EPI561595 A/breeder duck/Korea/H128/2014 (A/H5N8) segment 8 (NS) 1526.5 0.000000e+00 834/838 (99%)
EPI561581 A/breeder chicken/Korea/H122/2014 (A/H5N8) segment 8 (NS) 1526.5 0.000000e+00 834/838 (99%)
EPI561546 A/Baikal teal/Korea/H68/2014 (A/H5N8) segment 8 (NS) 1526.5 0.000000e+00 834/838 (99%)
EPI561364 A/bean goose/Korea/H40/2014 (A/H5N8) segment 8 (NS) 1526.5 0.000000e+00 834/838 (99%)
EPI561357 A/broiler duck/Korea/H48/2014 (A/H5N8) segment 8 (NS) 1526.5 0.000000e+00 834/838 (99%)
EPI561352 A/broiler duck/Korea/H47/2014 (A/H5N8) segment 8 (NS) 1526.5 0.000000e+00 834/838 (99%)
EPI561191 A/waterfowl/Korea/S005/2014 (A/H5N8) segment 8 (NS) 1526.5 0.000000e+00 834/838 (99%)
EPI554604 A/turkey/Germany-NI/R3372/2014 (A/H5N8) segment 8 (NS) 1526.5 0.000000e+00 834/838 (99%)
EPI553471 A/wigeon/Sakha/1/2014 (A/H5N8) segment 8 (NS) 1526.5 0.000000e+00 834/838 (99%)
EPI552750 A/turkey/Germany/R2474-L00899/2014 (A/H5N8) segment 8 (NS) 1526.5 0.000000e+00 834/838 (99%)
EPI548628 A/chicken/Netherlands/14015531/2014 (A/H5N8) segment 8 (NS) 1526.5 0.000000e+00 834/838 (99%)
EPI548428 A/turkey/Germany-MV/R2472/2014 (A/H5N8) segment 8 (NS) 1526.5 0.000000e+00 834/838 (99%)
EPI561637 A/white-fronted goose/Korea/H231/2014 (A/H5N8) segment 8 (NS) 1520.9 0.000000e+00 833/838 (99%)
EPI561616 A/breeder duck/Korea/H158/2014 (A/H5N8) segment 8 (NS) 1520.9 0.000000e+00 833/838 (99%)
EPI561567 A/Baikal teal/Korea/H84/2014 (A/H5N8) segment 8 (NS) 1520.9 0.000000e+00 833/838 (99%)
EPI561512 A/bean goose/Korea/H53/2014 (A/H5N8) segment 8 (NS) 1520.9 0.000000e+00 833/838 (99%)
EPI558013 A/duck/England/36038/14 (A/H5N8) segment 8 (NS) 1520.9 0.000000e+00 833/838 (99%)
EPI553212 A/crane/Kagoshima/KU1/2014 (A/H5N8) segment 8 (NS) 1520.9 0.000000e+00 833/838 (99%)
EPI547685 A/Chicken/Netherlands/14015526/2014 (A/H5N8) segment 8 (NS) 1520.9 0.000000e+00 833/838 (99%)
EPI547677 A/duck/England/36254/14 (A/H5N8) segment 8 (NS) 1520.9 0.000000e+00 833/838 (99%)
EPI517165 A/Chicken/Kumamoto/1-7/2014 (A/H5N8) segment 8 (NS) 1520.9 0.000000e+00 833/838 (99%)
EPI558006 A/duck/England/36226/14 (A/H5N8) segment 8 (NS) 1517.2 0.000000e+00 832/838 (99%)
EPI561526 A/broiler duck/Korea/H65/2014 (A/H5N8) segment 8 (NS) 1515.4 0.000000e+00 832/838 (99%)
EPI561369 A/broiler duck/Korea/H49/2014 (A/H5N8) segment 8 (NS) 1515.4 0.000000e+00 832/838 (99%)
EPI553366 A/environment/Kagoshima/KU-ngr-H/2014 (A/H5N8) segment 8 (NS) 1515.4 0.000000e+00 832/838 (99%)
EPI548497 A/duck/Chiba/26-372-61/2014 (A/H5N8) segment 8 (NS) 1515.4 0.000000e+00 832/838 (99%)
EPI548489 A/duck/Chiba/26-372-48/2014 (A/H5N8) segment 8 (NS) 1515.4 0.000000e+00 832/838 (99%)
EPI553347 A/chicken/Miyazaki/7/2014 (A/H5N8) segment 8 (NS) 1504.3 0.000000e+00 830/838 (99%)
EPI542998 A/duck/Beijing/FS01/2013 (A/H5N8) segment 8 (NS) 1504.3 0.000000e+00 828/835 (99%)
EPI543014 A/duck/Beijing/CT01/2014 (A/H5N8) segment 8 (NS) 1498.8 0.000000e+00 827/835 (99%)
EPI543006 A/duck/Beijing/FS01/2014 (A/H5N8) segment 8 (NS) 1493.2 0.000000e+00 826/835 (98%)
EPI553183 A/turkey/Italy/14VIR7898-10/2014 (A/H5N8) segment 8 (NS) 1476.6 0.000000e+00 810/816 (99%)
EPI552780 A/chicken/Netherlands/emc-3/2014 (A/H5N8) segment 8 (NS) 1476.6 0.000000e+00 809/814 (99%)
EPI431452 A/duck/Hebei/2/2011 (A/H5N2) segment 8 (NS) 1476.6 0.000000e+00 820/830 (98%)
EPI403396 A/duck/Eastern China/1111/2011 (A/H5N2) segment 8 (NS) 1476.6 0.000000e+00 826/839 (98%)
EPI414242 A/duck/Jiangsu/1-15/2011 (A/H4N2) segment 8 (NS) 1471.1 0.000000e+00 825/839 (98%)
EPI403397 A/goose/Eastern China/1112/2011 (A/H5N2) segment 8 (NS) 1465.5 0.000000e+00 824/839 (98%)
EPI552764 A/eurasian wigeon/Netherlands/emc-1/2014 (A/H5N8) segment 8 (NS) 1456.3 0.000000e+00 796/800 (99%)
EPI475583 A/wild duck/Shandong/628/2011 (A/H5N1) segment 8 (NS) 1432.3 0.000000e+00 817/838 (97%)
EPI431460 A/duck/Hebei/3/2011 (A/H5N2) segment 8 (NS) 1423.0 0.000000e+00 812/832 (97%)
EPI399964 A/duck/Jiangsu/m234/2012 (A/H5N2) segment 8 (NS) 1412.0 0.000000e+00 812/836 (97%)
EPI552772 A/eurasian wigeon/Netherlands/emc-2/2014 (A/H5N8) segment 8 (NS) 1388.0 0.000000e+00 765/772 (99%)
EPI296628 A/mallard/Sweden/95/2005 (A/H7N7) segment 8 (NS) 1354.7 0.000000e+00 803/838 (95%)
EPI130868 A/duck/Nanchang/1944/1993 (A/H7N4) segment 8 (NS) 1354.7 0.000000e+00 803/838 (95%)
EPI89129 A/duck/Nanchang/1904/1992 (A/H7N1) segment 8 (NS) 1354.7 0.000000e+00 803/838 (95%)
EPI485927 A/mallard/Sweden/17/2002 (A/H10N4) segment 8 (NS) 1349.2 0.000000e+00 802/838 (95%)
EPI485684 A/mallard/Sweden/64/2003 (A/H7N7) segment 8 (NS) 1349.2 0.000000e+00 802/838 (95%)
EPI377644 A/mallard/Netherlands/14/2001 (A/H2N3) segment 8 (NS) 1349.2 0.000000e+00 802/838 (95%)
EPI268644 A/wild duck/Shantou/311/2001 (A/H6N9) segment 8 (NS) 1349.2 0.000000e+00 802/838 (95%)
EPI268610 A/duck/Shantou/1090/2001 (A/H6N2) segment 8 (NS) 1349.2 0.000000e+00 802/838 (95%)
EPI251862 A/whitefronted goose/Netherlands/2/1999 (A/H6N2) segment 8 (NS) 1349.2 0.000000e+00 802/838 (95%)
EPI251854 A/whitefronted goose/Netherlands/1/1999 (A/H6N1) segment 8 (NS) 1349.2 0.000000e+00 802/838 (95%)
EPI251704 A/mallard/Sweden/4/2002 (A/H10N2) segment 8 (NS) 1349.2 0.000000e+00 803/839 (95%)
EPI251621 A/greylag goose/Netherlands/4/1999 (A/H6N1) segment 8 (NS) 1349.2 0.000000e+00 802/838 (95%)
EPI182085 A/black-headed gull/Netherlands/1/2005 (A/H6N8) segment 8 (NS) 1349.2 0.000000e+00 802/838 (95%)
EPI105878 A/duck/Primorie/3691/02 (A/H12N2) segment 8 (NS) 1349.2 0.000000e+00 796/829 (96%)
EPI514909 A/mallard/Sweden/146/2002 (A/H4N6) segment 8 (NS) 1343.6 0.000000e+00 802/839 (95%)
EPI514749 A/mallard/Sweden/4514/2004 (A/H4N6) segment 8 (NS) 1343.6 0.000000e+00 801/838 (95%)
EPI514157 A/mallard/Sweden/58359/2006 (A/H0) segment 8 (NS) 1343.6 0.000000e+00 801/838 (95%)
EPI470704 A/wild waterfowl/Hong Kong/MPJ1815/2010 (A/H11N9) segment 8 (NS) 1343.6 0.000000e+00 801/838 (95%)
EPI470665 A/eurasian wigeon/Hong Kong/MPK653/2009 (A/H11N9) segment 8 (NS) 1343.6 0.000000e+00 801/838 (95%)
EPI470656 A/eurasian wigeon/Hong Kong/MPK655/2009 (A/H11N9) segment 8 (NS) 1343.6 0.000000e+00 801/838 (95%)
EPI447398 A/mallard/Italy/3401/2005 (A/H5N1) segment 8 (NS) 1343.6 0.000000e+00 801/838 (95%)
EPI447396 A/mallard/Italy/3401/2005 (A/H5N1) segment 8 (NS) 1343.6 0.000000e+00 801/838 (95%)
EPI327321 A/mallard/Italy/3401/2005 (A/H5N1) segment 8 (NS) 1343.6 0.000000e+00 801/838 (95%)
EPI268611 A/duck/Shantou/728/2001 (A/H6N2) segment 8 (NS) 1343.6 0.000000e+00 801/838 (95%)
EPI60376 A/mallard/Italy/3401/2005 (A/H5N1) segment 8 (NS) 1343.6 0.000000e+00 801/838 (95%)
EPI514916 A/mallard/Sweden/274/2002 (A/H4N2) segment 8 (NS) 1338.1 0.000000e+00 800/838 (95%)
EPI514892 A/mallard/Sweden/1616/2002 (A/H4N6) segment 8 (NS) 1338.1 0.000000e+00 800/838 (95%)
EPI514885 A/mallard/Sweden/1544/2002 (A/H4N6) segment 8 (NS) 1338.1 0.000000e+00 800/838 (95%)
EPI514833 A/mallard/Sweden/1705/2002 (A/H4N6) segment 8 (NS) 1338.1 0.000000e+00 800/838 (95%)
EPI514826 A/mallard/Sweden/1677/2002 (A/H4N6) segment 8 (NS) 1338.1 0.000000e+00 800/838 (95%)
EPI514819 A/mallard/Sweden/1665/2002 (A/H4N6) segment 8 (NS) 1338.1 0.000000e+00 800/838 (95%)
EPI514812 A/mallard/Sweden/1656/2002 (A/H4N6) segment 8 (NS) 1338.1 0.000000e+00 800/838 (95%)
EPI514222 A/mallard/Sweden/52484/2006 (A/H4N6) segment 8 (NS) 1338.1 0.000000e+00 800/838 (95%)
EPI485934 A/mallard/Sweden/39/2002 (A/H5N3) segment 8 (NS) 1338.1 0.000000e+00 801/839 (95%)
EPI372420 A/teal/Egypt/01207-NAMRU3/2007 (A/H10N7) segment 8 (NS) 1338.1 0.000000e+00 800/838 (95%)

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Mon May 18, 2015 2:42 pm 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
H5N2 sequence at GISAID

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Mon May 18, 2015 2:44 pm 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
EPI588968 A/chicken/Taiwan/a174/2015 (A/H5N3) segment 4 (HA) 3142.3 0.000000e+00 1703/1704 (99%)
EPI573638 A/crane/Kagoshima/KU13/2014(H5N8) (A/H5N8) segment 4 (HA) 3142.3 0.000000e+00 1703/1704 (99%)
EPI588976 A/duck/Taiwan/a068/2015 (A/H5N8) segment 4 (HA) 3125.7 0.000000e+00 1700/1704 (99%)
EPI588960 A/duck/Taiwan/a043/2015 (A/H5N2) segment 4 (HA) 3125.7 0.000000e+00 1700/1704 (99%)
EPI553208 A/crane/Kagoshima/KU1/2014 (A/H5N8) segment 4 (HA) 3116.4 0.000000e+00 1697/1702 (99%)
EPI588952 A/goose/Taiwan/a015/2015 (A/H5N8) segment 4 (HA) 3109.0 0.000000e+00 1697/1704 (99%)
EPI586534 A/chicken/BC/FAV22/2014 (A/H5N2) segment 4 (HA) 3099.8 0.000000e+00 1695/1704 (99%)
EPI586550 A/chicken/BC/FAV24/2014 (A/H5N2) segment 4 (HA) 3098.0 0.000000e+00 1695/1704 (99%)
EPI586518 A/chicken/BC/FAV20/2014 (A/H5N2) segment 4 (HA) 3098.0 0.000000e+00 1695/1704 (99%)
EPI586509 A/poultry/BC/FAV19/2014 (A/H5N2) segment 4 (HA) 3098.0 0.000000e+00 1695/1704 (99%)
EPI584079 A/turkey/BC/FAV14/2014 (A/H5N2) segment 4 (HA) 3098.0 0.000000e+00 1695/1704 (99%)
EPI573298 A/turkey/BC/FAV10/2014 (A/H5N2) segment 4 (HA) 3098.0 0.000000e+00 1695/1704 (99%)
EPI569383 A/Northern pintail/Washington/40964/2014 (A/H5N2) segment 4 (HA) 3098.0 0.000000e+00 1695/1704 (99%)
EPI586542 A/chicken/BC/FAV23/2014 (A/H5N2) segment 4 (HA) 3092.4 0.000000e+00 1694/1704 (99%)
EPI586526 A/chicken/BC/FAV21/2014 (A/H5N2) segment 4 (HA) 3092.4 0.000000e+00 1694/1704 (99%)
EPI586493 A/poultry/BC/FAV15/2014 (A/H5N2) segment 4 (HA) 3092.4 0.000000e+00 1694/1704 (99%)
EPI585092 A/pheasant/Washington/3147-2/2015 (A/H5N2) segment 4 (HA) 3092.4 0.000000e+00 1694/1704 (99%)
EPI576470 A/chicken/BC/FAV8/2014 (A/H5N2) segment 4 (HA) 3092.4 0.000000e+00 1694/1704 (99%)
EPI569390 A/gyrfalcon/Washington/41088-6/2014 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1694/1704 (99%)
EPI569376 A/guinea fowl/Oregon/41613-1/2014 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1694/1704 (99%)
EPI569372 A/chicken/Oregon/41613-2/2014 (A/H5N8) segment 4 (HA) 3092.4 0.000000e+00 1694/1704 (99%)
EPI587633 A/chicken/Iowa/04-20/2015 (A/H5N2) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%)
EPI587521 A/American wigeon/BC/050-31/2015 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%)
EPI586501 A/poultry/BC/FAV17/2014 (A/H5N2) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%)
EPI585084 A/turkey/California/K1500169-1.2/2015 (A/H5N8) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%)
EPI576477 A/chicken/BC/FAV9/2014 (A/H5N2) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%)
EPI573281 A/turkey/Washington/61-22/2014 (A/H5N2) segment 4 (HA) 3086.9 0.000000e+00 1693/1704 (99%)
EPI586558 A/chicken/BC/FAV25/2014 (A/H5N2) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%)
EPI573271 A/chicken/Washington/61-9/2014 (A/H5N2) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%)
EPI561570 A/Baikal teal/Korea/H96/2014 (A/H5N8) segment 4 (HA) 3081.3 0.000000e+00 1692/1704 (99%)
EPI585595 A/baikal teal/Korea/2417/2014 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%)
EPI585589 A/baikal teal/Korea/2399/2014 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%)
EPI585586 A/baikal teal/Korea/1456/2014 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%)
EPI573276 A/domestic duck/Washington/61-16/2014 (A/H5N2) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%)
EPI561646 A/breeder duck/Korea/H249/2014 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%)
EPI561626 A/mallard/Korea/H207/2014 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%)
EPI561605 A/broiler duck/Korea/H145/2014 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%)
EPI561591 A/breeder duck/Korea/H128/2014 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%)
EPI561529 A/Baikal teal/Korea/H66/2014 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%)
EPI561508 A/bean goose/Korea/H53/2014 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%)
EPI561341 A/Baikal teal/Korea/H41/2014 (A/H5N8) segment 4 (HA) 3075.8 0.000000e+00 1691/1704 (99%)
EPI585594 A/baikal teal/Korea/2416/2014 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%)
EPI585592 A/baikal teal/Korea/2406/2014 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%)
EPI585591 A/baikal teal/Korea/2403/2014 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%)
EPI585590 A/baikal teal/Korea/2402/2014 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%)
EPI585582 A/baikal teal/Korea/1448/2014 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%)
EPI585581 A/baikal teal/Korea/1447/2014 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%)
EPI585579 A/baikal teal/Korea/1445/2014 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%)
EPI585577 A/baikal teal/Korea/1437/2014 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%)
EPI573286 A/American green-winged teal/Washington/195750/2014 (A/H5N1) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%)
EPI561674 A/bean goose/Korea/H328/2014 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%)
EPI561612 A/breeder duck/Korea/H158/2014 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%)
EPI561577 A/breeder chicken/Korea/H122/2014 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%)
EPI561563 A/Baikal teal/Korea/H84/2014 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%)
EPI561542 A/Baikal teal/Korea/H68/2014 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%)
EPI561522 A/broiler duck/Korea/H65/2014 (A/H5N8) segment 4 (HA) 3070.3 0.000000e+00 1690/1704 (99%)
EPI585593 A/baikal teal/Korea/2414/2014 (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1689/1704 (99%)
EPI585587 A/baikal teal/Korea/1457/2014 (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1689/1704 (99%)
EPI585584 A/baikal teal/Korea/1452/2014 (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1689/1704 (99%)
EPI585583 A/baikal teal/Korea/1449/2014 (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1689/1704 (99%)
EPI561705 A/bean goose/Korea/H40/2014 (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1689/1704 (99%)
EPI561667 A/mallard/Korea/H297/2014 (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1690/1705 (99%)
EPI561653 A/breeder chicken/Korea/H250/2014 (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1689/1704 (99%)
EPI561633 A/white-fronted goose/Korea/H231/2014 (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1689/1704 (99%)
EPI509704 A/broiler duck/Korea/Buan2/2014 (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1689/1704 (99%)
EPI585580 A/baikal teal/Korea/1446/2014 (A/H5N8) segment 4 (HA) 3059.2 0.000000e+00 1688/1704 (99%)
EPI573196 A/broiler duck/Korea/H651/2014 (A/H5N8) segment 4 (HA) 3059.2 0.000000e+00 1688/1704 (99%)
EPI573194 A/breeder chicken/Korea/H818/2014 (A/H5N8) segment 4 (HA) 3059.2 0.000000e+00 1688/1704 (99%)
EPI561697 A/spot-billed duck/Korea/H455-42/2014 (A/H5N8) segment 4 (HA) 3059.2 0.000000e+00 1688/1704 (99%)
EPI561681 A/tundra swan/Korea/H411/2014 (A/H5N8) segment 4 (HA) 3059.2 0.000000e+00 1688/1704 (99%)
EPI561660 A/Korean native chicken/Korea/H257/2014 (A/H5N8) segment 4 (HA) 3059.2 0.000000e+00 1688/1704 (99%)
EPI561598 A/broiler duck/Korea/H133/2014 (A/H5N8) segment 4 (HA) 3059.2 0.000000e+00 1688/1704 (99%)
EPI561360 A/broiler duck/Korea/H49/2014 (A/H5N8) segment 4 (HA) 3059.2 0.000000e+00 1688/1704 (99%)
EPI561348 A/broiler duck/Korea/H47/2014 (A/H5N8) segment 4 (HA) 3059.2 0.000000e+00 1688/1704 (99%)
EPI561336 A/broiler duck/Korea/H48/2014 (A/H5N8) segment 4 (HA) 3059.2 0.000000e+00 1688/1704 (99%)
EPI561204 A/broiler duck/Korea/H31/2014 (A/H5N8) segment 4 (HA) 3059.2 0.000000e+00 1688/1704 (99%)
EPI561196 A/broiler duck/Korea/H29/2014 (A/H5N8) segment 4 (HA) 3059.2 0.000000e+00 1688/1704 (99%)
EPI561187 A/waterfowl/Korea/S005/2014 (A/H5N8) segment 4 (HA) 3059.2 0.000000e+00 1688/1704 (99%)
EPI517161 A/Chicken/Kumamoto/1-7/2014 (A/H5N8) segment 4 (HA) 3059.2 0.000000e+00 1688/1704 (99%)
EPI585588 A/baikal teal/Korea/1458/2014 (A/H5N8) segment 4 (HA) 3053.6 0.000000e+00 1687/1704 (99%)
EPI585585 A/baikal teal/Korea/1454/2014 (A/H5N8) segment 4 (HA) 3053.6 0.000000e+00 1687/1704 (99%)
EPI573192 A/breeder chicken/Korea/H503/2014 (A/H5N8) segment 4 (HA) 3053.6 0.000000e+00 1687/1704 (99%)
EPI561690 A/common teal/Korea/H455-30/2014 (A/H5N8) segment 4 (HA) 3053.6 0.000000e+00 1687/1704 (99%)
EPI561556 A/Coot/Korea/H81/2014 (A/H5N8) segment 4 (HA) 3053.6 0.000000e+00 1687/1704 (99%)
EPI561549 A/Baikal teal/Korea/H80/2014 (A/H5N8) segment 4 (HA) 3053.6 0.000000e+00 1687/1704 (99%)
EPI561515 A/Baikal teal/Korea/H62/2014 (A/H5N8) segment 4 (HA) 3053.6 0.000000e+00 1687/1704 (99%)
EPI509709 A/baikal teal/Korea/Donglim3/2014 (A/H5N8) segment 4 (HA) 3053.6 0.000000e+00 1687/1704 (99%)
EPI585578 A/baikal teal/Korea/1441/2014 (A/H5N8) segment 4 (HA) 3048.1 0.000000e+00 1686/1704 (98%)
EPI573195 A/breeder chicken/Korea/H818/2014 (A/H5N8) segment 4 (HA) 3048.1 0.000000e+00 1686/1704 (98%)
EPI561619 A/breeder duck/Korea/H200/2014 (A/H5N8) segment 4 (HA) 3042.6 0.000000e+00 1686/1705 (98%)
EPI542628 A/mallard/Korea/W452/2014 (A/H5N8) segment 4 (HA) 3037.0 0.000000e+00 1684/1704 (98%)
EPI553349 A/wigeon/Sakha/1/2014 (A/H5N8) segment 4 (HA) 3031.5 0.000000e+00 1683/1704 (98%)
EPI550849 A/duck/England/36226/14 (A/H5N8) segment 4 (HA) 3025.9 0.000000e+00 1682/1704 (98%)
EPI550848 A/duck/England/36038/14 (A/H5N8) segment 4 (HA) 3025.9 0.000000e+00 1682/1704 (98%)
EPI547673 A/duck/England/36254/14 (A/H5N8) segment 4 (HA) 3014.9 0.000000e+00 1680/1704 (98%)
EPI552746 A/turkey/Germany/R2474-L00899/2014 (A/H5N8) segment 4 (HA) 3003.8 0.000000e+00 1678/1704 (98%)
EPI548493 A/duck/Chiba/26-372-61/2014 (A/H5N8) segment 4 (HA) 3003.8 0.000000e+00 1678/1704 (98%)
EPI548485 A/duck/Chiba/26-372-48/2014 (A/H5N8) segment 4 (HA) 3003.8 0.000000e+00 1678/1704 (98%)
EPI547678 A/Chicken/Netherlands/14015526/2014 (A/H5N8) segment 4 (HA) 3003.8 0.000000e+00 1678/1704 (98%)
EPI548623 A/chicken/Netherlands/14015531/2014 (A/H5N8) segment 4 (HA) 2998.2 0.000000e+00 1677/1704 (98%)

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Mon May 18, 2015 3:03 pm 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
EPI588970 A/chicken/Taiwan/a174/2015 (A/H5N3) segment 6 (NA) 2595.7 0.000000e+00 1408/1410 (99%)
EPI406332 A/duck/Hokkaido/157/2012 (A/H11N3) segment 6 (NA) 2484.9 0.000000e+00 1388/1410 (98%)
EPI259431 A/duck/Hokkaido/327/2009 (A/H1N3) segment 6 (NA) 2440.5 0.000000e+00 1380/1410 (97%)
EPI545253 A/green winged teal/Japan/9KS0643/2009 (A/H12N3) segment 6 (NA) 2429.5 0.000000e+00 1378/1410 (97%)
EPI181914 A/duck/Niigata/514/2006 (A/H5N3) segment 6 (NA) 2407.3 0.000000e+00 1374/1410 (97%)
EPI276138 A/pintail/Aomori/1130/2008 (A/H1N3) segment 6 (NA) 2396.2 0.000000e+00 1372/1410 (97%)
EPI408361 A/duck/Korea/BC10/2007 (A/H7N3) segment 6 (NA) 2390.7 0.000000e+00 1371/1410 (97%)
EPI341944 A/duck/Nanjing/19/2010 (A/H1N3) segment 6 (NA) 2385.1 0.000000e+00 1371/1411 (97%)
EPI341937 A/duck/Nanjing/20/2010 (A/H1N3) segment 6 (NA) 2385.1 0.000000e+00 1371/1411 (97%)
EPI392622 A/wild bird/Korea/A4/11 (A/H7N3) segment 6 (NA) 2372.2 0.000000e+00 1351/1385 (97%)
EPI160656 A/duck/Hokkaido/167/2007 (A/H5N3) segment 6 (NA) 2368.5 0.000000e+00 1367/1410 (96%)
EPI485340 A/ruddy shelduck/Mongolia/894V/2009 (A/H4N3) segment 6 (NA) 2364.8 0.000000e+00 1341/1372 (97%)
EPI220656 A/northern pintail/Aomori/385/2008 (A/H5N3) segment 6 (NA) 2363.0 0.000000e+00 1366/1410 (96%)
EPI504025 A/wild duck/SH17-34/2008 (A/H2N3) segment 6 (NA) 2329.7 0.000000e+00 1360/1410 (96%)
EPI161531 A/duck/Mongolia/274/2007 (A/H4N3) segment 6 (NA) 2329.7 0.000000e+00 1361/1411 (96%)
EPI503992 A/wild duck/SH17-1/2008 (A/H2N3) segment 6 (NA) 2324.2 0.000000e+00 1359/1410 (96%)
EPI296210 A/wild duck/Korea/SH29/2006 (A/H1N3) segment 6 (NA) 2315.0 0.000000e+00 1320/1354 (97%)
EPI296212 A/wild duck/Korea/SH14/2006 (A/H1N3) segment 6 (NA) 2309.4 0.000000e+00 1319/1354 (97%)
EPI296211 A/wild duck/Korea/PJ25/2006 (A/H1N3) segment 6 (NA) 2303.9 0.000000e+00 1318/1354 (97%)
EPI377791 A/mallard/Sweden/57/2002 (A/H2N3) segment 6 (NA) 2302.0 0.000000e+00 1355/1410 (96%)
EPI377674 A/mallard/Sweden/99/2002 (A/H2N3) segment 6 (NA) 2302.0 0.000000e+00 1355/1410 (96%)
EPI508003 A/Northern shoveler/Korea/SD175/2008 (A/H7N3) segment 6 (NA) 2298.4 0.000000e+00 1325/1366 (96%)
EPI377847 A/mallard/Sweden/53/2003 (A/H2N3) segment 6 (NA) 2279.9 0.000000e+00 1351/1410 (95%)
EPI118090 A/mallard/Italy/208/2000 (A/H5N3) segment 6 (NA) 2268.8 0.000000e+00 1347/1407 (95%)
EPI21402 A/mallard/Italy/208/2000 (A/H5N3) segment 6 (NA) 2268.8 0.000000e+00 1347/1407 (95%)
EPI377658 A/mallard/Sweden/6/2002 (A/H2N3) segment 6 (NA) 2263.3 0.000000e+00 1348/1410 (95%)
EPI251771 A/mallard/Sweden/6/2002 (A/H2N3) segment 6 (NA) 2263.3 0.000000e+00 1348/1410 (95%)
EPI507993 A/bean goose/Korea/SH20-17/2008 (A/H7N3) segment 6 (NA) 2255.9 0.000000e+00 1320/1370 (96%)
EPI485315 A/mallard/Mongolia/651/2010 (A/H2N3) segment 6 (NA) 2252.2 0.000000e+00 1299/1339 (97%)
EPI262639 A/aquatic bird/Korea/w209/2007 (A/H5N3) segment 6 (NA) 2252.2 0.000000e+00 1349/1413 (95%)
EPI21400 A/mallard/Italy/36/1999 (A/H2N3) segment 6 (NA) 2252.2 0.000000e+00 1344/1407 (95%)
EPI296206 A/duck/Korea/U14/2007 (A/H1N3) segment 6 (NA) 2243.0 0.000000e+00 1308/1355 (96%)
EPI514845 A/mallard/Sweden/1883/2003 (A/H4N3) segment 6 (NA) 2235.6 0.000000e+00 1343/1410 (95%)
EPI182396 A/duck/Altai/1285/1991 (A/H5N3) segment 6 (NA) 2235.6 0.000000e+00 1344/1411 (95%)
EPI372449 A/shoveler/Egypt/00017-NAMRU3/2007 (A/H7N3) segment 6 (NA) 2226.3 0.000000e+00 1342/1411 (95%)
EPI68166 A/duck/Italy/775/2004 (A/H5N3) segment 6 (NA) 2224.5 0.000000e+00 1341/1410 (95%)
EPI21398 A/mallard/Italy/35/1999 (A/H2N3) segment 6 (NA) 2224.5 0.000000e+00 1340/1408 (95%)
EPI377896 A/mallard/Sweden/73/2005 (A/H2N3) segment 6 (NA) 2213.4 0.000000e+00 1339/1410 (94%)
EPI272791 A/mallard/PT/4228/2007 (A/H5N3) segment 6 (NA) 2213.4 0.000000e+00 1339/1410 (94%)
EPI573059 A/Ostrich/Netherlands/03006814/2003 (A/H2N3) segment 6 (NA) 2207.9 0.000000e+00 1338/1410 (94%)
EPI227121 A/duck/France/05054a/2005 (A/H5N3) segment 6 (NA) 2207.9 0.000000e+00 1338/1410 (94%)
EPI174874 A/mallard/Denmark/77-64849-G2/2005 (A/H1N3) segment 6 (NA) 2200.5 0.000000e+00 1326/1394 (95%)
EPI262638 A/aquatic bird/Korea/w16/2005 (A/H5N3) segment 6 (NA) 2196.8 0.000000e+00 1337/1411 (94%)
EPI89973 A/mallard/Netherlands/12/00 (A/H7N3) segment 6 (NA) 2193.1 0.000000e+00 1336/1411 (94%)
EPI238139 A/mallard/Netherlands/12/2000 (A/H7N3) segment 6 (NA) 2191.2 0.000000e+00 1336/1411 (94%)
EPI378004 A/mallard/Netherlands/29/2010 (A/H2N3) segment 6 (NA) 2185.7 0.000000e+00 1334/1410 (94%)
EPI377799 A/mallard/Sweden/70/2002 (A/H2N3) segment 6 (NA) 2185.7 0.000000e+00 1335/1411 (94%)
EPI182059 A/mallard/Sweden/65/2005 (A/H4N3) segment 6 (NA) 2185.7 0.000000e+00 1334/1410 (94%)
EPI141374 A/Perdix perdix/Germany/R44/06 (A/H8N3) segment 6 (NA) 2185.7 0.000000e+00 1334/1410 (94%)
EPI13873 A/teal/France/2546/2001 (A/H1N3) segment 6 (NA) 2185.7 0.000000e+00 1335/1411 (94%)
EPI485556 A/mallard/Sweden/46/2002 (A/H4N3) segment 6 (NA) 2180.2 0.000000e+00 1335/1412 (94%)
EPI398730 A/mallard/Portugal/99013/2009 (A/H11) segment 6 (NA) 2180.2 0.000000e+00 1331/1410 (94%)
EPI251690 A/mallard/Sweden/25/2002 (A/H11N3) segment 6 (NA) 2180.2 0.000000e+00 1334/1411 (94%)
EPI513365 A/mallard/Sweden/101900/2009 (A/H4N3) segment 6 (NA) 2174.6 0.000000e+00 1332/1410 (94%)
EPI378012 A/mallard/Netherlands/12/2008 (A/H2N3) segment 6 (NA) 2174.6 0.000000e+00 1332/1410 (94%)
EPI21406 A/mallard/Italy/43/2001 (A/H7N3) segment 6 (NA) 2174.6 0.000000e+00 1330/1407 (94%)
EPI21404 A/mallard/Italy/33/01 (A/H7N3) segment 6 (NA) 2174.6 0.000000e+00 1330/1407 (94%)
EPI462883 A/environment/Guangdong/2/2009 (A/H2N3) segment 6 (NA) 2172.8 0.000000e+00 1285/1340 (95%)
EPI378020 A/mallard/Netherlands/1/2010 (A/H2N3) segment 6 (NA) 2169.1 0.000000e+00 1332/1411 (94%)
EPI377996 A/common teal/Netherlands/2/2008 (A/H2N3) segment 6 (NA) 2169.1 0.000000e+00 1331/1410 (94%)
EPI377980 A/mallard/Netherlands/37/2008 (A/H2N3) segment 6 (NA) 2169.1 0.000000e+00 1331/1410 (94%)
EPI230041 A/whooper swan/Mongolia/232/2005 (A/H12N3) segment 6 (NA) 2169.1 0.000000e+00 1332/1411 (94%)
EPI230031 A/ruddy shelduck/Mongolia/P52/2005 (A/H12N3) segment 6 (NA) 2169.1 0.000000e+00 1332/1411 (94%)
EPI229929 A/bar headed goose/Mongolia/143/2005 (A/H12N3) segment 6 (NA) 2169.1 0.000000e+00 1332/1411 (94%)
EPI181641 A/duck/Tsukuba/394/2005 (A/H5N3) segment 6 (NA) 2169.1 0.000000e+00 1332/1411 (94%)
EPI63244 A/teal/Italy/3812/2005 (A/H5N3) segment 6 (NA) 2169.1 0.000000e+00 1331/1410 (94%)
EPI13871 A/mallard/France/2518/2001 (A/H9N3) segment 6 (NA) 2169.1 0.000000e+00 1331/1410 (94%)
EPI507987 A/wild bird feces/Korea/SH21/2006 (A/H7N3) segment 6 (NA) 2167.2 0.000000e+00 1313/1383 (94%)
EPI377936 A/mallard/Sweden/5/2005 (A/H2N3) segment 6 (NA) 2163.5 0.000000e+00 1331/1411 (94%)
EPI230023 A/ruddy shelduck/Mongolia/37/2005 (A/H12N3) segment 6 (NA) 2163.5 0.000000e+00 1331/1411 (94%)
EPI182404 A/duck/Primorie/2633/01 (A/H5N3) segment 6 (NA) 2163.5 0.000000e+00 1330/1410 (94%)
EPI377807 A/northern pintail/Sweden/1/2003 (A/H2N3) segment 6 (NA) 2158.0 0.000000e+00 1330/1411 (94%)
EPI377554 A/mallard/Sweden/6/2003 (A/H2N3) segment 6 (NA) 2158.0 0.000000e+00 1330/1411 (94%)
EPI251838 A/northern pintail/Sweden/1/2003 (A/H2N3) segment 6 (NA) 2158.0 0.000000e+00 1330/1411 (94%)
EPI251613 A/common teal/Sweden/1/2003 (A/H3N3) segment 6 (NA) 2158.0 0.000000e+00 1311/1383 (94%)
EPI229975 A/duck/France/06436/2006 (A/H5N3) segment 6 (NA) 2158.0 0.000000e+00 1330/1411 (94%)
EPI169304 A/duck/France/06436/2006 (A/H5N3) segment 6 (NA) 2158.0 0.000000e+00 1330/1411 (94%)
EPI125299 A/mallard/Italy/199/01 (A/H7N3) segment 6 (NA) 2156.2 0.000000e+00 1322/1400 (94%)
EPI377988 A/mallard/Netherlands/58/2008 (A/H2N3) segment 6 (NA) 2152.5 0.000000e+00 1328/1410 (94%)
EPI377823 A/mallard/Sweden/81/2003 (A/H2N3) segment 6 (NA) 2152.5 0.000000e+00 1329/1411 (94%)
EPI377815 A/mallard/Sweden/12/2003 (A/H2N3) segment 6 (NA) 2152.5 0.000000e+00 1329/1411 (94%)
EPI3245 A/duck/Hokkaido/84/2002 (A/H5N3) segment 6 (NA) 2152.5 0.000000e+00 1329/1411 (94%)
EPI3239 A/duck/Hokkaido/17/2001 (A/H2N3) segment 6 (NA) 2152.5 0.000000e+00 1329/1411 (94%)
EPI272802 A/tufted duck/PT/13771/2006 (A/H7N3) segment 6 (NA) 2150.6 0.000000e+00 1328/1410 (94%)
EPI377830 A/mallard/Sweden/84/2003 (A/H2N3) segment 6 (NA) 2146.9 0.000000e+00 1328/1411 (94%)
EPI89006 A/Bantam/Nanchang/9-366/2000 (A/H3N3) segment 6 (NA) 2146.9 0.000000e+00 1329/1412 (94%)
EPI16382 A/Pigeon/Nanchang/9-058/2000 (A/H3N3) segment 6 (NA) 2146.9 0.000000e+00 1329/1412 (94%)
EPI16380 A/Bantam/Nanchang/9-366/2000 (A/H3N3) segment 6 (NA) 2141.4 0.000000e+00 1328/1412 (94%)
EPI181653 A/duck/Shimane/83/2006 (A/H7N3) segment 6 (NA) 2135.8 0.000000e+00 1326/1411 (93%)
EPI181642 A/duck/Shizuoka/40/2002 (A/H5N3) segment 6 (NA) 2135.8 0.000000e+00 1325/1410 (93%)
EPI174827 A/duck/Denmark/74-68425/2002 (A/H1N3) segment 6 (NA) 2135.8 0.000000e+00 1325/1410 (93%)
EPI485333 A/ruddy shelduck/Mongolia/686C2/2008 (A/H2N3) segment 6 (NA) 2132.2 0.000000e+00 1283/1348 (95%)
EPI377569 A/mallard/Sweden/88/2005 (A/H0) segment 6 (NA) 2130.3 0.000000e+00 1324/1410 (93%)
EPI377560 A/mallard/Sweden/58/2005 (A/H0) segment 6 (NA) 2130.3 0.000000e+00 1324/1410 (93%)
EPI235863 A/duck/France/02166/2002 (A/H0) segment 6 (NA) 2130.3 0.000000e+00 1325/1411 (93%)
EPI229999 A/mallard/France/061054/2006 (A/H5N3) segment 6 (NA) 2130.3 0.000000e+00 1324/1410 (93%)
EPI182035 A/mallard/Sweden/45/2005 (A/H2N3) segment 6 (NA) 2130.3 0.000000e+00 1324/1410 (93%)
EPI169276 A/duck/France/061054/2006 (A/H5N3) segment 6 (NA) 2130.3 0.000000e+00 1324/1410 (93%)
EPI377928 A/mallard/Sweden/107/2005 (A/H2N3) segment 6 (NA) 2124.8 0.000000e+00 1323/1410 (93%)
EPI377912 A/mallard/Sweden/93/2005 (A/H2N3) segment 6 (NA) 2124.8 0.000000e+00 1323/1410 (93%)

_________________
www.twitter.com/hniman


Top
 Profile  
 
Display posts from previous:  Sort by  
Post new topic Reply to topic  [ 26 posts ]  Go to page Previous  1, 2, 3  Next

All times are UTC - 5 hours [ DST ]


Who is online

Users browsing this forum: No registered users and 31 guests


You cannot post new topics in this forum
You cannot reply to topics in this forum
You cannot edit your posts in this forum
You cannot delete your posts in this forum
You cannot post attachments in this forum

Search for:
Jump to:  
Powered by phpBB® Forum Software © phpBB Group