Rhiza Labs FluTracker Forum

The place to discuss the flu
It is currently Tue Oct 17, 2017 9:06 am

All times are UTC - 5 hours [ DST ]




Post new topic Reply to topic  [ 26 posts ]  Go to page 1, 2, 3  Next
Author Message
PostPosted: Wed Feb 11, 2015 12:21 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
Full H5N2 Sequences A/Goose/Taiwan/0104/2015 have been released.

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Wed Feb 11, 2015 12:23 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
1776 bp mRNA linear 29-JAN- 2015

DEFINITION

ACCESSION VERSION KEYWORDS SOURCE

Influenza A virus A/Goose/ Taiwan/0104/ 2015 (HSN2)) hemagglutinin (HA) gene, complete eds.



Viruses; ssRNA negative-strand viruses ; Orthomyxov iridae; Influenzavirus A.

ORGANISM Viruses; ssRNA negative-strand viruses ; Orthomyxoviridae; Influenzavirus A.
Unclassified .
REFERENCE 1 (bases 1 to 1776)

AUTHORS

TITLE JOURNAL
REFERENCE AUTHORS

TITLE JOURNAL


COMMENT



FEATURES
source










gene CDS

Lee , M.S. , Chen , L.H . , Liu , Y.P. , Chen , Y .P. , Li,W .C. , Lee, F . ,
Ting,L.J . and Lin,Y.L.
Avian influenza subtype HS in geese in Taiwan , 2015 Unpublished
2 (bases 1 to 1776)
Lee,M.S. , Chen , L .H. , Liu,Y. P ., Chen,Y.P. , Li,W.C. , Lee , F. ,
Ting,L .J . and Lin,Y.L. Direct Submission
Submi tted (29-JAN-2015) Epidemiology Research Department, National Institute for Animal Health, Chung- Cheng Rd, Tansui, Taiwan 251 , Taiwan
##Assembly-Data-START##
Assembly Method Lasergene DNASTAR v. Jan. 2015 Sequencing Technology :: Sanger dideoxy sequencing
##Assembly-Data-END##
Location/Qualifiers
1. . 1776
/organism= "Viruses; ssRNA negative-strand viru ses; Orthomyxoviridae; Influenzavirus A ."
/mol type="mRNA "
/strin= "A/GS/TW/0104/2015 "
/isolation_source= "organ "
/host= "goose "
/segment= "4"
/country= "Taiwan"
/collection_date= "2015/0l/09 "
/subtype="HSN2"
1. . 1776
/gene= "HA " 29 . .1732
/gene= "HA "
/codon_start=l
/product= "hemagglutinin "
/translation= "MEKIVLLLAVISLVKSDQICIGYHANNSTKQVDTIMEKNVTVTH AQDILEKTHNGKLCDLNGVKPLILKDCSVAGWLLGNPMCDEFIRVPEWSYIVERANPV NDLCYPGTLNDYEELKHLLSRINHFEKTLIIPRSSWPNHETSLGVSAACPYQGASSFF RNVVWLIKKNDAYPTIKISYNNTNREDLLILWGIHHSNNAAEQTNLYKNPDTYVSVGT STLNQRLVPKIATRSQVNGQSGRMGFFWTILKPNDAIHFESNGNFIAPEYAYKIVKKG DSTIMKSEMEYGHCNTKCQTPIGAINSSMPFHNIHPLTIGECPKYVKSNKLVLATGLR NSPLRERRRKRGLFGAIAGFIEGGWQGMVDGWYGYHHSNEQGSGYAADKESTQ KAIDG VTNKVNSIIDKMNTQFEAVGREFNNLERRIENLNKKMEDGFLDVWTYNAELLVLMENE RTLDFHDSNVKNLYDKVRLQLRDNAKELGNGCFEFYHKCDNECMESVRNGTYDYPKYS EEAILKREEISGVKLESIGTYQILSIYSTVASSLALAIIVAGLSLWMCSNGSLQCRIC I"

BASE COUNT 616 a 332 c 404 g 424 t ORIGIN
1 agcaaaagca ggggtataat ctgtcaaaat ggagaaaata gtgcttcttc ttgcagtgat
61 tagccttgtt aaaagtgatc agatttgcat tggttaccat gcaaacaact caacaaagca
121 ggttgacacg ataatggaga aaaacgtcac tgttacacat gcccaagaca tactggaaaa
181 gacacacaac gggaagctct gcgatcttaa tggagtgaag cccctgattc taaaggattg
241 tagcgtagct gggtggctcc ttggaaatcc aatgtgcgac gagttcatca gggtgccgga

301
361
421
481
541

atggtcttac atcgtggaga gggctaaccc agtcaacgac ctctgttacc cagggaccct caatgactat gaggaactga aacacctatt gagcagaata aatcattttg agaaaactct gatcatcccc aggagttctt ggcccaatca tgaaacatca ttaggggtga gcgcagcatg tccataccag ggagcatcct catttttcag aaatgtggta tggctcatca aaaagaacga tgcatacccg acaataaaga taagctacaa taataccaat cgggaagatc ttttgatact

601 gtgggggatt catcattcca acaatgcagc agagcagaca aatctctata aaaacccaga

















I I
LOCUS

661
721
781
841
901
961
1021
1081
1141
1201
1261
1321
1381
1441
1501
1561
1621
1681
1741

cacttatgtt tccgtgggga catcaacatt aaaccagaga ttggtgccaa aaatagctac
tagatcccaa gtaaacgggc aaagtggaag aatgggtttc ttctggacaa ttttaaaacc gaatgatgca atccactttg agagtaatgg aaatttcatt gctccagaat atgcatacaa aattgtcaag aaaggggact caacaattat gaaaagtgaa atggagtatg gccactgcaa caccaaatgt caaactccaa taggggcgat aaactctagc atgccattcc acaatataca ccctctcacc atcggggaat gccccaaata cgtgaagtca aacaaattag tccttgcgac tgggctcaga aatagtcctc taagagaaag aagaagaaaa agaggactat ttggagctat agcagggttt atagagggag gatggcaggg aatggtagac ggttggtatg ggtatcatca tagcaatgag caggggagtg ggtacgctgc agacaaagaa tccacccaaa aggcaataga tggagttacc aataaggtca actcaatcat tgacaaaatg aacactcaat ttgaggccgt tggaagggaa tttaataact tagaaaggag aatagagaat ttaaacaaga aaatggaaga cggattccta gatgtctgga cttataatgc tgaactttta gttctcatgg aaaatgagag aactctagat ttccatgact caaatgtcaa gaacctttac gacaaagtcc ggctacagct tagggataat gcaaaagagc tgggcaatgg ttgtttcgag ttctatcaca aatgtgataa cgaatgcatg gagagcgtaa gaaatgggac gtatgactac cctaagtatt cagaagaagc aatattaaaa agagaagaaa taagcggagt gaaattagaa tcaataggaa cttaccaaat actgtcaatt tattcaacag tggcgagttc cctagcactg gcaatcatag tggctggtct atctttatgg atgtgctcta atgggtcgtt acaatgcaga atttgcatct aaatttgtga gctcagattg tagttaaaaa cacccttgtt tctact

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Wed Feb 11, 2015 12:27 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
EPI553208 A/crane/Kagoshima/KU1/2014 (A/H5N8) segment 4 (HA) 3099.8 0.000000e+00 1694/1702 (99%)
EPI561570 A/Baikal teal/Korea/H96/2014 (A/H5N8) segment 4 (HA) 3064.7 0.000000e+00 1689/1704 (99%)
EPI561646 A/breeder duck/Korea/H249/2014 (A/H5N8) segment 4 (HA) 3059.2 0.000000e+00 1688/1704 (99%)
EPI561626 A/mallard/Korea/H207/2014 (A/H5N8) segment 4 (HA) 3059.2 0.000000e+00 1688/1704 (99%)
EPI561605 A/broiler duck/Korea/H145/2014 (A/H5N8) segment 4 (HA) 3059.2 0.000000e+00 1688/1704 (99%)
EPI561591 A/breeder duck/Korea/H128/2014 (A/H5N8) segment 4 (HA) 3059.2 0.000000e+00 1688/1704 (99%)
EPI561529 A/Baikal teal/Korea/H66/2014 (A/H5N8) segment 4 (HA) 3059.2 0.000000e+00 1688/1704 (99%)
EPI561508 A/bean goose/Korea/H53/2014 (A/H5N8) segment 4 (HA) 3059.2 0.000000e+00 1688/1704 (99%)
EPI561341 A/Baikal teal/Korea/H41/2014 (A/H5N8) segment 4 (HA) 3059.2 0.000000e+00 1688/1704 (99%)
EPI561674 A/bean goose/Korea/H328/2014 (A/H5N8) segment 4 (HA) 3053.6 0.000000e+00 1687/1704 (99%)
EPI561612 A/breeder duck/Korea/H158/2014 (A/H5N8) segment 4 (HA) 3053.6 0.000000e+00 1687/1704 (99%)
EPI561577 A/breeder chicken/Korea/H122/2014 (A/H5N8) segment 4 (HA) 3053.6 0.000000e+00 1687/1704 (99%)
EPI561563 A/Baikal teal/Korea/H84/2014 (A/H5N8) segment 4 (HA) 3053.6 0.000000e+00 1687/1704 (99%)
EPI561542 A/Baikal teal/Korea/H68/2014 (A/H5N8) segment 4 (HA) 3053.6 0.000000e+00 1687/1704 (99%)
EPI561522 A/broiler duck/Korea/H65/2014 (A/H5N8) segment 4 (HA) 3053.6 0.000000e+00 1687/1704 (99%)
EPI561705 A/bean goose/Korea/H40/2014 (A/H5N8) segment 4 (HA) 3048.1 0.000000e+00 1686/1704 (98%)
EPI561667 A/mallard/Korea/H297/2014 (A/H5N8) segment 4 (HA) 3048.1 0.000000e+00 1687/1705 (98%)
EPI561653 A/breeder chicken/Korea/H250/2014 (A/H5N8) segment 4 (HA) 3048.1 0.000000e+00 1686/1704 (98%)
EPI561633 A/white-fronted goose/Korea/H231/2014 (A/H5N8) segment 4 (HA) 3048.1 0.000000e+00 1686/1704 (98%)
EPI509704 A/broiler duck/Korea/Buan2/2014 (A/H5N8) segment 4 (HA) 3048.1 0.000000e+00 1686/1704 (98%)
EPI561697 A/spot-billed duck/Korea/H455-42/2014 (A/H5N8) segment 4 (HA) 3042.6 0.000000e+00 1685/1704 (98%)
EPI561681 A/tundra swan/Korea/H411/2014 (A/H5N8) segment 4 (HA) 3042.6 0.000000e+00 1685/1704 (98%)
EPI561660 A/Korean native chicken/Korea/H257/2014 (A/H5N8) segment 4 (HA) 3042.6 0.000000e+00 1685/1704 (98%)
EPI561598 A/broiler duck/Korea/H133/2014 (A/H5N8) segment 4 (HA) 3042.6 0.000000e+00 1685/1704 (98%)
EPI561360 A/broiler duck/Korea/H49/2014 (A/H5N8) segment 4 (HA) 3042.6 0.000000e+00 1685/1704 (98%)
EPI561348 A/broiler duck/Korea/H47/2014 (A/H5N8) segment 4 (HA) 3042.6 0.000000e+00 1685/1704 (98%)
EPI561336 A/broiler duck/Korea/H48/2014 (A/H5N8) segment 4 (HA) 3042.6 0.000000e+00 1685/1704 (98%)
EPI561204 A/broiler duck/Korea/H31/2014 (A/H5N8) segment 4 (HA) 3042.6 0.000000e+00 1685/1704 (98%)
EPI561196 A/broiler duck/Korea/H29/2014 (A/H5N8) segment 4 (HA) 3042.6 0.000000e+00 1685/1704 (98%)
EPI561187 A/waterfowl/Korea/S005/2014 (A/H5N8) segment 4 (HA) 3042.6 0.000000e+00 1685/1704 (98%)
EPI517161 A/Chicken/Kumamoto/1-7/2014 (A/H5N8) segment 4 (HA) 3042.6 0.000000e+00 1685/1704 (98%)
EPI561690 A/common teal/Korea/H455-30/2014 (A/H5N8) segment 4 (HA) 3037.0 0.000000e+00 1684/1704 (98%)
EPI561556 A/Coot/Korea/H81/2014 (A/H5N8) segment 4 (HA) 3037.0 0.000000e+00 1684/1704 (98%)
EPI561549 A/Baikal teal/Korea/H80/2014 (A/H5N8) segment 4 (HA) 3037.0 0.000000e+00 1684/1704 (98%)
EPI561515 A/Baikal teal/Korea/H62/2014 (A/H5N8) segment 4 (HA) 3037.0 0.000000e+00 1684/1704 (98%)
EPI509709 A/baikal teal/Korea/Donglim3/2014 (A/H5N8) segment 4 (HA) 3037.0 0.000000e+00 1684/1704 (98%)
EPI561619 A/breeder duck/Korea/H200/2014 (A/H5N8) segment 4 (HA) 3025.9 0.000000e+00 1683/1705 (98%)
EPI542628 A/mallard/Korea/W452/2014 (A/H5N8) segment 4 (HA) 3020.4 0.000000e+00 1681/1704 (98%)
EPI553349 A/wigeon/Sakha/1/2014 (A/H5N8) segment 4 (HA) 3014.9 0.000000e+00 1680/1704 (98%)
EPI550849 A/duck/England/36226/14 (A/H5N8) segment 4 (HA) 3009.3 0.000000e+00 1679/1704 (98%)
EPI550848 A/duck/England/36038/14 (A/H5N8) segment 4 (HA) 3009.3 0.000000e+00 1679/1704 (98%)
EPI547673 A/duck/England/36254/14 (A/H5N8) segment 4 (HA) 2998.2 0.000000e+00 1677/1704 (98%)
EPI552746 A/turkey/Germany/R2474-L00899/2014 (A/H5N8) segment 4 (HA) 2987.2 0.000000e+00 1675/1704 (98%)
EPI548493 A/duck/Chiba/26-372-61/2014 (A/H5N8) segment 4 (HA) 2987.2 0.000000e+00 1675/1704 (98%)
EPI548485 A/duck/Chiba/26-372-48/2014 (A/H5N8) segment 4 (HA) 2987.2 0.000000e+00 1675/1704 (98%)
EPI547678 A/Chicken/Netherlands/14015526/2014 (A/H5N8) segment 4 (HA) 2987.2 0.000000e+00 1675/1704 (98%)
EPI548623 A/chicken/Netherlands/14015531/2014 (A/H5N8) segment 4 (HA) 2981.6 0.000000e+00 1674/1704 (98%)
EPI553362 A/environment/Kagoshima/KU-ngr-H/2014 (A/H5N8) segment 4 (HA) 2976.1 0.000000e+00 1673/1704 (98%)
EPI553343 A/chicken/Miyazaki/7/2014 (A/H5N8) segment 4 (HA) 2976.1 0.000000e+00 1674/1705 (98%)
EPI544756 A/turkey/Germany-MV/R2472/2014 (A/H5N8) segment 4 (HA) 2965.0 0.000000e+00 1663/1692 (98%)
EPI552776 A/chicken/Netherlands/emc-3/2014 (A/H5N8) segment 4 (HA) 2941.0 0.000000e+00 1653/1683 (98%)
EPI552768 A/eurasian wigeon/Netherlands/emc-2/2014 (A/H5N8) segment 4 (HA) 2941.0 0.000000e+00 1659/1692 (98%)
EPI552760 A/eurasian wigeon/Netherlands/emc-1/2014 (A/H5N8) segment 4 (HA) 2904.1 0.000000e+00 1624/1650 (98%)
EPI551149 A/eurasian wigeon/Netherlands/emc-2/2014 (A/H5N8) segment 4 (HA) 2894.8 0.000000e+00 1634/1667 (98%)
EPI543010 A/duck/Beijing/CT01/2014 (A/H5N8) segment 4 (HA) 2837.6 0.000000e+00 1584/1608 (98%)
EPI551143 A/eurasian wigeon/Netherlands/emc-1/2014 (A/H5N8) segment 4 (HA) 2832.0 0.000000e+00 1585/1611 (98%)
EPI543002 A/duck/Beijing/FS01/2014 (A/H5N8) segment 4 (HA) 2826.5 0.000000e+00 1583/1609 (98%)
EPI542617 A/duck/Beijing/FS01/2013 (A/H5N8) segment 4 (HA) 2821.0 0.000000e+00 1580/1608 (98%)
EPI442017 A/duck/Jiangsu/k1203/2010 (A/H5N8) segment 4 (HA) 2821.0 0.000000e+00 1648/1707 (96%)
EPI475579 A/wild duck/Shandong/628/2011 (A/H5N1) segment 4 (HA) 2815.4 0.000000e+00 1648/1708 (96%)
EPI399960 A/duck/Jiangsu/m234/2012 (A/H5N2) segment 4 (HA) 2776.6 0.000000e+00 1642/1709 (96%)
EPI398966 A/goose/Eastern China/1112/2011 (A/H5N2) segment 4 (HA) 2776.6 0.000000e+00 1641/1708 (96%)
EPI431456 A/duck/Hebei/3/2011 (A/H5N2) segment 4 (HA) 2765.6 0.000000e+00 1639/1708 (95%)
EPI398965 A/duck/Eastern China/1111/2011 (A/H5N2) segment 4 (HA) 2760.0 0.000000e+00 1638/1708 (95%)
EPI530054 A/duck/Jiangxi/95/2014 (A/H5N6) segment 4 (HA) 2748.9 0.000000e+00 1635/1707 (95%)
EPI544892 A/duck/Shandong/Q1/2013 (A/H5N8) segment 4 (HA) 2743.4 0.000000e+00 1637/1710 (95%)
EPI531456 A/duck/Guangdong/GD01/2014 (A/H5N6) segment 4 (HA) 2743.4 0.000000e+00 1634/1707 (95%)
EPI509698 A/breeder duck/Korea/Gochang1/2014 (A/H5N8) segment 4 (HA) 2743.4 0.000000e+00 1635/1708 (95%)
EPI561495 A/Baikal teal/Korea/H52/2014 (A/H5N8) segment 4 (HA) 2732.3 0.000000e+00 1633/1708 (95%)
EPI530985 A/duck/Zhejiang/W24/2013 (A/H5N8) segment 4 (HA) 2732.3 0.000000e+00 1631/1706 (95%)
EPI507673 A/mallard duck/Shanghai/SH-9/2013 (A/H5N8) segment 4 (HA) 2726.8 0.000000e+00 1631/1707 (95%)
EPI530063 A/environment/Shenzhen/25-24/2013 (A/H5N6) segment 4 (HA) 2721.2 0.000000e+00 1630/1707 (95%)
EPI553144 A/turkey/Italy/14VIR7898-10/2014 (A/H5N8) segment 4 (HA) 2717.5 0.000000e+00 1520/1545 (98%)
EPI530986 A/duck/Zhejiang/6D18/2013 (A/H5N8) segment 4 (HA) 2715.7 0.000000e+00 1630/1708 (95%)
EPI550768 A/duck/Laos/XBY004/2014 (A/H5N6) segment 4 (HA) 2710.2 0.000000e+00 1629/1708 (95%)
EPI550763 A/duck/Laos/XBY004/2014 (A/H5N6) segment 4 (HA) 2710.2 0.000000e+00 1629/1708 (95%)
EPI550759 A/chicken/Laos/XBY003/2014 (A/H5N6) segment 4 (HA) 2710.2 0.000000e+00 1629/1708 (95%)
EPI550757 A/duck/Laos/LPQ002/2014 (A/H5N6) segment 4 (HA) 2710.2 0.000000e+00 1629/1708 (95%)
EPI493825 A/duck/Guangdong/wy19/2008 (A/H5N5) segment 4 (HA) 2710.2 0.000000e+00 1630/1709 (95%)
EPI550752 A/chicken/Laos/LPQ001/2014 (A/H5N6) segment 4 (HA) 2704.6 0.000000e+00 1628/1708 (95%)
EPI499478 A/chicken/China/AH/2012 (A/H5N1) segment 4 (HA) 2699.1 0.000000e+00 1626/1707 (95%)
EPI431448 A/duck/Hebei/2/2011 (A/H5N2) segment 4 (HA) 2695.4 0.000000e+00 1627/1709 (95%)
EPI493817 A/duck/Guangdong/wy11/2008 (A/H5N5) segment 4 (HA) 2688.0 0.000000e+00 1627/1710 (95%)
EPI328878 A/duck/Eastern China/031/2009 (A/H5N5) segment 4 (HA) 2654.8 0.000000e+00 1619/1708 (94%)
EPI328870 A/duck/Eastern China/008/2008 (A/H5N5) segment 4 (HA) 2627.1 0.000000e+00 1615/1709 (94%)
EPI328886 A/duck/Eastern China/108/2008 (A/H5N1) segment 4 (HA) 2621.5 0.000000e+00 1614/1709 (94%)
EPI533583 A/Sichuan/26221/2014 (A/H5N6) segment 4 (HA) 2616.0 0.000000e+00 1614/1710 (94%)
EPI493833 A/duck/Guangdong/wy24/2008 (A/H5N5) segment 4 (HA) 2612.3 0.000000e+00 1615/1712 (94%)
EPI442025 A/quail/Jiangsu/k0104/2010 (A/H5N5) segment 4 (HA) 2612.3 0.000000e+00 1615/1712 (94%)
EPI547402 A/environment/Zhenjiang/C13/2013 (A/H5N6) segment 4 (HA) 2610.4 0.000000e+00 1614/1711 (94%)
EPI442001 A/goose/Shandong/k1204/2009 (A/H5N5) segment 4 (HA) 2566.1 0.000000e+00 1603/1708 (93%)
EPI442009 A/goose/Guangdong/k0103/2010 (A/H5N5) segment 4 (HA) 2556.9 0.000000e+00 1604/1711 (93%)
EPI127384 A/wild duck/Hunan/021/2005 (A/H5N1) segment 4 (HA) 2505.2 0.000000e+00 1593/1709 (93%)
EPI275982 A/duck/Hubei/49/2005 (A/H5N1) segment 4 (HA) 2499.6 0.000000e+00 1593/1710 (93%)
EPI227309 A/Mallard/Huadong/lk/2005 (A/H5N1) segment 4 (HA) 2499.6 0.000000e+00 1591/1708 (93%)
EPI127406 A/wild duck/Hunan/211/2005 (A/H5N1) segment 4 (HA) 2499.6 0.000000e+00 1592/1709 (93%)
EPI107769 A/duck/Guangxi/288/2006 (A/H5N1) segment 4 (HA) 2499.6 0.000000e+00 1586/1700 (93%)
EPI439897 A/goose/Guangdong/08/2005 (A/H5N1) segment 4 (HA) 2497.8 0.000000e+00 1592/1709 (93%)
EPI399886 A/duck/HuBei/03/2010 (A/H5N5) segment 4 (HA) 2494.1 0.000000e+00 1592/1710 (93%)
EPI279949 A/Zhejiang/1/2006 (A/H5N1) segment 4 (HA) 2494.1 0.000000e+00 1591/1709 (93%)

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Wed Feb 11, 2015 12:31 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
6 1467 bp mRNA linear 10-FEB -2015

DEFINITION

ACCESSION VERSION KEYWORDS SOURCE

Influenza A virus (A/Goose/Taiwan/0104/2015(HSN2)) neuraminidase
(NA) gene, complete eds.



Viruses; ssRNA negative-strand viruses; Orthomyxoviridae ; Influenzavirus A .

ORGANISM Viruses ; ssRNA negative-strand viruses ; Orthomyxoviridae; Influenzavirus A .
Unclassified.
REFERENCE 1 (bases 1 to 1467)
AUTHORS Lee,M. S . , Chen,L.H. , Liu, Y .P . , Chen , Y.P. , Li , W .C., Lee, F . ,
Ting , L.J . and Lin,Y .L .
TITLE Avian influenza subtype HS in geese in Taiwan , 2015 JOURNAL Unpublished
REFERENCE 2 (bases 1 to 1467)
AUTHORS Lee,M.S. , Chen , L.H. , Liu , Y .P. , Chen , Y. P. , Li ,W.C. , Lee, F. ,
Ting , L.J. and Lin,Y.L . TITLE Direct Submission
JOURNAL Submitted (10-FEB-2015) Epidemiology Research Department , National Institute for Animal Health, Chung- Cheng Rd , Tansui, Taiwan 251 , Taiwan
COMMENT ##Assembly-Data-START##
Sequencing Technology : : Sanger dideoxy sequencing
##Assembly-Data-END##
FEATURES Location/Qualifiers source 1 ..1467
/organism= "Viruses; ssRNA negative-strand viruses; Orthomyxoviridae; Influenzavirus A. "
/mol type= "mRNA "
/strain= "A/Goose/Taiwan/0104/2015 "
/isolation_source= "organ"
/host= "Goose"
/segment= 11 611
/country= "Taiwan"
/collected by= " 2015-01-09 "
/identified by= "RT- PCR "
/subtype= "HSN2 "

gene CDS

1 . .1467
/gene= "NA " 20 . .1429
/gene= "NA "
/codon_ start=l
/product= "neuraminidase "
/translation= "MNPNQKIITIGSVSLTIATVCFLMQIAILATTVTLHFKQNECSI PSNNQVVPCEPIIIERNITEIVYLNNTIIEKELCPKLAEYRDWSKPQCQITGFAPFSK DNSIRLSAGGDIWVTREPYVSCSPNKCYQFALGQGTTLDNKHSNGTIHDRIPHRTLLM NELGV PFHLGTKQVC IAWSSSSCHDGRVWLH ICVTGDDRNATASFIYNGVLVDS ISSW SQNILRTQESECVCINGTCTVVMTDGSASGRADTRVLFIKEGKIVHISPLSGSAQHIE ECSCYPRYPDVRCVCRDNWKGSNRPVIDISMADYSIDSSYVCSGLVGDTPRNDDSSSN




BASE COUNT ORIGIN

SNCKDPNNERGSPGVKGWAFDYGNDVWMGRTISKDSRSGYETFRVIEGWTTANSKSQV NRQVIVDNNNWSGYSGIFSVKGKSCINRCFYVELIRGRPQETRVWWTSNSIVVFCGTS GTYGTGSWPDGANINFMPI"
465 a 275 c 341 g 386 t

1 agcaaaagca ggagagaaga tgaacccaaa ccagaagata ataacaattg gctctgtctc
61 tctaaccatt gcaacagtat gtttcctcat gcaaattgcc atcctagcaa cgactgtaac
121 actgcacttc aagcagaatg aatgcagcat tccctcgaac aatcaagtag tgccatgtga
181 gccaatcata atagaaagga acataacaga gatagtgtat ttgaataaca ccatcataga
241 aaaagaactt tgccctaaat tggcagaata cagggactgg tcgaaaccac agtgtcagat
301 cacagggttt gctcctttct ccaaggacaa ctcaatccga ctttctgctg gtggggacat
361 ttgggtaaca agagaacctt atgtatcatg cagtcccaat aaatgttatc agtttgcact
421 cggtcaggga accacgctag acaacaaaca ttcaaatggc acaatacatg atagaattcc
481 ccatcgaacc cttttaatga acgagttggg tgttccattc catttgggga ccaaacaagt
541 gtgcatagca tggtcaagct caagctgcca tgatggaaga gtatggctac acatttgtgt 601 tactggggat gacaggaatg caaccgccag tttcatttat aatggggtgc ttgttgacag 661 tattagttca tggtctcaaa acattctcag aactcaggag tcagagtgcg tctgcatcaa 721 tggaacttgt acagtagtaa tgactgatgg aagtgcatca ggaagggccg atactagagt 781 actattcatt aaagagggga aaattgttca tatcagtcca ttatcaggaa gtgctcagca 841 tatagaggag tgttcctgtt atccccgcta tccagacgtc agatgtgtct gcagagacaa 901 ttggaaaggt tcaaataggc ccgttataga tataagtatg gcagattata gcattgattc 961 tagttatgtg tgctcagggc ttgttggaga cacaccgaga aacgatgata gctctagcaa 1021 tagtaactgc aaggatccta ataatgagag agggagccca ggagtaaaag ggtgggcatt 1081 tgactatgga aatgatgttt ggatgggaag aacaatcagc aaggattctc gctcaggtta 1141 tgagaccttc agagtcattg aaggttggac aacagctaat tccaaatctc aagtaaatag 1201 acaagtcata gttgacaata ataactggtc tggttattcc ggcattttct ctgttaaagg 1261 taaaagctgc atcaataggt gtttttatgt ggagttgata agaggaaggc cacaagagac 1321 tagagtgtgg tggacctcaa acagtattgt tgtgttctgt ggaacttcag gtacttatgg 1381 aacaggctca tggcctgatg gggcgaatat caattttatg cctatataag ctttcgcaat
1441 tttagaaaaa aactccttgt ttctact

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Wed Feb 11, 2015 12:34 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
EPI401809 A/green-winged teal/Xianghai/430/2011 (A/H5N2) segment 6 (NA) 2422.1 0.000000e+00 1377/1410 (97%)
EPI401802 A/little grebe/Xianghai/429/2011 (A/H5N2) segment 6 (NA) 2422.1 0.000000e+00 1377/1410 (97%)
EPI485359 A/ruddy shelduck/Mongolia/590C2/2009 (A/H11N2) segment 6 (NA) 2416.5 0.000000e+00 1376/1410 (97%)
EPI357829 A/duck/Mongolia/OIE-7799/2011 (A/H3N2) segment 6 (NA) 2416.5 0.000000e+00 1376/1410 (97%)
EPI401793 A/canvasback/Xianghai/428/2011 (A/H5N2) segment 6 (NA) 2411.0 0.000000e+00 1375/1410 (97%)
EPI401786 A/spot-billed duck/Xianghai/427/2011 (A/H5N2) segment 6 (NA) 2411.0 0.000000e+00 1375/1410 (97%)
EPI401779 A/baikal teal/Xianghai/426/2011 (A/H5N2) segment 6 (NA) 2405.5 0.000000e+00 1374/1410 (97%)
EPI506486 A/duck/Thailand/CU-12326T/2012 (A/H11N2) segment 6 (NA) 2394.4 0.000000e+00 1372/1410 (97%)
EPI272252 A/duck/Korea/A14/2008 (A/H5N2) segment 6 (NA) 2372.2 0.000000e+00 1368/1410 (97%)
EPI341928 A/chicken/Korea/KNUWSJ09/2009 (A/H9N2) segment 6 (NA) 2366.7 0.000000e+00 1367/1410 (96%)
EPI341896 A/chicken/Korea/KNUSWR09/2009 (A/H9N2) segment 6 (NA) 2366.7 0.000000e+00 1367/1410 (96%)
EPI272250 A/wild bird/Korea/A81/2009 (A/H5N2) segment 6 (NA) 2366.7 0.000000e+00 1367/1410 (96%)
EPI399701 A/duck/Japan/9UO025/2009 (A/H5N2) segment 6 (NA) 2361.1 0.000000e+00 1366/1410 (96%)
EPI399694 A/duck/Japan/9UO139/2009 (A/H5N2) segment 6 (NA) 2361.1 0.000000e+00 1366/1410 (96%)
EPI399688 A/duck/Japan/9UO036/2009 (A/H5N2) segment 6 (NA) 2361.1 0.000000e+00 1366/1410 (96%)
EPI272253 A/duck/Korea/A93/2008 (A/H5N2) segment 6 (NA) 2361.1 0.000000e+00 1366/1410 (96%)
EPI559937 A/wild bird/Jilin/SJ95/2012 (A/H9N2) segment 6 (NA) 2355.6 0.000000e+00 1365/1410 (96%)
EPI461573 A/duck/Hunan/S11313/2012 (A/H4N2) segment 6 (NA) 2355.6 0.000000e+00 1365/1410 (96%)
EPI341888 A/duck/Korea/KNUDPJ09/2009 (A/H9N2) segment 6 (NA) 2355.6 0.000000e+00 1365/1410 (96%)
EPI314541 A/avian/Japan/8KI0148/2008 (A/H4N2) segment 6 (NA) 2355.6 0.000000e+00 1365/1410 (96%)
EPI262572 A/aquatic bird/Korea/w217/2007 (A/H5N2) segment 6 (NA) 2355.6 0.000000e+00 1360/1402 (97%)
EPI262571 A/aquatic bird/Korea/w216/2007 (A/H5N2) segment 6 (NA) 2355.6 0.000000e+00 1365/1410 (96%)
EPI258993 A/aquatic bird/Korea/w347/2008 (A/H5N2) segment 6 (NA) 2355.6 0.000000e+00 1366/1411 (96%)
EPI258991 A/aquatic bird/Korea/w344/2008 (A/H5N2) segment 6 (NA) 2355.6 0.000000e+00 1365/1410 (96%)
EPI417484 A/duck/Guangxi/GXd-2/2010 (A/H6N2) segment 6 (NA) 2350.1 0.000000e+00 1364/1410 (96%)
EPI404180 A/duck/Vietnam/OIE-2530/2011 (A/H4N2) segment 6 (NA) 2350.1 0.000000e+00 1364/1410 (96%)
EPI341920 A/chicken/Korea/KNUGJ09/2009 (A/H9N2) segment 6 (NA) 2350.1 0.000000e+00 1364/1410 (96%)
EPI300914 A/duck/Korea/SH0912/2009 (A/H9N2) segment 6 (NA) 2350.1 0.000000e+00 1362/1407 (96%)
EPI300913 A/chicken/Korea/SH0911/2009 (A/H9N2) segment 6 (NA) 2350.1 0.000000e+00 1362/1407 (96%)
EPI300910 A/duck/Korea/SH0908/2009 (A/H9N2) segment 6 (NA) 2350.1 0.000000e+00 1362/1407 (96%)
EPI300909 A/chicken/Korea/SH0907/2009 (A/H9N2) segment 6 (NA) 2350.1 0.000000e+00 1362/1407 (96%)
EPI300908 A/chicken/Korea/SH0906/2009 (A/H9N2) segment 6 (NA) 2350.1 0.000000e+00 1362/1407 (96%)
EPI272248 A/chicken/Korea/A170/2009 (A/H9N2) segment 6 (NA) 2350.1 0.000000e+00 1354/1395 (97%)
EPI262577 A/aquatic bird/Korea/w230/2007 (A/H5N2) segment 6 (NA) 2350.1 0.000000e+00 1364/1410 (96%)
EPI262576 A/aquatic bird/Korea/w229/2007 (A/H5N2) segment 6 (NA) 2350.1 0.000000e+00 1364/1410 (96%)
EPI262565 A/aquatic bird/Korea/w202/2007 (A/H5N2) segment 6 (NA) 2350.1 0.000000e+00 1364/1410 (96%)
EPI300917 A/duck/Korea/SH0915/2009 (A/H9N2) segment 6 (NA) 2348.2 0.000000e+00 1361/1406 (96%)
EPI300916 A/chicken/Korea/SH0914/2009 (A/H9N2) segment 6 (NA) 2348.2 0.000000e+00 1361/1406 (96%)
EPI300915 A/chicken/Korea/SH0913/2009 (A/H9N2) segment 6 (NA) 2348.2 0.000000e+00 1361/1406 (96%)
EPI300904 A/chicken/Korea/SH0902/2009 (A/H9N2) segment 6 (NA) 2348.2 0.000000e+00 1361/1406 (96%)
EPI258995 A/aquatic bird/Korea/w351/2008 (A/H5N2) segment 6 (NA) 2344.5 0.000000e+00 1364/1411 (96%)
EPI272247 A/chicken/Korea/A146/2009 (A/H9N2) segment 6 (NA) 2340.8 0.000000e+00 1349/1390 (97%)
EPI493028 A/wild waterfowl/Dongting/C2383/2012 (A/H1N2) segment 6 (NA) 2339.0 0.000000e+00 1362/1410 (96%)
EPI406483 A/baikal teal/Xianghai/421/2011 (A/H9N2) segment 6 (NA) 2339.0 0.000000e+00 1362/1410 (96%)
EPI272249 A/duck/Korea/A174/2009 (A/H9N2) segment 6 (NA) 2337.1 0.000000e+00 1351/1394 (96%)
EPI439806 A/white-fronted goose/Korea/20-36/2007 (A/H9N2) segment 6 (NA) 2327.9 0.000000e+00 1360/1410 (96%)
EPI335406 A/aquatic bird/Korea/CN17/2009 (A/H6N2) segment 6 (NA) 2327.9 0.000000e+00 1355/1402 (96%)
EPI335313 A/Korean native chicken/Korea/K040110/2010 (A/H9N2) segment 6 (NA) 2322.4 0.000000e+00 1360/1411 (96%)
EPI300911 A/duck/Korea/SH0909/2009 (A/H9N2) segment 6 (NA) 2322.4 0.000000e+00 1357/1407 (96%)
EPI398854 A/duck/Shanghai/28-1/2009 (A/H4N2) segment 6 (NA) 2316.8 0.000000e+00 1360/1412 (96%)
EPI377586 A/mallard/Sweden/58451/2006 (A/H2N2) segment 6 (NA) 2316.8 0.000000e+00 1358/1410 (96%)
EPI314508 A/duck/Guangxi/912/2008 (A/H4N2) segment 6 (NA) 2316.8 0.000000e+00 1360/1412 (96%)
EPI262560 A/aquatic bird/Korea/w164/2007 (A/H5N2) segment 6 (NA) 2316.8 0.000000e+00 1354/1404 (96%)
EPI262551 A/aquatic bird/Korea/w96/2005 (A/H5N2) segment 6 (NA) 2316.8 0.000000e+00 1358/1410 (96%)
EPI457889 A/chicken/Guangxi/GXc-1/2011 (A/H1N2) segment 6 (NA) 2311.3 0.000000e+00 1357/1410 (96%)
EPI363521 A/duck/Guizhou/1084/2006 (A/H6N2) segment 6 (NA) 2311.3 0.000000e+00 1357/1410 (96%)
EPI262570 A/aquatic bird/Korea/w211/2007 (A/H5N2) segment 6 (NA) 2311.3 0.000000e+00 1358/1411 (96%)
EPI262559 A/aquatic bird/Korea/w163/2007 (A/H5N2) segment 6 (NA) 2311.3 0.000000e+00 1353/1404 (96%)
EPI393269 A/mallard/Korea/KU683/2008 (A/H5N2) segment 6 (NA) 2307.6 0.000000e+00 1337/1381 (96%)
EPI392674 A/duck/Korea/A349/09 (A/H7N2) segment 6 (NA) 2307.6 0.000000e+00 1343/1390 (96%)
EPI262575 A/aquatic bird/Korea/w222/2007 (A/H5N2) segment 6 (NA) 2305.7 0.000000e+00 1356/1410 (96%)
EPI377578 A/mallard/Sweden/58112/2006 (A/H2N2) segment 6 (NA) 2300.2 0.000000e+00 1355/1410 (96%)
EPI300918 A/chicken/Korea/HC0410/2009 (A/H9N2) segment 6 (NA) 2300.2 0.000000e+00 1355/1410 (96%)
EPI371550 A/duck/Vietnam/OIE-3321/2011 (A/H6N2) segment 6 (NA) 2294.7 0.000000e+00 1354/1410 (96%)
EPI262569 A/aquatic bird/Korea/w208/2007 (A/H5N2) segment 6 (NA) 2294.7 0.000000e+00 1354/1410 (96%)
EPI222089 A/garganey/Altai/1213/2007 (A/H5N2) segment 6 (NA) 2294.7 0.000000e+00 1354/1410 (96%)
EPI222049 A/gadwall/Altai/1202/2007 (A/H5N2) segment 6 (NA) 2294.7 0.000000e+00 1354/1410 (96%)
EPI463589 A/tundra swan/Shimane/3211A001/2011 (A/H5N2) segment 6 (NA) 2289.1 0.000000e+00 1353/1410 (95%)
EPI457921 A/duck/Guangxi/GXd-2/2012 (A/H1N2) segment 6 (NA) 2289.1 0.000000e+00 1353/1410 (95%)
EPI262580 A/aquatic bird/Korea/w235/2007 (A/H5N2) segment 6 (NA) 2289.1 0.000000e+00 1353/1410 (95%)
EPI262567 A/aquatic bird/Korea/w205/2007 (A/H5N2) segment 6 (NA) 2289.1 0.000000e+00 1353/1410 (95%)
EPI262562 A/aquatic bird/Korea/w193/2007 (A/H5N2) segment 6 (NA) 2289.1 0.000000e+00 1349/1404 (96%)
EPI262558 A/aquatic bird/Korea/w161/2007 (A/H5N2) segment 6 (NA) 2289.1 0.000000e+00 1345/1398 (96%)
EPI262581 A/aquatic bird/Korea/w236/2007 (A/H5N2) segment 6 (NA) 2283.6 0.000000e+00 1348/1404 (96%)
EPI262579 A/aquatic bird/Korea/w234/2007 (A/H5N2) segment 6 (NA) 2283.6 0.000000e+00 1352/1410 (95%)
EPI262561 A/aquatic bird/Korea/w191/2007 (A/H5N2) segment 6 (NA) 2283.6 0.000000e+00 1352/1410 (95%)
EPI262555 A/aquatic bird/Korea/w121/2006 (A/H5N2) segment 6 (NA) 2283.6 0.000000e+00 1352/1410 (95%)
EPI182381 A/mallard/Xuyi/10/2005 (A/H5N2) segment 6 (NA) 2283.6 0.000000e+00 1352/1410 (95%)
EPI181910 A/duck/Shimane/19/2006 (A/H5N2) segment 6 (NA) 2283.6 0.000000e+00 1352/1410 (95%)
EPI161528 A/duck/Hokkaido/W87/2007 (A/H10N2) segment 6 (NA) 2283.6 0.000000e+00 1352/1410 (95%)
EPI119089 A/garganey/SanJiang/160/2006 (A/H5N2) segment 6 (NA) 2283.6 0.000000e+00 1352/1410 (95%)
EPI262573 A/aquatic bird/Korea/w218/2007 (A/H5N2) segment 6 (NA) 2281.7 0.000000e+00 1347/1403 (96%)
EPI268188 A/mallard/Jiangxi/8264/2004 (A/H6N2) segment 6 (NA) 2278.0 0.000000e+00 1351/1410 (95%)
EPI262568 A/aquatic bird/Korea/w206/2007 (A/H5N2) segment 6 (NA) 2278.0 0.000000e+00 1347/1404 (95%)
EPI262553 A/aquatic bird/Korea/w114/2006 (A/H5N2) segment 6 (NA) 2278.0 0.000000e+00 1347/1404 (95%)
EPI182379 A/spotbill duck/Xuyi/6/2005 (A/H11N2) segment 6 (NA) 2278.0 0.000000e+00 1351/1410 (95%)
EPI181911 A/duck/Shimane/02/2007 (A/H5N2) segment 6 (NA) 2278.0 0.000000e+00 1351/1410 (95%)
EPI181648 A/duck/Tsukuba/9/2005 (A/H5N2) segment 6 (NA) 2278.0 0.000000e+00 1351/1410 (95%)
EPI118050 A/duck/Jiang Xi/1286/2005 (A/H5N2) segment 6 (NA) 2274.3 0.000000e+00 1347/1405 (95%)
EPI441017 A/duck/Hokkaido/WZ68/2012 (A/H13N2) segment 6 (NA) 2272.5 0.000000e+00 1350/1410 (95%)
EPI262578 A/aquatic bird/Korea/w231/2007 (A/H5N2) segment 6 (NA) 2272.5 0.000000e+00 1350/1410 (95%)
EPI262574 A/aquatic bird/Korea/w221/2007 (A/H5N2) segment 6 (NA) 2272.5 0.000000e+00 1349/1408 (95%)
EPI262552 A/aquatic bird/Korea/w113/2006 (A/H5N2) segment 6 (NA) 2272.5 0.000000e+00 1346/1404 (95%)
EPI182378 A/spotbill duck/Xuyi/18/2005 (A/H5N2) segment 6 (NA) 2272.5 0.000000e+00 1350/1410 (95%)
EPI181912 A/duck/Niigata/477/2007 (A/H5N2) segment 6 (NA) 2272.5 0.000000e+00 1351/1411 (95%)
EPI173576 A/swine/Korea/C13/2008 (A/H5N2) segment 6 (NA) 2272.5 0.000000e+00 1350/1410 (95%)
EPI122741 A/mallard/SanJiang/113/2006 (A/H6N2) segment 6 (NA) 2272.5 0.000000e+00 1350/1410 (95%)
EPI393259 A/bean goose/Korea/EG16/2006 (A/H5N2) segment 6 (NA) 2268.8 0.000000e+00 1330/1381 (96%)
EPI118064 A/duck/Jiang Xi/3345/2005 (A/H5N2) segment 6 (NA) 2268.8 0.000000e+00 1346/1405 (95%)
EPI544768 A/environment/Shanghai/LPM1/2013 (A/H3N2) segment 6 (NA) 2267.0 0.000000e+00 1349/1410 (95%)

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Wed Feb 11, 2015 12:37 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
7 1027 bp mRNA linear 10-FEB- 2015
DEFINITION Influenza A virus (A/Goose/Taiwan/0104/2015(HSN2)) matrix protein 2 (M2) and matrix protein 1 (Ml) genes , complete eds.

ACCESSION VERSION KEYWORDS SOURCE

ORGANISM


REFERENCE




Viruses; ssRNA negative-strand viru ses ; Orthomy xoviridae; Influenzavirus A .
Viruses; ssRNA negativ e-strand v iruses; Orthomy xov iridae ; Influenzavirus A.
Unclassified .
1 (bases 1 to 1027)

AUTHORS Lee,M.S. , Chen , L .H. , Liu,Y. P. , Chen,Y.P. , Li,W.C. , Lee,F. ,
Ting,L.J. and Lin , Y.L.
TITLE Avian influenza subtype HS in geese in Taiwan, 2015 JOURNAL Unpublished
REFERENCE 2 (bases 1 to 1027)
AUTHORS Lee , M. S. , Chen , L.H . , Liu , Y.P. , Chen, Y. P . , Li,W.C. , Lee, F . ,
Ting , L.J . and Lin ,Y.L. TITLE Direct Submission
JOURNAL Submitted (10-FEB-2015) Epidemiology Research Department, National Institute for Animal Health , Chung- Cheng Rd, Tansui, Taiwan 251, Taiwan
COMMENT ##Assembly-Data-START##
Sequencing Technology : : Sanger dideoxy sequencing
##Assembly-Data-END##
FEATURES Location/Qualifiers source 1 . .1027
/organism= "Viruse s; ssRNA negative-strand viru ses; Orthomyxoviridae; Influenzaviru s A ."
/mol type="mRNA "
/strain= "A/Goose/Taiwan/0104/2015"
/isolation source= "organ"
/host= "Goose"
/segment= " 7"
/country= "Taiwan"
/collected by= "2015-01-09"
/identified_by= "RT- PCR"
/subtype= "H5N2 "

gene CDS

1. .1027
/gene= "Ml" 20 . .784
/gene= "Ml "
/codon_start = l
/product= "matrix protein l"







gene CDS




BASE COUNT
ORIGIN

/translation= "­ KMSLLTEVETYVLSIIPSGPLKAEIAQRLEDVFAGKNTDLEALMEWLKTRPILSPLTK GILGFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDKAVKLYKK LKREITFHGAKEV ALSYSTGALASCMGLIYNRMGTVTTEVAFGLVCATCEQIADSQHRSHRQMATITNPLI RHENRMVLASTTAKAMEQMAGSSEQASEAMEVAKQARQMVQAMRTIGTHPNSSAGLRD NLLENLQAYQNRMGVQMQRFK"
26 . .1007
/gene= "M 2 "
join(26 ..51,740 . . 1007)
/gene= "M 2 "
/codon_ start= l
/product= "matrix protein 2 "
/translation= "MSLLTEVETPTRTEWECRCSDSSDPLVVAANIIGILHLILWILD RLFFKCIYRRLKYGLKIGPSTEGVPESMREEYRQEQQSAVDVDDGHFVNIELE "
•-•- 294 a 221 c 270 g 242 t

1
61
121
181
241
301
361
421
481
541

agcaaaagca ggtagatgtt gaaagatgag tcttctaacc gaggtcgaaa cgtacgttct ctctatcatc ccgtcaggcc ccctcaaagc cgagatcgcg cagagacttg aagatgtctt tgcagggaaa aacaccgatc tcgaggctct catggagtgg ctaaagacaa gaccaatcct gtcacctctg actaaaggga ttttgggatt tgtgttcacg ctcaccgtgc ccagtgagcg aggactgcag cgtagacgct tcgtccagaa tgccctaaat ggaaatgggg atccaaataa tatggataag gcagttaagc tatataagaa gctgaaaaga gagataacat tccatggggc taaggaggtc gcacttagct actcaaccgg tgcacttgcc agctgcatgg gtctcatata caacaggatg ggaacggtga ctacagaagt ggcttttggc ctagtgtgtg ccacttgtga gcagattgca gattcacagc atcggtccca cagacagatg gcaaccatca ccaacccatt aatcagacat gagaacagaa tggtgctggc cagcactaca gctaaggcca tggagcagat

601 ggcaggatca agcgagcagg catcagaagc catggaggtt gctaaacagg ccaggcagat 661 ggtacaggca atgaggacaa ttgggactca tcctaattct agtgctggtc tgagagataa






I I
LOCUS

721
781
841
901
961
1021

tcttcttgaa aatttgcagg cctaccagaa ccgaatggga gtgcagatgc agcgattcaa gtgatcctct tgttgttgcc gcaaatatca ttgggatcct gcacttgata ttgtggatcc ttgatcgtct tttcttcaaa tgcatttatc gtcgccttaa atacggtttg aaaatagggc cttctacgga aggggtacct gagtctatga gggaagagta ccggcaggaa cagcagagtg ctgtggatgt tgacgatggt cattt tgtca acatagaatt ggagtaaaaa actaccttgt ttctact

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Wed Feb 11, 2015 12:41 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
EPI561700 A/spot-billed duck/Korea/H455-42/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI561693 A/common teal/Korea/H455-30/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI561684 A/tundra swan/Korea/H411/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI561677 A/bean goose/Korea/H328/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI561670 A/mallard/Korea/H297/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI561656 A/breeder chicken/Korea/H250/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI561649 A/breeder duck/Korea/H249/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI561636 A/white-fronted goose/Korea/H231/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI561629 A/mallard/Korea/H207/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI561622 A/breeder duck/Korea/H200/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI561601 A/broiler duck/Korea/H133/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI561594 A/breeder duck/Korea/H128/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI561580 A/breeder chicken/Korea/H122/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI561573 A/Baikal teal/Korea/H96/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI561566 A/Baikal teal/Korea/H84/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI561559 A/Coot/Korea/H81/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI561552 A/Baikal teal/Korea/H80/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI561532 A/Baikal teal/Korea/H66/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI561525 A/broiler duck/Korea/H65/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI561511 A/bean goose/Korea/H53/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI561351 A/broiler duck/Korea/H47/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI561344 A/Baikal teal/Korea/H41/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI561211 A/broiler duck/Korea/H31/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI561199 A/broiler duck/Korea/H29/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI561190 A/waterfowl/Korea/S005/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI553211 A/crane/Kagoshima/KU1/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI542633 A/mallard/Korea/W452/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI517164 A/Chicken/Kumamoto/1-7/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI509756 A/baikal teal/Korea/Donglim3/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI509711 A/broiler duck/Korea/Buan2/2014 (A/H5N8) segment 7 (MP) 1803.5 0.000000e+00 980/982 (99%)
EPI561708 A/bean goose/Korea/H40/2014 (A/H5N8) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI561663 A/Korean native chicken/Korea/H257/2014 (A/H5N8) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI561615 A/breeder duck/Korea/H158/2014 (A/H5N8) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI561608 A/broiler duck/Korea/H145/2014 (A/H5N8) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI561545 A/Baikal teal/Korea/H68/2014 (A/H5N8) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI561518 A/Baikal teal/Korea/H62/2014 (A/H5N8) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI561363 A/broiler duck/Korea/H49/2014 (A/H5N8) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI561356 A/broiler duck/Korea/H48/2014 (A/H5N8) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI554603 A/turkey/Germany-NI/R3372/2014 (A/H5N8) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI553346 A/chicken/Miyazaki/7/2014 (A/H5N8) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI552749 A/turkey/Germany/R2474-L00899/2014 (A/H5N8) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI548627 A/chicken/Netherlands/14015531/2014 (A/H5N8) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI547684 A/Chicken/Netherlands/14015526/2014 (A/H5N8) segment 7 (MP) 1797.9 0.000000e+00 979/982 (99%)
EPI558012 A/duck/England/36038/14 (A/H5N8) segment 7 (MP) 1792.4 0.000000e+00 978/982 (99%)
EPI558005 A/duck/England/36226/14 (A/H5N8) segment 7 (MP) 1792.4 0.000000e+00 978/982 (99%)
EPI553365 A/environment/Kagoshima/KU-ngr-H/2014 (A/H5N8) segment 7 (MP) 1792.4 0.000000e+00 978/982 (99%)
EPI548496 A/duck/Chiba/26-372-61/2014 (A/H5N8) segment 7 (MP) 1792.4 0.000000e+00 978/982 (99%)
EPI548488 A/duck/Chiba/26-372-48/2014 (A/H5N8) segment 7 (MP) 1792.4 0.000000e+00 978/982 (99%)
EPI547676 A/duck/England/36254/14 (A/H5N8) segment 7 (MP) 1792.4 0.000000e+00 978/982 (99%)
EPI555124 A/domestic duck/Germany-NI/R3468/2014 (A/H5N8) segment 7 (MP) 1790.5 0.000000e+00 975/978 (99%)
EPI553181 A/turkey/Italy/14VIR7898-10/2014 (A/H5N8) segment 7 (MP) 1790.5 0.000000e+00 975/978 (99%)
EPI548426 A/turkey/Germany-MV/R2472/2014 (A/H5N8) segment 7 (MP) 1790.5 0.000000e+00 975/978 (99%)
EPI542997 A/duck/Beijing/FS01/2013 (A/H5N8) segment 7 (MP) 1786.8 0.000000e+00 975/979 (99%)
EPI543005 A/duck/Beijing/FS01/2014 (A/H5N8) segment 7 (MP) 1781.3 0.000000e+00 974/979 (99%)
EPI431451 A/duck/Hebei/2/2011 (A/H5N2) segment 7 (MP) 1759.1 0.000000e+00 972/982 (98%)
EPI414241 A/duck/Jiangsu/1-15/2011 (A/H4N2) segment 7 (MP) 1753.6 0.000000e+00 971/982 (98%)
EPI398977 A/duck/Eastern China/1111/2011 (A/H5N2) segment 7 (MP) 1753.6 0.000000e+00 971/982 (98%)
EPI552763 A/eurasian wigeon/Netherlands/emc-1/2014 (A/H5N8) segment 7 (MP) 1711.1 0.000000e+00 946/955 (99%)
EPI475582 A/wild duck/Shandong/628/2011 (A/H5N1) segment 7 (MP) 1709.3 0.000000e+00 963/982 (98%)
EPI399963 A/duck/Jiangsu/m234/2012 (A/H5N2) segment 7 (MP) 1703.7 0.000000e+00 962/982 (97%)
EPI328891 A/duck/Eastern China/909/2009 (A/H5N1) segment 7 (MP) 1703.7 0.000000e+00 962/982 (97%)
EPI328875 A/duck/Eastern China/031/2009 (A/H5N5) segment 7 (MP) 1703.7 0.000000e+00 962/982 (97%)
EPI328867 A/duck/Eastern China/008/2008 (A/H5N5) segment 7 (MP) 1703.7 0.000000e+00 962/982 (97%)
EPI328883 A/duck/Eastern China/108/2008 (A/H5N1) segment 7 (MP) 1698.2 0.000000e+00 961/982 (97%)
EPI442028 A/quail/Jiangsu/k0104/2010 (A/H5N5) segment 7 (MP) 1692.7 0.000000e+00 960/982 (97%)
EPI398978 A/goose/Eastern China/1112/2011 (A/H5N2) segment 7 (MP) 1692.7 0.000000e+00 960/982 (97%)
EPI442004 A/goose/Shandong/k1204/2009 (A/H5N5) segment 7 (MP) 1681.6 0.000000e+00 959/983 (97%)
EPI431459 A/duck/Hebei/3/2011 (A/H5N2) segment 7 (MP) 1676.0 0.000000e+00 957/982 (97%)
EPI552779 A/chicken/Netherlands/emc-3/2014 (A/H5N8) segment 7 (MP) 1672.3 0.000000e+00 911/914 (99%)
EPI442020 A/duck/Jiangsu/k1203/2010 (A/H5N8) segment 7 (MP) 1670.5 0.000000e+00 956/982 (97%)
EPI493836 A/duck/Guangdong/wy24/2008 (A/H5N5) segment 7 (MP) 1665.0 0.000000e+00 955/982 (97%)
EPI493820 A/duck/Guangdong/wy11/2008 (A/H5N5) segment 7 (MP) 1665.0 0.000000e+00 955/982 (97%)
EPI442012 A/goose/Guangdong/k0103/2010 (A/H5N5) segment 7 (MP) 1665.0 0.000000e+00 957/984 (97%)
EPI280107 A/Shanghai/1/2006 (A/H5N1) segment 7 (MP) 1665.0 0.000000e+00 955/982 (97%)
EPI280099 A/Guangdong/1/2006 (A/H5N1) segment 7 (MP) 1665.0 0.000000e+00 955/982 (97%)
EPI227312 A/Mallard/Huadong/lk/2005 (A/H5N1) segment 7 (MP) 1665.0 0.000000e+00 955/982 (97%)
EPI164233 A/Sichuan/2/2006 (A/H5N1) segment 7 (MP) 1665.0 0.000000e+00 955/982 (97%)
EPI164225 A/Sichuan/1/2006 (A/H5N1) segment 7 (MP) 1665.0 0.000000e+00 955/982 (97%)
EPI111857 A/chicken/Guiyang/3923/2005 (A/H5N1) segment 7 (MP) 1665.0 0.000000e+00 955/982 (97%)
EPI106032 A/China/GD01/2006 (A/H5N1) segment 7 (MP) 1665.0 0.000000e+00 955/982 (97%)
EPI552771 A/eurasian wigeon/Netherlands/emc-2/2014 (A/H5N8) segment 7 (MP) 1661.3 0.000000e+00 907/911 (99%)
EPI493828 A/duck/Guangdong/wy19/2008 (A/H5N5) segment 7 (MP) 1659.4 0.000000e+00 955/983 (97%)
EPI399889 A/duck/HuBei/03/2010 (A/H5N5) segment 7 (MP) 1659.4 0.000000e+00 954/982 (97%)
EPI276073 A/shrike/Tibet/13/2006 (A/H5N1) segment 7 (MP) 1659.4 0.000000e+00 954/982 (97%)
EPI275985 A/duck/Hubei/49/2005 (A/H5N1) segment 7 (MP) 1659.4 0.000000e+00 954/982 (97%)
EPI275389 A/Anhui/2/2005 (A/H5N1) segment 7 (MP) 1659.4 0.000000e+00 954/982 (97%)
EPI251445 A/Anhui/1/2006 (A/H5N1) segment 7 (MP) 1659.4 0.000000e+00 954/982 (97%)
EPI251423 A/Sichuan/3/2006 (A/H5N1) segment 7 (MP) 1659.4 0.000000e+00 954/982 (97%)
EPI251419 A/Zhejiang/1/2006 (A/H5N1) segment 7 (MP) 1659.4 0.000000e+00 954/982 (97%)
EPI224780 A/Shanghai/1/2006 (A/H5N1) segment 7 (MP) 1659.4 0.000000e+00 954/982 (97%)
EPI167956 A/long-tailed shrike/Hong Kong/2762/2007 (A/H5N1) segment 7 (MP) 1659.4 0.000000e+00 954/982 (97%)
EPI164241 A/Anhui/2/2005 (A/H5N1) segment 7 (MP) 1659.4 0.000000e+00 954/982 (97%)
EPI164217 A/Anhui/1/2005 (A/H5N1) segment 7 (MP) 1659.4 0.000000e+00 954/982 (97%)
EPI127390 A/wild duck/Hunan/021/2005 (A/H5N1) segment 7 (MP) 1659.4 0.000000e+00 954/982 (97%)
EPI111872 A/duck/Guiyang/1558/2006 (A/H5N1) segment 7 (MP) 1659.4 0.000000e+00 954/982 (97%)
EPI111860 A/goose/Guiyang/4030/2005 (A/H5N1) segment 7 (MP) 1659.4 0.000000e+00 954/982 (97%)
EPI111674 A/duck/Hunan/5472/2005 (A/H5N1) segment 7 (MP) 1659.4 0.000000e+00 954/982 (97%)
EPI111656 A/goose/Shantou/3265/2006 (A/H5N1) segment 7 (MP) 1659.4 0.000000e+00 954/982 (97%)
EPI111644 A/goose/Guiyang/538/2006 (A/H5N1) segment 7 (MP) 1659.4 0.000000e+00 954/982 (97%)
EPI111632 A/chicken/Guiyang/4059/2005 (A/H5N1) segment 7 (MP) 1659.4 0.000000e+00 954/982 (97%)

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Wed Feb 11, 2015 12:43 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
1 2341 bp mRNA linear 10-FEB-2015
DEFINITION Influenza A virus (A/Goose/Taiwan/0104/2015(HSN2)) polymerase PB2 (PB2) gene, complete eds.

ACCESSION VERSION KEYWORDS SOURCE

ORGANISM


REFERENCE AUTHORS

TITLE JOURNAL
REFERENCE AUTHORS

TITLE JOURNAL
COMMENT FEATURES
source











gene




Viruses ; ssRNA negative-strand viruses ; Orthomyxoviridae; Influenzavirus A .
Viruses ; ssRNA negative-strand viruses; Orthomyxoviridae; Influenzavirus A.
Unclassified.
1 (bases 1 to 2341)
Lee,M. S. , Chen,L.H. , Liu,Y. P. , Chen,Y .P. , Li,W.C. , Lee, F. ,
Ting,L.J . and Lin, Y .L .
Avian influenza subtype HS in geese in Taiwan, 2015 Unpublished
2 (bases 1 to 2341)
Lee,M .S., Chen,L.H. , Liu,Y.P ., Chen,Y .P. , Li,W .C . , Lee, F. ,
Ting,L .J. and Lin , Y.L . Direct Submission
Submitted (10-FEB-2015) Epidemiology Research Department , National Institute for Anima l Health, Chung-Cheng Rd, Tansui, Taiwan 251 , Taiwan
##Assembly-Data-START##
Sequencing Technology : : Sanger dideoxy sequencing
##Assembly-Data- END##
Location/Qualifiers
1. . 2341
/organism= "Viruses; ssRNA negative-strand viruses ; Orthomyxoviridae; Influenzavirus A ."
/mol type="mRNA "
/strain= "A/Goose/Taiwan/0104/2015 "
/isolation source= "organ "
/host= "Goose "
/segment= "!"
/country= "Taiwan"
/collected by= "2015- 0l-09 "
/identified by= "RT-PCR "
/subtype= "HSN2" 1 . .2341
/gene= " PB2 "

CDS 28 . .2307
/gene= "PB2 "
/codon_start=l
/product= "polymerase PB2"
/translation= "MERIKELRDLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPA LRMKWMMAMKYPITADKRIMEMIPERNEQGQILWSKTNDAGSDRVMVSPLAVTWWNRN GPTISTVHYPKVYKTYFEKVERLKHGTFGPVHFRNQVKIRRRVDINPGHADLSAKEAQ DVIMEVVFPNEVGARILTSESQLTITKEKKEELQDCKIAPLMVAYMLERELVRKTRFL PVAGGTSSVYIEVLHLTQGTCWEQMYTPGGEVRNDDVDQSLIIAARNIVRRATVSADP LASLLEMCHSTQIGGIRMVDILRQNPTEEQAVDICKAAMGLRISSSFSFGGFTFKRTS GSSVKREEEVLTGNLQTLKIRVHEGYEEFTMVGRRATAILRKATRRLIQLIVSGRDEQ SIAEAIIVAMVFSQEDCMIKAVRGDLNFVNRANQRLNPMHQLLRHFQKDAKVLFQNWG IEPIDNVMGMIGMLPDMTPSTEMSLRGVRVSKMGVDEYSSTEKVVVSIDRFLRVRDQR GNVLLSPEEVSETQGTEKLTITYSSSMMWEINGPESVLVNTYQWIIRNWETVKIQWSQ DPTMLYNKMEFEPFQSLVPKAARGQYSGFVRTLFQQMRDVLGTFDTVQIIKLLPFAAA PPEQSRMQFSSLTVNVRGSGMRILVRGNSPVFNYNKTTKRLTVLGKDAGALTEDPDEG TAGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGEKANVLIGQGDVVLVMKRKRD SSILTDSQTATKRIRMAIN "

BASE COUNT ORIGIN

780 a 425 c 604 g 532 t

1
61
121
181
241
301
361
421
481
541
601

agcaaaagca ggtcaaatat attcaatatg gagagaataa aagaactaag agacttgatg tcgcagtctc gcactcgcga gatactgaca aaaaccactg tggaccatat ggccataatt aagaaataca catcaggaag acaggagaag aatcctgccc ttaggatgaa atggatgatg gcaatgaaat atccgattac agccgacaaa agaataatgg aaatgatccc cgaaagaaat gagcaaggtc aaattctctg gagcaaaaca aatgatgctg gatcagacag agtgatggta tcacctctgg ctgtaacatg gtggaataga aatgggccga cgataagtac agtccactat ccaaaggtct acaaaactta ctttgaaaaa gtcgaaaggt tgaaacatgg aacctttggt cctgttcact ttcgaaatca ggttaaaata cgccgcaggg ttgacataaa cccgggccat gcagatc:tca gtgccaaaga agcacaggat gtcatcatgg aggtcgtttt cccaaacgaa
'
gttggagcca ggatattgac atcagagtca caattaacaa taacaaagga gaagaaggag
gagcttcagg actgtaaaat cgctcctttg atggtggcat acatgttgga gagagaactg

661 gttcgcaaaa ccagatttct accagtagct ggcggaacaa gcagcgtgta tatcgaggta

721
781
841

ttgcatttga ctcaggggac ctgctgggaa caaatgtaca caccgggagg ggaggtgaga aatgatgatg tcgatcagag tttgatcatt gctgctagaa atattgttag gagggcaaca gtatcagca_g •acccgt tggc ttcgctcttg gagatgtgcc atagtacaca aattggcggg

901 ataagaatgg tggatattct tagacagaac ccaacagaag agcaagctgt ggatatatgc 961 aaagcagcta tgggtttgag aatcagttca tccttcagct ttggaggttt cactttcaaa 1021 agaacaagtg ggtcatctgt caaaagagaa gaagaagtgc tcacaggcaa cctccaaaca 1081 ttgaaaataa gagtacatga agggtatgaa gaattcacaa tggttgggcg aagagccaca 1141 gccattctaa ggaaggcaac cagaaggctg atccaattaa tagtgagtgg aagagatgag 1201 cagtcaatcg ctgaagcgat tatagtggca atggttttct cacaagagga ttgcatgata 1261 aaggcagtac gaggtgattt aaactttgtt aacagagcaa atcagcggct aaatcctatg 1321 catcaacttc tgaggcattt ccaaaaggat gcaaaggtgc tgtttcaaaa ctggggaatt 1381 gaaccaatcg ataatgtcat ggggatgatc ggaatgctgc ctgacatgac ccccagcaca 1441 gagatgtcac tgagaggagt aagagtcagt aaaatgggag tggatgaata ttccagtact 1501 gaaaaagtgg tcgtgagcat tgatcgtttc ttgagagtcc gagatcagag gggaaacgta 1561 ctcttgtctc ctgaggaagt tagtgaaaca cagggaacag agaaactgac gataacatat 1621 tcatcgtcta tgatgtggga aatcaatggt ccggaatcag tgctagtcaa cacataccaa 1681 tggatcatta gaaattggga aactgtgaag attcaatggt cccaagaccc tacaatgttg 1741 tacaataaga tggagtttga gccattccaa tccttggtgc ccaaggctgc cagaggtcag 1801 tatagtggat ttgttaggac gttattccaa cagatgcgtg atgtgctggg gacatttgac 1861 actgtccaga taataaagct cctaccattt gcagcagccc caccagaaca gagtaggatg 1921 cagttctctt ctttgactgt gaatgtaaga ggttcaggaa tgagaatcct tgtgagaggc 1981 aactcccctg tgttcaacta caacaagaca accaagagac tcacagtcct tggaaaggat 2041 gcaggtgcat tgacagaaga tccagatgag ggaacagcag gagtggaatc tgcggtatta 2101 agaggatttc taattctggg caaagaagac aaaagatatg gaccagcatt gagcatcaat 2161 gaattgagca atcttgcgaa aggggagaag gctaatgtgt tgatagggca aggagacgtg 2221 gtgttggtaa tgaaacggaa acgggactct agcatactta ctgacagcca gacagcgacc 2281 aaaaggattc ggatggccat caattagtgt cgaattgttt aaaaacgacc ttgtttctac
2341 t

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Wed Feb 11, 2015 12:44 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
EPI446495 A/wild goose/Dongting/C1037/2011 (A/H12N8) segment 1 (PB2) 3956.6 0.000000e+00 2235/2281 (97%)
EPI493021 A/wild waterfowl/Dongting/C2383/2012 (A/H1N2) segment 1 (PB2) 3923.4 0.000000e+00 2228/2280 (97%)
EPI469137 A/duck/Jiangxi/22537/2012 (A/H11N9) segment 1 (PB2) 3912.3 0.000000e+00 2226/2280 (97%)
EPI469138 A/duck/Jiangxi/22597/2012 (A/H11N9) segment 1 (PB2) 3901.2 0.000000e+00 2224/2280 (97%)
EPI513369 A/mallard/Sweden/101900/2009 (A/H4N3) segment 1 (PB2) 3856.9 0.000000e+00 2216/2280 (97%)
EPI375105 A/wild bird/Korea/A330/09 (A/H7N7) segment 1 (PB2) 3851.4 0.000000e+00 2215/2280 (97%)
EPI513202 A/mallard/Sweden/124418/2010 (A/H4N6) segment 1 (PB2) 3840.3 0.000000e+00 2213/2280 (97%)
EPI513195 A/mallard/Sweden/124228/2010 (A/H4N6) segment 1 (PB2) 3840.3 0.000000e+00 2213/2280 (97%)
EPI375106 A/wild bird/Korea/A331/09 (A/H7N7) segment 1 (PB2) 3836.6 0.000000e+00 2207/2272 (97%)
EPI375107 A/pintail/Korea/1173/09 (A/H7N7) segment 1 (PB2) 3820.0 0.000000e+00 2206/2275 (96%)
EPI508029 A/wild duck/Korea/SH19-47/2010 (A/H7N9) segment 1 (PB2) 3790.4 0.000000e+00 2204/2280 (96%)
EPI508028 A/wild duck/Korea/SH19-44/2010 (A/H7N9) segment 1 (PB2) 3790.4 0.000000e+00 2204/2280 (96%)
EPI508027 A/wild duck/Korea/SH19-27/2010 (A/H7N9) segment 1 (PB2) 3790.4 0.000000e+00 2204/2280 (96%)
EPI508026 A/wild duck/Korea/SH19-50/2010 (A/H7N9) segment 1 (PB2) 3788.6 0.000000e+00 2203/2279 (96%)
EPI461626 A/duck/Hunan/S1256/2012 (A/H3N8) segment 1 (PB2) 3788.6 0.000000e+00 2203/2280 (96%)
EPI222084 A/garganey/Altai/1213/2007 (A/H5N2) segment 1 (PB2) 3784.9 0.000000e+00 2203/2280 (96%)
EPI508034 A/wild duck/Korea/MHC39-26/2011(H7N9) (A/H7N9) segment 1 (PB2) 3773.8 0.000000e+00 2201/2280 (96%)
EPI508033 A/wild duck/Korea/MHC39-13/2011(H7N9) (A/H7N9) segment 1 (PB2) 3773.8 0.000000e+00 2201/2280 (96%)
EPI508031 A/wild duck/Korea/MHC35-41/2011 (A/H7N9) segment 1 (PB2) 3773.8 0.000000e+00 2201/2280 (96%)
EPI221960 A/environment/Dongting Lake/Hunan/3-9/2007 (A/H10N8) segment 1 (PB2) 3773.8 0.000000e+00 2201/2280 (96%)
EPI221952 A/water/Dongting Lake/Hunan/3-9/2007 (A/H10N8) segment 1 (PB2) 3773.8 0.000000e+00 2201/2280 (96%)
EPI544771 A/chicken/Shanghai/LPM2/2013 (A/H3N2) segment 1 (PB2) 3768.3 0.000000e+00 2201/2281 (96%)
EPI508032 A/wild duck/Korea/MHC35-25/2011 (A/H7N9) segment 1 (PB2) 3768.3 0.000000e+00 2200/2280 (96%)
EPI221968 A/environment/Dongting Lake/Hunan/3-9/2007 (A/H10N8) segment 1 (PB2) 3768.3 0.000000e+00 2201/2281 (96%)
EPI401308 A/duck/Korea/DY104/2007 (A/H4N6) segment 1 (PB2) 3762.7 0.000000e+00 2199/2280 (96%)
EPI221976 A/environment/Dongting Lake/Hunan/3-9/2007 (A/H10N8) segment 1 (PB2) 3762.7 0.000000e+00 2200/2281 (96%)
EPI375109 A/wild bird/Korea/A3/11 (A/H7N9) segment 1 (PB2) 3759.1 0.000000e+00 2194/2273 (96%)
EPI372328 A/shoveler/Egypt/00134-NAMRU3/2005 (A/H1N1) segment 1 (PB2) 3753.5 0.000000e+00 2197/2280 (96%)
EPI515121 A/duck/Vietnam/LBM533/2013 (A/H3N6) segment 1 (PB2) 3751.7 0.000000e+00 2197/2280 (96%)
EPI508035 A/wild duck/Korea/SH41-33/2011 (A/H7N7) segment 1 (PB2) 3751.7 0.000000e+00 2197/2280 (96%)
EPI375111 A/spot-billed duck/Korea/447/11 (A/H7N9) segment 1 (PB2) 3751.7 0.000000e+00 2191/2271 (96%)
EPI375110 A/wild bird/Korea/A4/11 (A/H7N3) segment 1 (PB2) 3748.0 0.000000e+00 2191/2272 (96%)
EPI514962 A/mallard/Sweden/79391/2008 (A/H4N2) segment 1 (PB2) 3746.1 0.000000e+00 2196/2280 (96%)
EPI513902 A/mallard/Sweden/79308/2008 (A/H4N2) segment 1 (PB2) 3746.1 0.000000e+00 2196/2280 (96%)
EPI513895 A/mallard/Sweden/79230/2008 (A/H0) segment 1 (PB2) 3746.1 0.000000e+00 2196/2280 (96%)
EPI513865 A/mallard/Sweden/79367/2008 (A/H4N6) segment 1 (PB2) 3746.1 0.000000e+00 2196/2280 (96%)
EPI513851 A/mallard/Sweden/79332/2008 (A/H4N6) segment 1 (PB2) 3746.1 0.000000e+00 2196/2280 (96%)
EPI513828 A/mallard/Sweden/79328/2008 (A/H4N6) segment 1 (PB2) 3746.1 0.000000e+00 2196/2280 (96%)
EPI513826 A/mallard/Sweden/79956/2008 (A/H0) segment 1 (PB2) 3746.1 0.000000e+00 2196/2280 (96%)
EPI513805 A/mallard/Sweden/79412/2008 (A/H4N6) segment 1 (PB2) 3746.1 0.000000e+00 2196/2280 (96%)
EPI513798 A/mallard/Sweden/79388/2008 (A/H4N6) segment 1 (PB2) 3746.1 0.000000e+00 2196/2280 (96%)
EPI513760 A/mallard/Sweden/79981/2008 (A/H4N6) segment 1 (PB2) 3746.1 0.000000e+00 2196/2280 (96%)
EPI513728 A/mallard/Sweden/80078/2008 (A/H4N6) segment 1 (PB2) 3746.1 0.000000e+00 2196/2280 (96%)
EPI513707 A/mallard/Sweden/80051/2008 (A/H4N6) segment 1 (PB2) 3746.1 0.000000e+00 2196/2280 (96%)
EPI513690 A/mallard/Sweden/80173/2008 (A/H4N6) segment 1 (PB2) 3746.1 0.000000e+00 2196/2280 (96%)
EPI513676 A/mallard/Sweden/80148/2008 (A/H4N6) segment 1 (PB2) 3746.1 0.000000e+00 2196/2280 (96%)
EPI513669 A/mallard/Sweden/80127/2008 (A/H4N6) segment 1 (PB2) 3746.1 0.000000e+00 2196/2280 (96%)
EPI513662 A/mallard/Sweden/80114/2008 (A/H4N2) segment 1 (PB2) 3746.1 0.000000e+00 2196/2280 (96%)
EPI513646 A/mallard/Sweden/80260/2008 (A/H4N6) segment 1 (PB2) 3746.1 0.000000e+00 2196/2280 (96%)
EPI513610 A/mallard/Sweden/80178/2008 (A/H4N6) segment 1 (PB2) 3746.1 0.000000e+00 2196/2280 (96%)
EPI513596 A/mallard/Sweden/81019/2008 (A/H4N6) segment 1 (PB2) 3746.1 0.000000e+00 2196/2280 (96%)
EPI513565 A/mallard/Sweden/80299/2008 (A/H4N6) segment 1 (PB2) 3746.1 0.000000e+00 2196/2280 (96%)
EPI513887 A/mallard/Sweden/79187/2008 (A/H4N6) segment 1 (PB2) 3740.6 0.000000e+00 2195/2280 (96%)
EPI513791 A/mallard/Sweden/79375/2008 (A/H4N6) segment 1 (PB2) 3740.6 0.000000e+00 2195/2280 (96%)
EPI513781 A/mallard/Sweden/80010/2008 (A/H4N6) segment 1 (PB2) 3740.6 0.000000e+00 2195/2280 (96%)
EPI513774 A/mallard/Sweden/80009/2008 (A/H4N6) segment 1 (PB2) 3740.6 0.000000e+00 2195/2280 (96%)
EPI513767 A/mallard/Sweden/79998/2008 (A/H4N6) segment 1 (PB2) 3740.6 0.000000e+00 2195/2280 (96%)
EPI513714 A/mallard/Sweden/80063/2008 (A/H4N6) segment 1 (PB2) 3740.6 0.000000e+00 2195/2280 (96%)
EPI513700 A/mallard/Sweden/80014/2008 (A/H4N6) segment 1 (PB2) 3740.6 0.000000e+00 2195/2280 (96%)
EPI513617 A/mallard/Sweden/80185/2008 (A/H4N6) segment 1 (PB2) 3740.6 0.000000e+00 2195/2280 (96%)
EPI513581 A/mallard/Sweden/80389/2008 (A/H4N6) segment 1 (PB2) 3740.6 0.000000e+00 2195/2280 (96%)
EPI513573 A/mallard/Sweden/80348/2008 (A/H0) segment 1 (PB2) 3740.6 0.000000e+00 2195/2280 (96%)
EPI513241 A/mallard/Sweden/104925/2009 (A/H4N6) segment 1 (PB2) 3735.0 0.000000e+00 2194/2280 (96%)
EPI513174 A/mallard/Sweden/105012/2009 (A/H4N6) segment 1 (PB2) 3735.0 0.000000e+00 2194/2280 (96%)
EPI399891 A/aquatic bird/Korea/CN5/2009 (A/H6N5) segment 1 (PB2) 3735.0 0.000000e+00 2195/2281 (96%)
EPI314734 A/aquatic bird/Korea/CN5/2009 (A/H6N5) segment 1 (PB2) 3735.0 0.000000e+00 2195/2281 (96%)
EPI514904 A/mallard/Sweden/105093/2009 (A/H4N6) segment 1 (PB2) 3729.5 0.000000e+00 2193/2280 (96%)
EPI513550 A/mallard/Sweden/101010/2009 (A/H4N6) segment 1 (PB2) 3729.5 0.000000e+00 2193/2280 (96%)
EPI513518 A/mallard/Sweden/101524/2009 (A/H4N6) segment 1 (PB2) 3729.5 0.000000e+00 2193/2280 (96%)
EPI513511 A/mallard/Sweden/101504/2009 (A/H4N6) segment 1 (PB2) 3729.5 0.000000e+00 2193/2280 (96%)
EPI513497 A/mallard/Sweden/101329/2009 (A/H4N6) segment 1 (PB2) 3729.5 0.000000e+00 2193/2280 (96%)
EPI513472 A/mallard/Sweden/101640/2009 (A/H4N6) segment 1 (PB2) 3729.5 0.000000e+00 2193/2280 (96%)
EPI513391 A/mallard/Sweden/101642/2009 (A/H4N6) segment 1 (PB2) 3729.5 0.000000e+00 2193/2280 (96%)
EPI513383 A/mallard/Sweden/102024/2009 (A/H4N6) segment 1 (PB2) 3729.5 0.000000e+00 2193/2280 (96%)
EPI513348 A/mallard/Sweden/101785/2009 (A/H4N6) segment 1 (PB2) 3729.5 0.000000e+00 2193/2280 (96%)
EPI513338 A/mallard/Sweden/102157/2009 (A/H4N6) segment 1 (PB2) 3729.5 0.000000e+00 2193/2280 (96%)
EPI513331 A/mallard/Sweden/102124/2009 (A/H4N6) segment 1 (PB2) 3729.5 0.000000e+00 2193/2280 (96%)
EPI513324 A/mallard/Sweden/102114/2009 (A/H4N6) segment 1 (PB2) 3729.5 0.000000e+00 2193/2280 (96%)
EPI513317 A/mallard/Sweden/102056/2009 (A/H4N6) segment 1 (PB2) 3729.5 0.000000e+00 2193/2280 (96%)
EPI513310 A/mallard/Sweden/102045/2009 (A/H4N6) segment 1 (PB2) 3729.5 0.000000e+00 2193/2280 (96%)
EPI513303 A/mallard/Sweden/102029/2009 (A/H4N6) segment 1 (PB2) 3729.5 0.000000e+00 2193/2280 (96%)
EPI513248 A/mallard/Sweden/104931/2009 (A/H4N6) segment 1 (PB2) 3729.5 0.000000e+00 2193/2280 (96%)
EPI513220 A/mallard/Sweden/104793/2009 (A/H4N6) segment 1 (PB2) 3729.5 0.000000e+00 2193/2280 (96%)
EPI513213 A/mallard/Sweden/104690/2009 (A/H4N6) segment 1 (PB2) 3729.5 0.000000e+00 2193/2280 (96%)
EPI513181 A/mallard/Sweden/105137/2009 (A/H4N6) segment 1 (PB2) 3729.5 0.000000e+00 2193/2280 (96%)
EPI513130 A/mallard/Sweden/102250/2009 (A/H4N6) segment 1 (PB2) 3729.5 0.000000e+00 2193/2280 (96%)
EPI401294 A/wild duck/Korea/CSM4-28/2010 (A/H4N6) segment 1 (PB2) 3729.5 0.000000e+00 2193/2280 (96%)
EPI377639 A/northern shoveler/Georgia/1/2010 (A/H2N3) segment 1 (PB2) 3729.5 0.000000e+00 2193/2280 (96%)
EPI354433 A/chicken/Pakistan/NARC-16945/2010 (A/H3N1) segment 1 (PB2) 3729.5 0.000000e+00 2194/2281 (96%)
EPI316757 A/mallard/Czech Republic/13577-24K/2010 (A/H3N8) segment 1 (PB2) 3729.5 0.000000e+00 2193/2280 (96%)
EPI513465 A/mallard/Sweden/101632/2009 (A/H4N6) segment 1 (PB2) 3724.0 0.000000e+00 2192/2280 (96%)
EPI513458 A/mallard/Sweden/101603/2009 (A/H4N6) segment 1 (PB2) 3724.0 0.000000e+00 2192/2280 (96%)
EPI513451 A/mallard/Sweden/101602/2009 (A/H4N6) segment 1 (PB2) 3724.0 0.000000e+00 2192/2280 (96%)
EPI513444 A/mallard/Sweden/101565/2009 (A/H4N6) segment 1 (PB2) 3724.0 0.000000e+00 2192/2280 (96%)
EPI513437 A/mallard/Sweden/101564/2009 (A/H4N6) segment 1 (PB2) 3724.0 0.000000e+00 2192/2280 (96%)
EPI513419 A/mallard/Sweden/101733/2009 (A/H4N6) segment 1 (PB2) 3724.0 0.000000e+00 2192/2280 (96%)
EPI513398 A/mallard/Sweden/101654/2009 (A/H4N6) segment 1 (PB2) 3724.0 0.000000e+00 2192/2280 (96%)
EPI513362 A/mallard/Sweden/101831/2009 (A/H4N6) segment 1 (PB2) 3724.0 0.000000e+00 2192/2280 (96%)
EPI506541 A/duck/Thailand/CU-12326T/2012 (A/H11N2) segment 1 (PB2) 3724.0 0.000000e+00 2193/2281 (96%)
EPI513234 A/mallard/Sweden/104839/2009 (A/H4N6) segment 1 (PB2) 3718.4 0.000000e+00 2191/2280 (96%)

_________________
www.twitter.com/hniman


Top
 Profile  
 
PostPosted: Wed Feb 11, 2015 12:47 am 
Offline

Joined: Wed Aug 19, 2009 10:42 am
Posts: 56044
Location: Pittsburgh, PA USA
2 2340 bp mRNA linear 10-FEB-2015
DEFINITION Influenza A virus (A/Goose/Taiwan/0104/2015(HSN2)) polymerase PBl (PBl) gene, complete eds.

ACCESSION VERSION KEYWORDS SOURCE

ORGANISM


REFERENCE AUTHORS

TITLE JOURNAL
REFERENCE AUTHORS

TITLE JOURNAL
COMMENT FEATURES
source











gene CDS




Viruses ; ssRNA negative-strand viruses ; Orthomyxoviridae ; Influenzavirus A.
Viruses ; ssRNA negative-strand viruses ; Orthomyxoviridae; Influenzavirus A.
Unclassi fied.
1 (bases 1 to 2340)
Lee,M .S. , Chen, L.H. , Liu,Y. P. , Chen,Y. P. , Li , W. C. , Lee, F .,
Ting,L .J. and Lin , Y.L .
Avian influenza subtype HS in geese in Taiwan , 2015 Unpublished
2 (bases 1 to 2340)
Lee,M .S. , Chen,L.H. , Liu,Y .P. , Chen,Y .P. , Li ,W.C. , Lee, F. ,
Ting,L.J. and Lin,Y .L . Direct Submission
Submitted (10-FEB-2015) Epidemiology Research Department, National Institute for Animal Health, Chung-Cheng Rd , Tansui, Taiwan 251, Taiwan
##Assembly-Data -START##
Sequencing Technology :: Sanger dideoxy sequencing
##Assembly-Data- END##
Location/Qualifiers
1. . 2340
/organism = "Viruses ; ssRNA negative-strand viruses; Orthomyxoviridae ; Influenzavirus A. "
/mol type= "mRNA "
/str-;;_-in= "A/Goose/Taiwan/0104/2015"
/isolation_source= "organ "
/host= "Goose "
/segment = "2 "
/country="Taiwan"
/collected_by= "2015- 01-09"
/identified_by= "RT-PCR "
/subtype= "H5N2" 1 . .2340
/gene= "PBl" 24 ..2297
/gene= "PBl"
/codon start=l
/product= "polymerase PBl"
/translation= "MDVNPTLLFLKVPAQNAISTTFPYTGDPPYSHGTGTGYTMDTVN RTHQYSERGKWTTNTETGAPQLNPIDGPLPEDNEPSGYAQTDCVLEAMAFLEESHPGI FENSCLETMEVVQQTRVDKLTQGRQTYDWTLNRNQPAATALANTIEVFRSNGMTANES GRLIDFLKDVMESMDKEEMEITTHFQRKRRVRDNMTKKMVTQRTIGKKKQRLNKRSYL IRALTLNTMTKDAERGKLKRRAIATPGMQIRGFVYFVETLARSICEKLEQSGLPVGGN










gene CDS




BASE COUNT ORIGIN

EKKAKLANVVRKMMTNSQDTELSFTITGDNTKWNENQNPRMFLAMITYITRNQPEWFR NVLSIAPIMFSNKMARLGKGYMFESKSMKLRTQIPAEMLANIDLKYFNESTRKKIEKI RPLLIDGTASLSPGMMMGMFNMLSTV LGVSILNLGQKRYTKTTYWWD GLQSSDDFALI VNAPNHEGIQAGVNRFYRTCKLVGINMSKKKSYINRTGTFEFTSFFYRYGFVANFSME LPSFGVSGINESADMSIGVTVIKNNMINNDLGPATAQMALQLFIKDYRYTYRCHRGDT QIQTRRSFELKKLWEQTRSKAGLLVSDGGPNLYNIRN LHIPEVCLKWELMDEDYQGRL CNPLNPFVSHKEIESVNNAVVMPAHGPAKSMEYDAVATTHSWIPKRNRSILNTSQRGI LEDEQMYQKCCSLFEKFFPSSSYRRPVGISSMVEAMMSRARIDARIDFESGRIKKEEF AEIMKICSTIEELRRQK "
118 . .390
/gene= "PB1-F2" 118 ..390
/gene= "PB1- F2 "
/codon start=l
/product= " PB1- F2 protein "
/translation= "MEQGQDTPWTQSTEHINTQKGESGQQTQKPERLNSTQLMDHYLR TTSQADTHKQIAYWKQW LSLKNPTQGSLKTLVLKRWKSFSKQEWTN"
813 a 474 c 543 g 510 t

1 agcaaaagca ggcaaccatt tgaatggatg tcaatccgac tttacttttc ttaaaagtgc
61 cagcgcaaaa tgctataagc actacattcc cttacactgg agatcctcca tatagccatg
121 gaacagggac aggatacacc atggacacag tcaacagaac acatcaatac tcagaaaggg
181 gaaagtggac aacaaacaca gaaaccggag cgcctcaact caacccaatt gatggaccat
241 tacctgagga caacgagcca agcggatacg cacaaacaga ttgcgtattg gaagcaatgg
301 ctttccttga agaatcccac ccagggatct ttgaaaactc ttgtcttgaa acgatggaag
361 tcgttcagca aacaagagtg gacaaactaa cccaaggtcg ccagacttat gactggacac
421 taaatagaaa tcaaccagct gcaactgctt tggccaatac tatagaggtc ttcagatcga
481 acggtatgac agccaatgag tcagggagat taatagattt cctcaaggat gtgatggaat
541 caatggataa agaagaaatg gaaataacaa cacatttcca gagaaagaga agagtgagag 601 acaacatgac caagaagatg gtcacacaaa gaacaatagg gaagaagaag cagaggctga 661 acaagaggag ttatttaata agagcactga cactgaacac aatgacaaaa gatgcagaac 721 ggggcaaatt gaagaggcga gcaattgcaa cacctgggat gcagattaga ggattcgtgt 781 actttgttga aacactagcg aggagcattt gtgagaaact cgaacaatct ggactccctg 841 ttggagggaa tgaaaagaag gctaaattag caaatgtcgt gagaaagatg atgactaact 901 cacaagacac agagctctct ttcacaatca ctggagacaa caccaaatgg aatgagaatc 961 agaatcctcg gatgtttttg gcaatgataa catacatcac aagaaaccaa cctgaatggt 1021 ttagaaatgt cttgagcatt gcccctataa tgttctcaaa caaaatggcg agattaggaa 1081 aaggatacat gtttgaaagt aagagcatga agctacggac acaaatacca gcagaaatgc 1141 ttgcaaacat tgacttgaaa tacttcaacg agtcaacaag aaagaaaatc gagaagataa 1201 gacctttgct gattgatggc acagcctcac tgagtcctgg aatgatgatg ggcatgttca 1261 atatgctgag cacagtatta ggagtctcaa tcctgaatct tggacaaaaa aggtacacca 1321 aaaccacata ctggtgggat ggactccaat cctctgatga cttcgctctt atagtgaacg 1381 caccgaatca cgagggaata caagcagggg tgaataggtt ctataggact tgcaaactgg 1441 ttgggatcaa catgagcaaa aagaagtctt acataaatcg aacaggaaca tttgaattca 1501 caagcttttt ctaccgctac ggatttgtag ccaacttcag catggagtta cccagcttcg 1561 gagtgtctgg aatcaatgaa tcagccgaca tgagcattgg agtgacagtg ataaagaaca 1621 atatgataaa caatgacctt ggaccagcaa cagctcagat ggctcttcaa ttattcatca 1681 aagactatag atacacatac cgatgccaca gaggcgatac acaaattcaa acgaggagat 1741 cattcgagct gaagaagcta tgggagcaga cccgttcaaa agcagggctg ttggtatcag 1801 atggagggcc aaacctatac aacatccgga atctccacat cccagaggtc tgtttgaaat 1861 gggaactgat ggatgaagat taccagggca ggctgtgtaa tcctctgaac ccgtttgtca 1921 gtcataagga aattgaatcc gtgaacaacg ctgtggtgat gccagcccat ggtccagcca 1981 agagcatgga atatgatgct gttgcgacta cacattcatg gattcccaag agaaaccgtt 2041 ccattctcaa taccagccaa aggggaatcc ttgaggatga gcagatgtac cagaagtgct 2101 gcagtctatt cgagaaattc ttccccagta gttcatacag gaggccagtt ggaatttcca 2161 gcatggtgga ggccatgatg tctagggccc gaattgatgc acgcattgat ttcgagtctg 2221 gaaggattaa gaaagaagag tttgctgaga tcatgaagat ctgttccacc attgaagagc 2281 tcagacggca aaaatagtga atttagcttg tccttcatga gaaaatgcct tgtttctact

_________________
www.twitter.com/hniman


Top
 Profile  
 
Display posts from previous:  Sort by  
Post new topic Reply to topic  [ 26 posts ]  Go to page 1, 2, 3  Next

All times are UTC - 5 hours [ DST ]


Who is online

Users browsing this forum: Google [Bot], Yahoo [Bot] and 42 guests


You cannot post new topics in this forum
You cannot reply to topics in this forum
You cannot edit your posts in this forum
You cannot delete your posts in this forum
You cannot post attachments in this forum

Search for:
Jump to:  
cron
Powered by phpBB® Forum Software © phpBB Group